Acta Crystallographica Section D
Acta Crystallographica
Section D
STRUCTURAL BIOLOGY
IUCr
IT
WDC
search IUCr Journals
home
archive
editors
for authors
for readers
submit
subscribe
open access
journal menu
home
archive
editors
for authors
for readers
submit
subscribe
open access
3D view
STRUCTURAL
BIOLOGY
Volume 75
|
Part 6
|
June 2019
|
Pages 578–591
https://doi.org/10.1107/S2059798319006910
Open
access
ISSN: 2059-7983
My images
view article
STRUCTURAL
BIOLOGY
Volume 75
|
Part 6
|
June 2019
|
Pages 578–591
https://doi.org/10.1107/S2059798319006910
Open
access
ISSN: 2059-7983
Visualization options
Jmol (JAVA applet)
JSmol (HTML5 version of Jmol)
CIFmol (light-weight HTML5 CIF viewer)
Follow Acta Cryst. D
E-alerts
twitter.com
Facebook
RSS
Please wait...
...
Generating image - please wait
3D viewers
Jmol (JAVA applet)
JSmol (HTML5 version of Jmol)
CIFmol (light-weight CIF viewer)
remember my choice
data_6GT6 # _entry.id 6GT6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6GT6 pdb_00006gt6 10.2210/pdb6gt6/pdb WWPDB D_1200010427 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 2 0 2020-07-29 3 'Structure model' 2 1 2024-01-17 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Derived calculations' 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Structure summary' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Database references' 9 3 'Structure model' 'Refinement description' 10 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' entity 4 2 'Structure model' pdbx_branch_scheme 5 2 'Structure model' pdbx_chem_comp_identifier 6 2 'Structure model' pdbx_entity_branch 7 2 'Structure model' pdbx_entity_branch_descriptor 8 2 'Structure model' pdbx_entity_branch_link 9 2 'Structure model' pdbx_entity_branch_list 10 2 'Structure model' pdbx_entity_nonpoly 11 2 'Structure model' pdbx_nonpoly_scheme 12 2 'Structure model' pdbx_struct_assembly_gen 13 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 14 2 'Structure model' refine 15 2 'Structure model' struct_asym 16 2 'Structure model' struct_conn 17 2 'Structure model' struct_site 18 2 'Structure model' struct_site_gen 19 3 'Structure model' chem_comp 20 3 'Structure model' chem_comp_atom 21 3 'Structure model' chem_comp_bond 22 3 'Structure model' database_2 23 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_asym_id' 2 2 'Structure model' '_atom_site.auth_seq_id' 3 2 'Structure model' '_atom_site.label_asym_id' 4 2 'Structure model' '_atom_site.label_entity_id' 5 2 'Structure model' '_chem_comp.name' 6 2 'Structure model' '_chem_comp.type' 7 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 8 2 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 9 2 'Structure model' '_refine.pdbx_diffrn_id' 10 2 'Structure model' '_struct_conn.pdbx_role' 11 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 12 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 14 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 15 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 16 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 17 3 'Structure model' '_chem_comp.pdbx_synonyms' 18 3 'Structure model' '_database_2.pdbx_DOI' 19 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GT6 _pdbx_database_status.recvd_initial_deposition_date 2018-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pathak, M.' 1 ? 'Emsley, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 578 _citation.page_last 591 _citation.title 'Crystal structures of the recombinant beta-factor XIIa protease with bound Thr-Arg and Pro-Arg substrate mimetics.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798319006910 _citation.pdbx_database_id_PubMed 31205020 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pathak, M.' 1 ? primary 'Manna, R.' 2 ? primary 'Li, C.' 3 ? primary 'Kaira, B.G.' 4 0000-0003-0102-5966 primary 'Hamad, B.K.' 5 ? primary 'Belviso, B.D.' 6 0000-0003-2880-1064 primary 'Bonturi, C.R.' 7 ? primary 'Dreveny, I.' 8 0000-0003-2256-642X primary 'Fischer, P.M.' 9 ? primary 'Dekker, L.V.' 10 0000-0001-5247-3297 primary 'Oliva, M.L.V.' 11 ? primary 'Emsley, J.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Coagulation factor XII' 27372.729 1 3.4.21.38 ? ? ? 2 branched man 'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542 1 ? ? ? ? 3 non-polymer man GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer man 'SULFATE ION' 96.063 1 ? ? ? ? 5 non-polymer man CYSTEINE 121.158 1 ? ? ? ? 6 water nat water 18.015 59 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Hageman factor,HAF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEA FSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERC SAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREH TVSTRTGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;VVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEA FSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERC SAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREH TVSTRTGHHHHHH ; _entity_poly.pdbx_strand_id B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'SULFATE ION' SO4 5 CYSTEINE CYS 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 LEU n 1 6 VAL n 1 7 ALA n 1 8 LEU n 1 9 ARG n 1 10 GLY n 1 11 ALA n 1 12 HIS n 1 13 PRO n 1 14 TYR n 1 15 ILE n 1 16 ALA n 1 17 ALA n 1 18 LEU n 1 19 TYR n 1 20 TRP n 1 21 GLY n 1 22 HIS n 1 23 SER n 1 24 PHE n 1 25 CYS n 1 26 ALA n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ALA n 1 32 PRO n 1 33 CYS n 1 34 TRP n 1 35 VAL n 1 36 LEU n 1 37 THR n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 LEU n 1 43 GLN n 1 44 ASP n 1 45 ARG n 1 46 PRO n 1 47 ALA n 1 48 PRO n 1 49 GLU n 1 50 ASP n 1 51 LEU n 1 52 THR n 1 53 VAL n 1 54 VAL n 1 55 LEU n 1 56 GLY n 1 57 GLN n 1 58 GLU n 1 59 ARG n 1 60 ARG n 1 61 ASN n 1 62 HIS n 1 63 SER n 1 64 CYS n 1 65 GLU n 1 66 PRO n 1 67 CYS n 1 68 GLN n 1 69 THR n 1 70 LEU n 1 71 ALA n 1 72 VAL n 1 73 ARG n 1 74 SER n 1 75 TYR n 1 76 ARG n 1 77 LEU n 1 78 HIS n 1 79 GLU n 1 80 ALA n 1 81 PHE n 1 82 SER n 1 83 PRO n 1 84 VAL n 1 85 SER n 1 86 TYR n 1 87 GLN n 1 88 HIS n 1 89 ASP n 1 90 LEU n 1 91 ALA n 1 92 LEU n 1 93 LEU n 1 94 ARG n 1 95 LEU n 1 96 GLN n 1 97 GLU n 1 98 ASP n 1 99 ALA n 1 100 ASP n 1 101 GLY n 1 102 SER n 1 103 CYS n 1 104 ALA n 1 105 LEU n 1 106 LEU n 1 107 SER n 1 108 PRO n 1 109 TYR n 1 110 VAL n 1 111 GLN n 1 112 PRO n 1 113 VAL n 1 114 CYS n 1 115 LEU n 1 116 PRO n 1 117 SER n 1 118 GLY n 1 119 ALA n 1 120 ALA n 1 121 ARG n 1 122 PRO n 1 123 SER n 1 124 GLU n 1 125 THR n 1 126 THR n 1 127 LEU n 1 128 CYS n 1 129 GLN n 1 130 VAL n 1 131 ALA n 1 132 GLY n 1 133 TRP n 1 134 GLY n 1 135 HIS n 1 136 GLN n 1 137 PHE n 1 138 GLU n 1 139 GLY n 1 140 ALA n 1 141 GLU n 1 142 GLU n 1 143 TYR n 1 144 ALA n 1 145 SER n 1 146 PHE n 1 147 LEU n 1 148 GLN n 1 149 GLU n 1 150 ALA n 1 151 GLN n 1 152 VAL n 1 153 PRO n 1 154 PHE n 1 155 LEU n 1 156 SER n 1 157 LEU n 1 158 GLU n 1 159 ARG n 1 160 CYS n 1 161 SER n 1 162 ALA n 1 163 PRO n 1 164 ASP n 1 165 VAL n 1 166 HIS n 1 167 GLY n 1 168 SER n 1 169 SER n 1 170 ILE n 1 171 LEU n 1 172 PRO n 1 173 GLY n 1 174 MET n 1 175 LEU n 1 176 CYS n 1 177 ALA n 1 178 GLY n 1 179 PHE n 1 180 LEU n 1 181 GLU n 1 182 GLY n 1 183 GLY n 1 184 THR n 1 185 ASP n 1 186 ALA n 1 187 CYS n 1 188 GLN n 1 189 GLY n 1 190 ASP n 1 191 SER n 1 192 GLY n 1 193 GLY n 1 194 PRO n 1 195 LEU n 1 196 VAL n 1 197 CYS n 1 198 GLU n 1 199 ASP n 1 200 GLN n 1 201 ALA n 1 202 ALA n 1 203 GLU n 1 204 ARG n 1 205 ARG n 1 206 LEU n 1 207 THR n 1 208 LEU n 1 209 GLN n 1 210 GLY n 1 211 ILE n 1 212 ILE n 1 213 SER n 1 214 TRP n 1 215 GLY n 1 216 SER n 1 217 GLY n 1 218 CYS n 1 219 GLY n 1 220 ASP n 1 221 ARG n 1 222 ASN n 1 223 LYS n 1 224 PRO n 1 225 GLY n 1 226 VAL n 1 227 TYR n 1 228 THR n 1 229 ASP n 1 230 VAL n 1 231 ALA n 1 232 TYR n 1 233 TYR n 1 234 LEU n 1 235 ALA n 1 236 TRP n 1 237 ILE n 1 238 ARG n 1 239 GLU n 1 240 HIS n 1 241 THR n 1 242 VAL n 1 243 SER n 1 244 THR n 1 245 ARG n 1 246 THR n 1 247 GLY n 1 248 HIS n 1 249 HIS n 1 250 HIS n 1 251 HIS n 1 252 HIS n 1 253 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene F12 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Fruit Fly' _entity_src_gen.pdbx_host_org_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7227 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1a_1-5]/1-1-2/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-Manp]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 MAN C1 O1 2 NAG O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose 'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 16 16 VAL VAL B . n A 1 2 VAL 2 17 17 VAL VAL B . n A 1 3 GLY 3 18 18 GLY GLY B . n A 1 4 GLY 4 19 19 GLY GLY B . n A 1 5 LEU 5 20 20 LEU LEU B . n A 1 6 VAL 6 21 21 VAL VAL B . n A 1 7 ALA 7 22 22 ALA ALA B . n A 1 8 LEU 8 23 23 LEU LEU B . n A 1 9 ARG 9 24 24 ARG ARG B . n A 1 10 GLY 10 25 25 GLY GLY B . n A 1 11 ALA 11 26 26 ALA ALA B . n A 1 12 HIS 12 27 27 HIS HIS B . n A 1 13 PRO 13 28 28 PRO PRO B . n A 1 14 TYR 14 29 29 TYR TYR B . n A 1 15 ILE 15 30 30 ILE ILE B . n A 1 16 ALA 16 31 31 ALA ALA B . n A 1 17 ALA 17 32 32 ALA ALA B . n A 1 18 LEU 18 33 33 LEU LEU B . n A 1 19 TYR 19 34 34 TYR TYR B . n A 1 20 TRP 20 37 37 TRP TRP B . n A 1 21 GLY 21 38 38 GLY GLY B . n A 1 22 HIS 22 39 39 HIS HIS B . n A 1 23 SER 23 40 40 SER SER B . n A 1 24 PHE 24 41 41 PHE PHE B . n A 1 25 CYS 25 42 42 CYS CYS B . n A 1 26 ALA 26 43 43 ALA ALA B . n A 1 27 GLY 27 44 44 GLY GLY B . n A 1 28 SER 28 45 45 SER SER B . n A 1 29 LEU 29 46 46 LEU LEU B . n A 1 30 ILE 30 47 47 ILE ILE B . n A 1 31 ALA 31 48 48 ALA ALA B . n A 1 32 PRO 32 49 49 PRO PRO B . n A 1 33 CYS 33 50 50 CYS CYS B . n A 1 34 TRP 34 51 51 TRP TRP B . n A 1 35 VAL 35 52 52 VAL VAL B . n A 1 36 LEU 36 53 53 LEU LEU B . n A 1 37 THR 37 54 54 THR THR B . n A 1 38 ALA 38 55 55 ALA ALA B . n A 1 39 ALA 39 56 56 ALA ALA B . n A 1 40 HIS 40 57 57 HIS HIS B . n A 1 41 CYS 41 58 58 CYS CYS B . n A 1 42 LEU 42 59 59 LEU LEU B . n A 1 43 GLN 43 60 60 GLN GLN B . n A 1 44 ASP 44 60 60 ASP ASP B A n A 1 45 ARG 45 60 60 ARG ARG B B n A 1 46 PRO 46 60 60 PRO PRO B C n A 1 47 ALA 47 60 60 ALA ALA B D n A 1 48 PRO 48 61 61 PRO PRO B . n A 1 49 GLU 49 62 62 GLU GLU B . n A 1 50 ASP 50 63 63 ASP ASP B . n A 1 51 LEU 51 64 64 LEU LEU B . n A 1 52 THR 52 65 65 THR THR B . n A 1 53 VAL 53 66 66 VAL VAL B . n A 1 54 VAL 54 67 67 VAL VAL B . n A 1 55 LEU 55 68 68 LEU LEU B . n A 1 56 GLY 56 69 69 GLY GLY B . n A 1 57 GLN 57 70 70 GLN GLN B . n A 1 58 GLU 58 71 71 GLU GLU B . n A 1 59 ARG 59 72 72 ARG ARG B . n A 1 60 ARG 60 73 73 ARG ARG B . n A 1 61 ASN 61 74 74 ASN ASN B . n A 1 62 HIS 62 75 75 HIS HIS B . n A 1 63 SER 63 76 76 SER SER B . n A 1 64 CYS 64 77 77 CYS CYS B . n A 1 65 GLU 65 78 78 GLU GLU B . n A 1 66 PRO 66 79 79 PRO PRO B . n A 1 67 CYS 67 80 80 CYS CYS B . n A 1 68 GLN 68 81 81 GLN GLN B . n A 1 69 THR 69 82 82 THR THR B . n A 1 70 LEU 70 83 83 LEU LEU B . n A 1 71 ALA 71 84 84 ALA ALA B . n A 1 72 VAL 72 85 85 VAL VAL B . n A 1 73 ARG 73 86 86 ARG ARG B . n A 1 74 SER 74 87 87 SER SER B . n A 1 75 TYR 75 88 88 TYR TYR B . n A 1 76 ARG 76 89 89 ARG ARG B . n A 1 77 LEU 77 90 90 LEU LEU B . n A 1 78 HIS 78 91 91 HIS HIS B . n A 1 79 GLU 79 92 92 GLU GLU B . n A 1 80 ALA 80 93 93 ALA ALA B . n A 1 81 PHE 81 94 94 PHE PHE B . n A 1 82 SER 82 95 95 SER SER B . n A 1 83 PRO 83 96 96 PRO PRO B . n A 1 84 VAL 84 97 97 VAL VAL B . n A 1 85 SER 85 98 98 SER SER B . n A 1 86 TYR 86 99 99 TYR TYR B . n A 1 87 GLN 87 100 100 GLN GLN B . n A 1 88 HIS 88 101 101 HIS HIS B . n A 1 89 ASP 89 102 102 ASP ASP B . n A 1 90 LEU 90 103 103 LEU LEU B . n A 1 91 ALA 91 104 104 ALA ALA B . n A 1 92 LEU 92 105 105 LEU LEU B . n A 1 93 LEU 93 106 106 LEU LEU B . n A 1 94 ARG 94 107 107 ARG ARG B . n A 1 95 LEU 95 108 108 LEU LEU B . n A 1 96 GLN 96 109 109 GLN GLN B . n A 1 97 GLU 97 109 109 GLU GLU B A n A 1 98 ASP 98 109 109 ASP ASP B B n A 1 99 ALA 99 109 109 ALA ALA B C n A 1 100 ASP 100 109 109 ASP ASP B D n A 1 101 GLY 101 109 109 GLY GLY B E n A 1 102 SER 102 110 110 SER SER B . n A 1 103 CYS 103 111 111 CYS CYS B . n A 1 104 ALA 104 112 112 ALA ALA B . n A 1 105 LEU 105 113 113 LEU LEU B . n A 1 106 LEU 106 114 114 LEU LEU B . n A 1 107 SER 107 115 115 SER SER B . n A 1 108 PRO 108 116 116 PRO PRO B . n A 1 109 TYR 109 117 117 TYR TYR B . n A 1 110 VAL 110 118 118 VAL VAL B . n A 1 111 GLN 111 119 119 GLN GLN B . n A 1 112 PRO 112 120 120 PRO PRO B . n A 1 113 VAL 113 121 121 VAL VAL B . n A 1 114 CYS 114 122 122 CYS CYS B . n A 1 115 LEU 115 123 123 LEU LEU B . n A 1 116 PRO 116 124 124 PRO PRO B . n A 1 117 SER 117 125 125 SER SER B . n A 1 118 GLY 118 126 126 GLY GLY B . n A 1 119 ALA 119 127 127 ALA ALA B . n A 1 120 ALA 120 128 ? ? ? B . n A 1 121 ARG 121 129 ? ? ? B . n A 1 122 PRO 122 130 130 PRO PRO B . n A 1 123 SER 123 131 131 SER SER B . n A 1 124 GLU 124 132 132 GLU GLU B . n A 1 125 THR 125 133 133 THR THR B . n A 1 126 THR 126 134 134 THR THR B . n A 1 127 LEU 127 135 135 LEU LEU B . n A 1 128 CYS 128 136 136 CYS CYS B . n A 1 129 GLN 129 137 137 GLN GLN B . n A 1 130 VAL 130 138 138 VAL VAL B . n A 1 131 ALA 131 139 139 ALA ALA B . n A 1 132 GLY 132 140 140 GLY GLY B . n A 1 133 TRP 133 141 141 TRP TRP B . n A 1 134 GLY 134 142 142 GLY GLY B . n A 1 135 HIS 135 143 143 HIS HIS B . n A 1 136 GLN 136 144 144 GLN GLN B . n A 1 137 PHE 137 145 145 PHE PHE B . n A 1 138 GLU 138 146 146 GLU GLU B . n A 1 139 GLY 139 147 147 GLY GLY B . n A 1 140 ALA 140 148 148 ALA ALA B . n A 1 141 GLU 141 149 149 GLU GLU B . n A 1 142 GLU 142 150 150 GLU GLU B . n A 1 143 TYR 143 151 151 TYR TYR B . n A 1 144 ALA 144 152 152 ALA ALA B . n A 1 145 SER 145 153 153 SER SER B . n A 1 146 PHE 146 154 154 PHE PHE B . n A 1 147 LEU 147 155 155 LEU LEU B . n A 1 148 GLN 148 156 156 GLN GLN B . n A 1 149 GLU 149 157 157 GLU GLU B . n A 1 150 ALA 150 158 158 ALA ALA B . n A 1 151 GLN 151 159 159 GLN GLN B . n A 1 152 VAL 152 160 160 VAL VAL B . n A 1 153 PRO 153 161 161 PRO PRO B . n A 1 154 PHE 154 162 162 PHE PHE B . n A 1 155 LEU 155 163 163 LEU LEU B . n A 1 156 SER 156 164 164 SER SER B . n A 1 157 LEU 157 165 165 LEU LEU B . n A 1 158 GLU 158 166 166 GLU GLU B . n A 1 159 ARG 159 167 167 ARG ARG B . n A 1 160 CYS 160 168 168 CYS CYS B . n A 1 161 SER 161 169 169 SER SER B . n A 1 162 ALA 162 169 169 ALA ALA B A n A 1 163 PRO 163 169 169 PRO PRO B B n A 1 164 ASP 164 170 170 ASP ASP B . n A 1 165 VAL 165 171 171 VAL VAL B . n A 1 166 HIS 166 172 172 HIS HIS B . n A 1 167 GLY 167 173 173 GLY GLY B . n A 1 168 SER 168 174 174 SER SER B . n A 1 169 SER 169 175 175 SER SER B . n A 1 170 ILE 170 176 176 ILE ILE B . n A 1 171 LEU 171 177 177 LEU LEU B . n A 1 172 PRO 172 178 178 PRO PRO B . n A 1 173 GLY 173 179 179 GLY GLY B . n A 1 174 MET 174 180 180 MET MET B . n A 1 175 LEU 175 181 181 LEU LEU B . n A 1 176 CYS 176 182 182 CYS CYS B . n A 1 177 ALA 177 183 183 ALA ALA B . n A 1 178 GLY 178 184 184 GLY GLY B . n A 1 179 PHE 179 184 184 PHE PHE B A n A 1 180 LEU 180 185 185 LEU LEU B . n A 1 181 GLU 181 186 186 GLU GLU B . n A 1 182 GLY 182 187 187 GLY GLY B . n A 1 183 GLY 183 188 188 GLY GLY B . n A 1 184 THR 184 188 188 THR THR B A n A 1 185 ASP 185 189 189 ASP ASP B . n A 1 186 ALA 186 190 190 ALA ALA B . n A 1 187 CYS 187 191 191 CYS CYS B . n A 1 188 GLN 188 192 192 GLN GLN B . n A 1 189 GLY 189 193 193 GLY GLY B . n A 1 190 ASP 190 194 194 ASP ASP B . n A 1 191 SER 191 195 195 SER SER B . n A 1 192 GLY 192 196 196 GLY GLY B . n A 1 193 GLY 193 197 197 GLY GLY B . n A 1 194 PRO 194 198 198 PRO PRO B . n A 1 195 LEU 195 199 199 LEU LEU B . n A 1 196 VAL 196 200 200 VAL VAL B . n A 1 197 CYS 197 201 201 CYS CYS B . n A 1 198 GLU 198 202 202 GLU GLU B . n A 1 199 ASP 199 203 203 ASP ASP B . n A 1 200 GLN 200 203 ? ? ? B A n A 1 201 ALA 201 203 ? ? ? B B n A 1 202 ALA 202 203 ? ? ? B C n A 1 203 GLU 203 203 ? ? ? B D n A 1 204 ARG 204 203 ? ? ? B E n A 1 205 ARG 205 206 206 ARG ARG B . n A 1 206 LEU 206 207 207 LEU LEU B . n A 1 207 THR 207 208 208 THR THR B . n A 1 208 LEU 208 209 209 LEU LEU B . n A 1 209 GLN 209 210 210 GLN GLN B . n A 1 210 GLY 210 211 211 GLY GLY B . n A 1 211 ILE 211 212 212 ILE ILE B . n A 1 212 ILE 212 213 213 ILE ILE B . n A 1 213 SER 213 214 214 SER SER B . n A 1 214 TRP 214 215 215 TRP TRP B . n A 1 215 GLY 215 216 216 GLY GLY B . n A 1 216 SER 216 217 217 SER SER B . n A 1 217 GLY 217 219 219 GLY GLY B . n A 1 218 CYS 218 220 220 CYS CYS B . n A 1 219 GLY 219 221 221 GLY GLY B . n A 1 220 ASP 220 221 221 ASP ASP B A n A 1 221 ARG 221 222 222 ARG ARG B . n A 1 222 ASN 222 223 223 ASN ASN B . n A 1 223 LYS 223 224 224 LYS LYS B . n A 1 224 PRO 224 225 225 PRO PRO B . n A 1 225 GLY 225 226 226 GLY GLY B . n A 1 226 VAL 226 227 227 VAL VAL B . n A 1 227 TYR 227 228 228 TYR TYR B . n A 1 228 THR 228 229 229 THR THR B . n A 1 229 ASP 229 230 230 ASP ASP B . n A 1 230 VAL 230 231 231 VAL VAL B . n A 1 231 ALA 231 232 232 ALA ALA B . n A 1 232 TYR 232 233 233 TYR TYR B . n A 1 233 TYR 233 234 234 TYR TYR B . n A 1 234 LEU 234 235 235 LEU LEU B . n A 1 235 ALA 235 236 236 ALA ALA B . n A 1 236 TRP 236 237 237 TRP TRP B . n A 1 237 ILE 237 238 238 ILE ILE B . n A 1 238 ARG 238 239 239 ARG ARG B . n A 1 239 GLU 239 240 240 GLU GLU B . n A 1 240 HIS 240 241 241 HIS HIS B . n A 1 241 THR 241 242 242 THR THR B . n A 1 242 VAL 242 243 243 VAL VAL B . n A 1 243 SER 243 244 244 SER SER B . n A 1 244 THR 244 245 245 THR THR B . n A 1 245 ARG 245 246 246 ARG ARG B . n A 1 246 THR 246 247 ? ? ? B . n A 1 247 GLY 247 248 ? ? ? B . n A 1 248 HIS 248 249 ? ? ? B . n A 1 249 HIS 249 250 ? ? ? B . n A 1 250 HIS 250 251 ? ? ? B . n A 1 251 HIS 251 252 ? ? ? B . n A 1 252 HIS 252 253 ? ? ? B . n A 1 253 HIS 253 254 ? ? ? B . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 A NAG 1 B NAG 247 n B 2 NAG 2 A NAG 2 B NAG 347 n B 2 MAN 3 A MAN 3 B MAN 447 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 304 885 GOL GOL B . D 4 SO4 1 305 985 SO4 SO4 B . E 5 CYS 1 306 340 CYS CYS B . F 6 HOH 1 401 20 HOH HOH B . F 6 HOH 2 402 46 HOH HOH B . F 6 HOH 3 403 49 HOH HOH B . F 6 HOH 4 404 60 HOH HOH B . F 6 HOH 5 405 15 HOH HOH B . F 6 HOH 6 406 14 HOH HOH B . F 6 HOH 7 407 3 HOH HOH B . F 6 HOH 8 408 31 HOH HOH B . F 6 HOH 9 409 45 HOH HOH B . F 6 HOH 10 410 38 HOH HOH B . F 6 HOH 11 411 34 HOH HOH B . F 6 HOH 12 412 61 HOH HOH B . F 6 HOH 13 413 68 HOH HOH B . F 6 HOH 14 414 16 HOH HOH B . F 6 HOH 15 415 8 HOH HOH B . F 6 HOH 16 416 71 HOH HOH B . F 6 HOH 17 417 24 HOH HOH B . F 6 HOH 18 418 18 HOH HOH B . F 6 HOH 19 419 9 HOH HOH B . F 6 HOH 20 420 28 HOH HOH B . F 6 HOH 21 421 40 HOH HOH B . F 6 HOH 22 422 30 HOH HOH B . F 6 HOH 23 423 67 HOH HOH B . F 6 HOH 24 424 5 HOH HOH B . F 6 HOH 25 425 35 HOH HOH B . F 6 HOH 26 426 62 HOH HOH B . F 6 HOH 27 427 26 HOH HOH B . F 6 HOH 28 428 22 HOH HOH B . F 6 HOH 29 429 21 HOH HOH B . F 6 HOH 30 430 39 HOH HOH B . F 6 HOH 31 431 54 HOH HOH B . F 6 HOH 32 432 41 HOH HOH B . F 6 HOH 33 433 13 HOH HOH B . F 6 HOH 34 434 4 HOH HOH B . F 6 HOH 35 435 33 HOH HOH B . F 6 HOH 36 436 56 HOH HOH B . F 6 HOH 37 437 32 HOH HOH B . F 6 HOH 38 438 47 HOH HOH B . F 6 HOH 39 439 53 HOH HOH B . F 6 HOH 40 440 27 HOH HOH B . F 6 HOH 41 441 70 HOH HOH B . F 6 HOH 42 442 25 HOH HOH B . F 6 HOH 43 443 50 HOH HOH B . F 6 HOH 44 444 48 HOH HOH B . F 6 HOH 45 445 55 HOH HOH B . F 6 HOH 46 446 17 HOH HOH B . F 6 HOH 47 447 44 HOH HOH B . F 6 HOH 48 448 29 HOH HOH B . F 6 HOH 49 449 66 HOH HOH B . F 6 HOH 50 450 63 HOH HOH B . F 6 HOH 51 451 69 HOH HOH B . F 6 HOH 52 452 1 HOH HOH B . F 6 HOH 53 453 42 HOH HOH B . F 6 HOH 54 454 36 HOH HOH B . F 6 HOH 55 455 58 HOH HOH B . F 6 HOH 56 456 23 HOH HOH B . F 6 HOH 57 457 11 HOH HOH B . F 6 HOH 58 458 37 HOH HOH B . F 6 HOH 59 459 59 HOH HOH B . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id B _pdbx_unobs_or_zero_occ_atoms.auth_comp_id CYS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 306 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OXT _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id E _pdbx_unobs_or_zero_occ_atoms.label_comp_id CYS _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OXT # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0222 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6GT6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.932 _cell.length_a_esd ? _cell.length_b 106.932 _cell.length_b_esd ? _cell.length_c 65.962 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GT6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GT6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Tris.Cl pH 8.0, 1.5M AmSO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6GT6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.54 _reflns.d_resolution_low 47.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13130 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.102 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.54 _reflns_shell.d_res_low 2.61 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 938 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -1.7400 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -1.7400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 3.4900 _refine.B_iso_max 109.620 _refine.B_iso_mean 40.6860 _refine.B_iso_min 14.830 _refine.correlation_coeff_Fo_to_Fc 0.9370 _refine.correlation_coeff_Fo_to_Fc_free 0.8910 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GT6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5400 _refine.ls_d_res_low 47.8200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12479 _refine.ls_number_reflns_R_free 620 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9300 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2141 _refine.ls_R_factor_R_free 0.2636 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2115 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4XDE _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3430 _refine.pdbx_overall_ESU_R_Free 0.2660 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.5960 _refine.overall_SU_ML 0.2520 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5400 _refine_hist.d_res_low 47.8200 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1911 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 238 _refine_hist.pdbx_B_iso_mean_ligand 58.42 _refine_hist.pdbx_B_iso_mean_solvent 35.14 _refine_hist.pdbx_number_atoms_protein 1796 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.014 1905 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1623 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.434 1.683 2604 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.853 1.661 3812 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.961 5.000 235 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.949 21.630 92 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.230 15.000 265 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.897 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.060 0.200 247 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2140 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 351 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5400 _refine_ls_shell.d_res_low 2.6060 _refine_ls_shell.number_reflns_all 935 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 39 _refine_ls_shell.number_reflns_R_work 896 _refine_ls_shell.percent_reflns_obs 99.6800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3520 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3490 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6GT6 _struct.title 'Crystal structure of recombinant coagulation factor beta-XIIa' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GT6 _struct_keywords.text 'human coagulation factor XIIa, hydrolase, serine protease, BLOOD CLOTTING' _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA12_HUMAN _struct_ref.pdbx_db_accession P00748 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEA FSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERC SAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREH TVS ; _struct_ref.pdbx_align_begin 373 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GT6 _struct_ref_seq.pdbx_strand_id B _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 243 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00748 _struct_ref_seq.db_align_beg 373 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 615 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 244 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GT6 THR B 244 ? UNP P00748 ? ? 'expression tag' 245 1 1 6GT6 ARG B 245 ? UNP P00748 ? ? 'expression tag' 246 2 1 6GT6 THR B 246 ? UNP P00748 ? ? 'expression tag' 247 3 1 6GT6 GLY B 247 ? UNP P00748 ? ? 'expression tag' 248 4 1 6GT6 HIS B 248 ? UNP P00748 ? ? 'expression tag' 249 5 1 6GT6 HIS B 249 ? UNP P00748 ? ? 'expression tag' 250 6 1 6GT6 HIS B 250 ? UNP P00748 ? ? 'expression tag' 251 7 1 6GT6 HIS B 251 ? UNP P00748 ? ? 'expression tag' 252 8 1 6GT6 HIS B 252 ? UNP P00748 ? ? 'expression tag' 253 9 1 6GT6 HIS B 253 ? UNP P00748 ? ? 'expression tag' 254 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1140 ? 1 MORE -5 ? 1 'SSA (A^2)' 11290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details monomer # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 39 ? GLN A 43 ? ALA B 56 GLN B 60 5 ? 5 HELX_P HELX_P2 AA2 ALA A 47 D LEU A 51 ? ALA B 60 LEU B 64 5 ? 5 HELX_P HELX_P3 AA3 SER A 156 ? SER A 161 ? SER B 164 SER B 169 1 ? 6 HELX_P HELX_P4 AA4 HIS A 166 ? ILE A 170 ? HIS B 172 ILE B 176 5 ? 5 HELX_P HELX_P5 AA5 TYR A 233 ? HIS A 240 ? TYR B 234 HIS B 241 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? B CYS 42 B CYS 58 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 103 SG ? ? B CYS 50 B CYS 111 1_555 ? ? ? ? ? ? ? 1.933 ? ? disulf3 disulf ? ? A CYS 64 SG ? ? ? 1_555 A CYS 67 SG ? ? B CYS 77 B CYS 80 1_555 ? ? ? ? ? ? ? 2.121 ? ? disulf4 disulf ? ? A CYS 114 SG ? ? ? 1_555 E CYS . SG ? ? B CYS 122 B CYS 306 1_555 ? ? ? ? ? ? ? 1.985 ? ? disulf5 disulf ? ? A CYS 128 SG ? ? ? 1_555 A CYS 197 SG ? ? B CYS 136 B CYS 201 1_555 ? ? ? ? ? ? ? 2.078 ? ? disulf6 disulf ? ? A CYS 160 SG ? ? ? 1_555 A CYS 176 SG ? ? B CYS 168 B CYS 182 1_555 ? ? ? ? ? ? ? 2.008 ? ? disulf7 disulf ? ? A CYS 187 SG ? ? ? 1_555 A CYS 218 SG ? ? B CYS 191 B CYS 220 1_555 ? ? ? ? ? ? ? 2.035 ? ? covale1 covale one ? A ASN 61 ND2 ? ? ? 1_555 B NAG . C1 ? ? B ASN 74 A NAG 1 1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? A NAG 1 A NAG 2 1_555 ? ? ? ? ? ? ? 1.466 ? ? covale3 covale both ? B NAG . O4 ? ? ? 1_555 B MAN . C1 ? ? A NAG 2 A MAN 3 1_555 ? ? ? ? ? ? ? 1.466 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 5 ? VAL A 6 ? LEU B 20 VAL B 21 AA1 2 GLN A 148 ? GLN A 151 ? GLN B 156 GLN B 159 AA1 3 CYS A 128 ? GLY A 132 ? CYS B 136 GLY B 140 AA1 4 PRO A 194 ? CYS A 197 ? PRO B 198 CYS B 201 AA1 5 THR A 207 ? TRP A 214 ? THR B 208 TRP B 215 AA1 6 GLY A 225 ? ASP A 229 ? GLY B 226 ASP B 230 AA1 7 MET A 174 ? ALA A 177 ? MET B 180 ALA B 183 AA1 8 PHE A 154 ? LEU A 155 ? PHE B 162 LEU B 163 AA2 1 GLN A 68 ? LEU A 70 ? GLN B 81 LEU B 83 AA2 2 THR A 52 ? LEU A 55 ? THR B 65 LEU B 68 AA2 3 ILE A 15 ? TRP A 20 ? ILE B 30 TRP B 37 AA2 4 SER A 23 ? ALA A 31 ? SER B 40 ALA B 48 AA2 5 TRP A 34 ? THR A 37 ? TRP B 51 THR B 54 AA2 6 ALA A 91 ? LEU A 95 ? ALA B 104 LEU B 108 AA2 7 VAL A 72 ? LEU A 77 ? VAL B 85 LEU B 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 5 ? N LEU B 20 O GLU A 149 ? O GLU B 157 AA1 2 3 O ALA A 150 ? O ALA B 158 N VAL A 130 ? N VAL B 138 AA1 3 4 N GLN A 129 ? N GLN B 137 O VAL A 196 ? O VAL B 200 AA1 4 5 N CYS A 197 ? N CYS B 201 O THR A 207 ? O THR B 208 AA1 5 6 N ILE A 211 ? N ILE B 212 O THR A 228 ? O THR B 229 AA1 6 7 O TYR A 227 ? O TYR B 228 N LEU A 175 ? N LEU B 181 AA1 7 8 O CYS A 176 ? O CYS B 182 N LEU A 155 ? N LEU B 163 AA2 1 2 O GLN A 68 ? O GLN B 81 N LEU A 55 ? N LEU B 68 AA2 2 3 O THR A 52 ? O THR B 65 N TYR A 19 ? N TYR B 34 AA2 3 4 N LEU A 18 ? N LEU B 33 O CYS A 25 ? O CYS B 42 AA2 4 5 N SER A 28 ? N SER B 45 O LEU A 36 ? O LEU B 53 AA2 5 6 N VAL A 35 ? N VAL B 52 O LEU A 93 ? O LEU B 106 AA2 6 7 O LEU A 92 ? O LEU B 105 N ARG A 76 ? N ARG B 89 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 109 _pdbx_validate_close_contact.PDB_ins_code_1 B _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 109 _pdbx_validate_close_contact.PDB_ins_code_2 D _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP B 109 B ? -68.52 -178.08 2 1 CYS B 111 ? ? -103.02 -154.72 3 1 ALA B 112 ? ? -32.20 124.96 4 1 SER B 131 ? ? -161.03 57.45 5 1 THR B 133 ? ? 70.20 50.27 6 1 SER B 153 ? ? -92.66 -66.18 7 1 VAL B 171 ? ? -96.03 -77.33 8 1 LEU B 181 ? ? -170.21 136.38 9 1 SER B 214 ? ? -125.69 -78.73 # _pdbx_entry_details.entry_id 6GT6 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B ALA 128 ? A ALA 120 2 1 Y 1 B ARG 129 ? A ARG 121 3 1 Y 1 B GLN 203 A A GLN 200 4 1 Y 1 B ALA 203 B A ALA 201 5 1 Y 1 B ALA 203 C A ALA 202 6 1 Y 1 B GLU 203 D A GLU 203 7 1 Y 1 B ARG 203 E A ARG 204 8 1 Y 1 B THR 247 ? A THR 246 9 1 Y 1 B GLY 248 ? A GLY 247 10 1 Y 1 B HIS 249 ? A HIS 248 11 1 Y 1 B HIS 250 ? A HIS 249 12 1 Y 1 B HIS 251 ? A HIS 250 13 1 Y 1 B HIS 252 ? A HIS 251 14 1 Y 1 B HIS 253 ? A HIS 252 15 1 Y 1 B HIS 254 ? A HIS 253 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MAN C1 C N S 244 MAN C2 C N S 245 MAN C3 C N S 246 MAN C4 C N S 247 MAN C5 C N R 248 MAN C6 C N N 249 MAN O1 O N N 250 MAN O2 O N N 251 MAN O3 O N N 252 MAN O4 O N N 253 MAN O5 O N N 254 MAN O6 O N N 255 MAN H1 H N N 256 MAN H2 H N N 257 MAN H3 H N N 258 MAN H4 H N N 259 MAN H5 H N N 260 MAN H61 H N N 261 MAN H62 H N N 262 MAN HO1 H N N 263 MAN HO2 H N N 264 MAN HO3 H N N 265 MAN HO4 H N N 266 MAN HO6 H N N 267 MET N N N N 268 MET CA C N S 269 MET C C N N 270 MET O O N N 271 MET CB C N N 272 MET CG C N N 273 MET SD S N N 274 MET CE C N N 275 MET OXT O N N 276 MET H H N N 277 MET H2 H N N 278 MET HA H N N 279 MET HB2 H N N 280 MET HB3 H N N 281 MET HG2 H N N 282 MET HG3 H N N 283 MET HE1 H N N 284 MET HE2 H N N 285 MET HE3 H N N 286 MET HXT H N N 287 NAG C1 C N R 288 NAG C2 C N R 289 NAG C3 C N R 290 NAG C4 C N S 291 NAG C5 C N R 292 NAG C6 C N N 293 NAG C7 C N N 294 NAG C8 C N N 295 NAG N2 N N N 296 NAG O1 O N N 297 NAG O3 O N N 298 NAG O4 O N N 299 NAG O5 O N N 300 NAG O6 O N N 301 NAG O7 O N N 302 NAG H1 H N N 303 NAG H2 H N N 304 NAG H3 H N N 305 NAG H4 H N N 306 NAG H5 H N N 307 NAG H61 H N N 308 NAG H62 H N N 309 NAG H81 H N N 310 NAG H82 H N N 311 NAG H83 H N N 312 NAG HN2 H N N 313 NAG HO1 H N N 314 NAG HO3 H N N 315 NAG HO4 H N N 316 NAG HO6 H N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PRO N N N N 341 PRO CA C N S 342 PRO C C N N 343 PRO O O N N 344 PRO CB C N N 345 PRO CG C N N 346 PRO CD C N N 347 PRO OXT O N N 348 PRO H H N N 349 PRO HA H N N 350 PRO HB2 H N N 351 PRO HB3 H N N 352 PRO HG2 H N N 353 PRO HG3 H N N 354 PRO HD2 H N N 355 PRO HD3 H N N 356 PRO HXT H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 SO4 S S N N 372 SO4 O1 O N N 373 SO4 O2 O N N 374 SO4 O3 O N N 375 SO4 O4 O N N 376 THR N N N N 377 THR CA C N S 378 THR C C N N 379 THR O O N N 380 THR CB C N R 381 THR OG1 O N N 382 THR CG2 C N N 383 THR OXT O N N 384 THR H H N N 385 THR H2 H N N 386 THR HA H N N 387 THR HB H N N 388 THR HG1 H N N 389 THR HG21 H N N 390 THR HG22 H N N 391 THR HG23 H N N 392 THR HXT H N N 393 TRP N N N N 394 TRP CA C N S 395 TRP C C N N 396 TRP O O N N 397 TRP CB C N N 398 TRP CG C Y N 399 TRP CD1 C Y N 400 TRP CD2 C Y N 401 TRP NE1 N Y N 402 TRP CE2 C Y N 403 TRP CE3 C Y N 404 TRP CZ2 C Y N 405 TRP CZ3 C Y N 406 TRP CH2 C Y N 407 TRP OXT O N N 408 TRP H H N N 409 TRP H2 H N N 410 TRP HA H N N 411 TRP HB2 H N N 412 TRP HB3 H N N 413 TRP HD1 H N N 414 TRP HE1 H N N 415 TRP HE3 H N N 416 TRP HZ2 H N N 417 TRP HZ3 H N N 418 TRP HH2 H N N 419 TRP HXT H N N 420 TYR N N N N 421 TYR CA C N S 422 TYR C C N N 423 TYR O O N N 424 TYR CB C N N 425 TYR CG C Y N 426 TYR CD1 C Y N 427 TYR CD2 C Y N 428 TYR CE1 C Y N 429 TYR CE2 C Y N 430 TYR CZ C Y N 431 TYR OH O N N 432 TYR OXT O N N 433 TYR H H N N 434 TYR H2 H N N 435 TYR HA H N N 436 TYR HB2 H N N 437 TYR HB3 H N N 438 TYR HD1 H N N 439 TYR HD2 H N N 440 TYR HE1 H N N 441 TYR HE2 H N N 442 TYR HH H N N 443 TYR HXT H N N 444 VAL N N N N 445 VAL CA C N S 446 VAL C C N N 447 VAL O O N N 448 VAL CB C N N 449 VAL CG1 C N N 450 VAL CG2 C N N 451 VAL OXT O N N 452 VAL H H N N 453 VAL H2 H N N 454 VAL HA H N N 455 VAL HB H N N 456 VAL HG11 H N N 457 VAL HG12 H N N 458 VAL HG13 H N N 459 VAL HG21 H N N 460 VAL HG22 H N N 461 VAL HG23 H N N 462 VAL HXT H N N 463 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MAN C1 C2 sing N N 231 MAN C1 O1 sing N N 232 MAN C1 O5 sing N N 233 MAN C1 H1 sing N N 234 MAN C2 C3 sing N N 235 MAN C2 O2 sing N N 236 MAN C2 H2 sing N N 237 MAN C3 C4 sing N N 238 MAN C3 O3 sing N N 239 MAN C3 H3 sing N N 240 MAN C4 C5 sing N N 241 MAN C4 O4 sing N N 242 MAN C4 H4 sing N N 243 MAN C5 C6 sing N N 244 MAN C5 O5 sing N N 245 MAN C5 H5 sing N N 246 MAN C6 O6 sing N N 247 MAN C6 H61 sing N N 248 MAN C6 H62 sing N N 249 MAN O1 HO1 sing N N 250 MAN O2 HO2 sing N N 251 MAN O3 HO3 sing N N 252 MAN O4 HO4 sing N N 253 MAN O6 HO6 sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 NAG C1 C2 sing N N 274 NAG C1 O1 sing N N 275 NAG C1 O5 sing N N 276 NAG C1 H1 sing N N 277 NAG C2 C3 sing N N 278 NAG C2 N2 sing N N 279 NAG C2 H2 sing N N 280 NAG C3 C4 sing N N 281 NAG C3 O3 sing N N 282 NAG C3 H3 sing N N 283 NAG C4 C5 sing N N 284 NAG C4 O4 sing N N 285 NAG C4 H4 sing N N 286 NAG C5 C6 sing N N 287 NAG C5 O5 sing N N 288 NAG C5 H5 sing N N 289 NAG C6 O6 sing N N 290 NAG C6 H61 sing N N 291 NAG C6 H62 sing N N 292 NAG C7 C8 sing N N 293 NAG C7 N2 sing N N 294 NAG C7 O7 doub N N 295 NAG C8 H81 sing N N 296 NAG C8 H82 sing N N 297 NAG C8 H83 sing N N 298 NAG N2 HN2 sing N N 299 NAG O1 HO1 sing N N 300 NAG O3 HO3 sing N N 301 NAG O4 HO4 sing N N 302 NAG O6 HO6 sing N N 303 PHE N CA sing N N 304 PHE N H sing N N 305 PHE N H2 sing N N 306 PHE CA C sing N N 307 PHE CA CB sing N N 308 PHE CA HA sing N N 309 PHE C O doub N N 310 PHE C OXT sing N N 311 PHE CB CG sing N N 312 PHE CB HB2 sing N N 313 PHE CB HB3 sing N N 314 PHE CG CD1 doub Y N 315 PHE CG CD2 sing Y N 316 PHE CD1 CE1 sing Y N 317 PHE CD1 HD1 sing N N 318 PHE CD2 CE2 doub Y N 319 PHE CD2 HD2 sing N N 320 PHE CE1 CZ doub Y N 321 PHE CE1 HE1 sing N N 322 PHE CE2 CZ sing Y N 323 PHE CE2 HE2 sing N N 324 PHE CZ HZ sing N N 325 PHE OXT HXT sing N N 326 PRO N CA sing N N 327 PRO N CD sing N N 328 PRO N H sing N N 329 PRO CA C sing N N 330 PRO CA CB sing N N 331 PRO CA HA sing N N 332 PRO C O doub N N 333 PRO C OXT sing N N 334 PRO CB CG sing N N 335 PRO CB HB2 sing N N 336 PRO CB HB3 sing N N 337 PRO CG CD sing N N 338 PRO CG HG2 sing N N 339 PRO CG HG3 sing N N 340 PRO CD HD2 sing N N 341 PRO CD HD3 sing N N 342 PRO OXT HXT sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 SO4 S O1 doub N N 357 SO4 S O2 doub N N 358 SO4 S O3 sing N N 359 SO4 S O4 sing N N 360 THR N CA sing N N 361 THR N H sing N N 362 THR N H2 sing N N 363 THR CA C sing N N 364 THR CA CB sing N N 365 THR CA HA sing N N 366 THR C O doub N N 367 THR C OXT sing N N 368 THR CB OG1 sing N N 369 THR CB CG2 sing N N 370 THR CB HB sing N N 371 THR OG1 HG1 sing N N 372 THR CG2 HG21 sing N N 373 THR CG2 HG22 sing N N 374 THR CG2 HG23 sing N N 375 THR OXT HXT sing N N 376 TRP N CA sing N N 377 TRP N H sing N N 378 TRP N H2 sing N N 379 TRP CA C sing N N 380 TRP CA CB sing N N 381 TRP CA HA sing N N 382 TRP C O doub N N 383 TRP C OXT sing N N 384 TRP CB CG sing N N 385 TRP CB HB2 sing N N 386 TRP CB HB3 sing N N 387 TRP CG CD1 doub Y N 388 TRP CG CD2 sing Y N 389 TRP CD1 NE1 sing Y N 390 TRP CD1 HD1 sing N N 391 TRP CD2 CE2 doub Y N 392 TRP CD2 CE3 sing Y N 393 TRP NE1 CE2 sing Y N 394 TRP NE1 HE1 sing N N 395 TRP CE2 CZ2 sing Y N 396 TRP CE3 CZ3 doub Y N 397 TRP CE3 HE3 sing N N 398 TRP CZ2 CH2 doub Y N 399 TRP CZ2 HZ2 sing N N 400 TRP CZ3 CH2 sing Y N 401 TRP CZ3 HZ3 sing N N 402 TRP CH2 HH2 sing N N 403 TRP OXT HXT sing N N 404 TYR N CA sing N N 405 TYR N H sing N N 406 TYR N H2 sing N N 407 TYR CA C sing N N 408 TYR CA CB sing N N 409 TYR CA HA sing N N 410 TYR C O doub N N 411 TYR C OXT sing N N 412 TYR CB CG sing N N 413 TYR CB HB2 sing N N 414 TYR CB HB3 sing N N 415 TYR CG CD1 doub Y N 416 TYR CG CD2 sing Y N 417 TYR CD1 CE1 sing Y N 418 TYR CD1 HD1 sing N N 419 TYR CD2 CE2 doub Y N 420 TYR CD2 HD2 sing N N 421 TYR CE1 CZ doub Y N 422 TYR CE1 HE1 sing N N 423 TYR CE2 CZ sing Y N 424 TYR CE2 HE2 sing N N 425 TYR CZ OH sing N N 426 TYR OH HH sing N N 427 TYR OXT HXT sing N N 428 VAL N CA sing N N 429 VAL N H sing N N 430 VAL N H2 sing N N 431 VAL CA C sing N N 432 VAL CA CB sing N N 433 VAL CA HA sing N N 434 VAL C O doub N N 435 VAL C OXT sing N N 436 VAL CB CG1 sing N N 437 VAL CB CG2 sing N N 438 VAL CB HB sing N N 439 VAL CG1 HG11 sing N N 440 VAL CG1 HG12 sing N N 441 VAL CG1 HG13 sing N N 442 VAL CG2 HG21 sing N N 443 VAL CG2 HG22 sing N N 444 VAL CG2 HG23 sing N N 445 VAL OXT HXT sing N N 446 # _pdbx_audit_support.funding_organization 'British Heart Foundation' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 MAN 3 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4XDE _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6GT6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009352 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009352 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015160 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_asym_id _atom_site.label_entity_id _atom_site.label_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.B_iso_or_equiv _atom_site.pdbx_formal_charge _atom_site.auth_seq_id _atom_site.auth_comp_id _atom_site.auth_asym_id _atom_site.auth_atom_id _atom_site.pdbx_PDB_model_num ATOM 1 N N . VAL A 1 1 ? -24.763 39.228 8.699 1.00 33.68 ? 16 VAL B N 1 ATOM 2 C CA . VAL A 1 1 ? -25.310 38.028 8.005 1.00 34.65 ? 16 VAL B CA 1 ATOM 3 C C . VAL A 1 1 ? -26.797 38.261 7.737 1.00 32.84 ? 16 VAL B C 1 ATOM 4 O O . VAL A 1 1 ? -27.516 38.529 8.690 1.00 31.97 ? 16 VAL B O 1 ATOM 5 C CB . VAL A 1 1 ? -25.084 36.760 8.848 1.00 36.73 ? 16 VAL B CB 1 ATOM 6 C CG1 . VAL A 1 1 ? -25.904 35.583 8.353 1.00 37.44 ? 16 VAL B CG1 1 ATOM 7 C CG2 . VAL A 1 1 ? -23.616 36.389 8.933 1.00 36.89 ? 16 VAL B CG2 1 ATOM 8 N N . VAL A 1 2 ? -27.228 38.185 6.478 1.00 33.49 ? 17 VAL B N 1 ATOM 9 C CA . VAL A 1 2 ? -28.649 38.354 6.185 1.00 35.07 ? 17 VAL B CA 1 ATOM 10 C C . VAL A 1 2 ? -29.330 36.975 6.123 1.00 37.17 ? 17 VAL B C 1 ATOM 11 O O . VAL A 1 2 ? -28.751 35.987 5.668 1.00 37.60 ? 17 VAL B O 1 ATOM 12 C CB . VAL A 1 2 ? -28.872 39.211 4.920 1.00 34.01 ? 17 VAL B CB 1 ATOM 13 C CG1 . VAL A 1 2 ? -27.936 40.407 4.910 1.00 35.61 ? 17 VAL B CG1 1 ATOM 14 C CG2 . VAL A 1 2 ? -28.753 38.448 3.611 1.00 34.28 ? 17 VAL B CG2 1 ATOM 15 N N . GLY A 1 3 ? -30.574 36.922 6.605 1.00 39.01 ? 18 GLY B N 1 ATOM 16 C CA . GLY A 1 3 ? -31.333 35.682 6.692 1.00 38.34 ? 18 GLY B CA 1 ATOM 17 C C . GLY A 1 3 ? -30.637 34.637 7.557 1.00 37.25 ? 18 GLY B C 1 ATOM 18 O O . GLY A 1 3 ? -30.592 33.467 7.168 1.00 35.82 ? 18 GLY B O 1 ATOM 19 N N . GLY A 1 4 ? -30.089 35.064 8.710 1.00 33.72 ? 19 GLY B N 1 ATOM 20 C CA . GLY A 1 4 ? -29.383 34.177 9.669 1.00 31.68 ? 19 GLY B CA 1 ATOM 21 C C . GLY A 1 4 ? -30.086 34.144 11.014 1.00 29.13 ? 19 GLY B C 1 ATOM 22 O O . GLY A 1 4 ? -31.166 34.665 11.116 1.00 29.68 ? 19 GLY B O 1 ATOM 23 N N . LEU A 1 5 ? -29.463 33.548 12.037 1.00 27.05 ? 20 LEU B N 1 ATOM 24 C CA . LEU A 1 5 ? -30.087 33.347 13.351 1.00 26.78 ? 20 LEU B CA 1 ATOM 25 C C . LEU A 1 5 ? -29.089 33.695 14.450 1.00 28.15 ? 20 LEU B C 1 ATOM 26 O O . LEU A 1 5 ? -27.910 33.395 14.340 1.00 32.13 ? 20 LEU B O 1 ATOM 27 C CB . LEU A 1 5 ? -30.471 31.875 13.517 1.00 27.95 ? 20 LEU B CB 1 ATOM 28 C CG . LEU A 1 5 ? -31.356 31.251 12.435 1.00 29.02 ? 20 LEU B CG 1 ATOM 29 C CD1 . LEU A 1 5 ? -31.287 29.728 12.485 1.00 28.52 ? 20 LEU B CD1 1 ATOM 30 C CD2 . LEU A 1 5 ? -32.791 31.719 12.587 1.00 28.37 ? 20 LEU B CD2 1 ATOM 31 N N . VAL A 1 6 ? -29.575 34.274 15.543 1.00 28.53 ? 21 VAL B N 1 ATOM 32 C CA . VAL A 1 6 ? -28.763 34.442 16.725 1.00 28.64 ? 21 VAL B CA 1 ATOM 33 C C . VAL A 1 6 ? -28.191 33.071 17.073 1.00 29.63 ? 21 VAL B C 1 ATOM 34 O O . VAL A 1 6 ? -28.924 32.115 17.074 1.00 31.74 ? 21 VAL B O 1 ATOM 35 C CB . VAL A 1 6 ? -29.594 34.993 17.896 1.00 29.50 ? 21 VAL B CB 1 ATOM 36 C CG1 . VAL A 1 6 ? -28.876 34.865 19.231 1.00 29.81 ? 21 VAL B CG1 1 ATOM 37 C CG2 . VAL A 1 6 ? -30.011 36.430 17.650 1.00 30.88 ? 21 VAL B CG2 1 ATOM 38 N N . ALA A 1 7 ? -26.893 33.002 17.370 1.00 31.83 ? 22 ALA B N 1 ATOM 39 C CA . ALA A 1 7 ? -26.212 31.748 17.687 1.00 33.84 ? 22 ALA B CA 1 ATOM 40 C C . ALA A 1 7 ? -26.138 31.575 19.203 1.00 34.53 ? 22 ALA B C 1 ATOM 41 O O . ALA A 1 7 ? -26.144 32.557 19.936 1.00 35.11 ? 22 ALA B O 1 ATOM 42 C CB . ALA A 1 7 ? -24.824 31.749 17.103 1.00 36.23 ? 22 ALA B CB 1 ATOM 43 N N . LEU A 1 8 ? -26.049 30.317 19.641 1.00 35.19 ? 23 LEU B N 1 ATOM 44 C CA . LEU A 1 8 ? -25.780 29.973 21.030 1.00 37.09 ? 23 LEU B CA 1 ATOM 45 C C . LEU A 1 8 ? -24.371 30.465 21.395 1.00 37.32 ? 23 LEU B C 1 ATOM 46 O O . LEU A 1 8 ? -23.535 30.613 20.531 1.00 36.82 ? 23 LEU B O 1 ATOM 47 C CB . LEU A 1 8 ? -25.883 28.450 21.202 1.00 37.28 ? 23 LEU B CB 1 ATOM 48 C CG . LEU A 1 8 ? -27.268 27.816 21.033 1.00 38.04 ? 23 LEU B CG 1 ATOM 49 C CD1 . LEU A 1 8 ? -27.164 26.301 20.955 1.00 39.67 ? 23 LEU B CD1 1 ATOM 50 C CD2 . LEU A 1 8 ? -28.207 28.180 22.172 1.00 39.04 ? 23 LEU B CD2 1 ATOM 51 N N . ARG A 1 9 ? -24.132 30.720 22.685 1.00 39.53 ? 24 ARG B N 1 ATOM 52 C CA . ARG A 1 9 ? -22.788 30.878 23.223 1.00 41.20 ? 24 ARG B CA 1 ATOM 53 C C . ARG A 1 9 ? -21.945 29.653 22.829 1.00 41.57 ? 24 ARG B C 1 ATOM 54 O O . ARG A 1 9 ? -22.337 28.501 23.007 1.00 46.71 ? 24 ARG B O 1 ATOM 55 C CB . ARG A 1 9 ? -22.831 31.044 24.747 1.00 45.26 ? 24 ARG B CB 1 ATOM 56 C CG . ARG A 1 9 ? -23.089 32.469 25.216 1.00 51.88 ? 24 ARG B CG 1 ATOM 57 C CD . ARG A 1 9 ? -23.466 32.591 26.688 1.00 59.21 ? 24 ARG B CD 1 ATOM 58 N NE . ARG A 1 9 ? -23.011 33.853 27.280 1.00 62.77 ? 24 ARG B NE 1 ATOM 59 C CZ . ARG A 1 9 ? -21.771 34.086 27.721 1.00 65.52 ? 24 ARG B CZ 1 ATOM 60 N NH1 . ARG A 1 9 ? -20.849 33.142 27.658 1.00 71.55 ? 24 ARG B NH1 1 ATOM 61 N NH2 . ARG A 1 9 ? -21.450 35.261 28.232 1.00 68.00 ? 24 ARG B NH2 1 ATOM 62 N N . GLY A 1 10 ? -20.774 29.913 22.257 1.00 41.49 ? 25 GLY B N 1 ATOM 63 C CA . GLY A 1 10 ? -19.816 28.875 21.934 1.00 40.44 ? 25 GLY B CA 1 ATOM 64 C C . GLY A 1 10 ? -20.152 28.154 20.641 1.00 39.91 ? 25 GLY B C 1 ATOM 65 O O . GLY A 1 10 ? -19.484 27.172 20.306 1.00 40.08 ? 25 GLY B O 1 ATOM 66 N N . ALA A 1 11 ? -21.155 28.647 19.898 1.00 36.63 ? 26 ALA B N 1 ATOM 67 C CA . ALA A 1 11 ? -21.591 28.001 18.644 1.00 35.16 ? 26 ALA B CA 1 ATOM 68 C C . ALA A 1 11 ? -20.426 27.950 17.655 1.00 34.52 ? 26 ALA B C 1 ATOM 69 O O . ALA A 1 11 ? -20.315 27.006 16.883 1.00 32.70 ? 26 ALA B O 1 ATOM 70 C CB . ALA A 1 11 ? -22.761 28.734 18.037 1.00 34.66 ? 26 ALA B CB 1 ATOM 71 N N . HIS A 1 12 ? -19.644 29.030 17.620 1.00 35.98 ? 27 HIS B N 1 ATOM 72 C CA . HIS A 1 12 ? -18.473 29.197 16.717 1.00 35.62 ? 27 HIS B CA 1 ATOM 73 C C . HIS A 1 12 ? -17.294 29.661 17.565 1.00 35.30 ? 27 HIS B C 1 ATOM 74 O O . HIS A 1 12 ? -16.985 30.845 17.537 1.00 38.54 ? 27 HIS B O 1 ATOM 75 C CB . HIS A 1 12 ? -18.814 30.205 15.624 1.00 34.84 ? 27 HIS B CB 1 ATOM 76 C CG . HIS A 1 12 ? -20.050 29.829 14.891 1.00 34.74 ? 27 HIS B CG 1 ATOM 77 N ND1 . HIS A 1 12 ? -20.024 29.031 13.781 1.00 35.99 ? 27 HIS B ND1 1 ATOM 78 C CD2 . HIS A 1 12 ? -21.343 30.102 15.130 1.00 34.16 ? 27 HIS B CD2 1 ATOM 79 C CE1 . HIS A 1 12 ? -21.248 28.836 13.359 1.00 36.85 ? 27 HIS B CE1 1 ATOM 80 N NE2 . HIS A 1 12 ? -22.070 29.481 14.164 1.00 36.35 ? 27 HIS B NE2 1 ATOM 81 N N . PRO A 1 13 ? -16.613 28.756 18.287 1.00 33.63 ? 28 PRO B N 1 ATOM 82 C CA . PRO A 1 13 ? -15.585 29.159 19.247 1.00 32.38 ? 28 PRO B CA 1 ATOM 83 C C . PRO A 1 13 ? -14.238 29.517 18.594 1.00 30.30 ? 28 PRO B C 1 ATOM 84 O O . PRO A 1 13 ? -13.301 29.905 19.287 1.00 27.32 ? 28 PRO B O 1 ATOM 85 C CB . PRO A 1 13 ? -15.505 27.924 20.162 1.00 33.66 ? 28 PRO B CB 1 ATOM 86 C CG . PRO A 1 13 ? -15.871 26.753 19.264 1.00 32.59 ? 28 PRO B CG 1 ATOM 87 C CD . PRO A 1 13 ? -16.822 27.303 18.223 1.00 32.95 ? 28 PRO B CD 1 ATOM 88 N N . TYR A 1 14 ? -14.185 29.436 17.261 1.00 30.13 ? 29 TYR B N 1 ATOM 89 C CA . TYR A 1 14 ? -13.005 29.774 16.463 1.00 31.19 ? 29 TYR B CA 1 ATOM 90 C C . TYR A 1 14 ? -13.073 31.209 15.898 1.00 31.82 ? 29 TYR B C 1 ATOM 91 O O . TYR A 1 14 ? -12.130 31.635 15.211 1.00 30.99 ? 29 TYR B O 1 ATOM 92 C CB . TYR A 1 14 ? -12.882 28.790 15.297 1.00 32.93 ? 29 TYR B CB 1 ATOM 93 C CG . TYR A 1 14 ? -14.212 28.377 14.721 1.00 32.76 ? 29 TYR B CG 1 ATOM 94 C CD1 . TYR A 1 14 ? -14.935 29.229 13.906 1.00 32.64 ? 29 TYR B CD1 1 ATOM 95 C CD2 . TYR A 1 14 ? -14.776 27.157 15.058 1.00 33.96 ? 29 TYR B CD2 1 ATOM 96 C CE1 . TYR A 1 14 ? -16.174 28.863 13.410 1.00 34.39 ? 29 TYR B CE1 1 ATOM 97 C CE2 . TYR A 1 14 ? -16.012 26.774 14.570 1.00 34.36 ? 29 TYR B CE2 1 ATOM 98 C CZ . TYR A 1 14 ? -16.712 27.632 13.744 1.00 34.72 ? 29 TYR B CZ 1 ATOM 99 O OH . TYR A 1 14 ? -17.926 27.253 13.267 1.00 36.31 ? 29 TYR B OH 1 ATOM 100 N N . ILE A 1 15 ? -14.171 31.947 16.138 1.00 30.49 ? 30 ILE B N 1 ATOM 101 C CA . ILE A 1 15 ? -14.322 33.284 15.540 1.00 29.25 ? 30 ILE B CA 1 ATOM 102 C C . ILE A 1 15 ? -13.620 34.314 16.427 1.00 29.39 ? 30 ILE B C 1 ATOM 103 O O . ILE A 1 15 ? -13.699 34.273 17.662 1.00 30.04 ? 30 ILE B O 1 ATOM 104 C CB . ILE A 1 15 ? -15.784 33.676 15.249 1.00 28.60 ? 30 ILE B CB 1 ATOM 105 C CG1 . ILE A 1 15 ? -15.857 34.847 14.269 1.00 29.43 ? 30 ILE B CG1 1 ATOM 106 C CG2 . ILE A 1 15 ? -16.553 33.986 16.514 1.00 29.02 ? 30 ILE B CG2 1 ATOM 107 C CD1 . ILE A 1 15 ? -17.190 34.973 13.578 1.00 30.21 ? 30 ILE B CD1 1 ATOM 108 N N . ALA A 1 16 ? -12.911 35.221 15.751 1.00 28.85 ? 31 ALA B N 1 ATOM 109 C CA . ALA A 1 16 ? -12.136 36.252 16.357 1.00 28.41 ? 31 ALA B CA 1 ATOM 110 C C . ALA A 1 16 ? -12.765 37.594 16.006 1.00 28.54 ? 31 ALA B C 1 ATOM 111 O O . ALA A 1 16 ? -13.186 37.818 14.853 1.00 30.65 ? 31 ALA B O 1 ATOM 112 C CB . ALA A 1 16 ? -10.724 36.169 15.859 1.00 29.28 ? 31 ALA B CB 1 ATOM 113 N N . ALA A 1 17 ? -12.827 38.459 17.014 1.00 28.04 ? 32 ALA B N 1 ATOM 114 C CA . ALA A 1 17 ? -13.199 39.843 16.842 1.00 29.74 ? 32 ALA B CA 1 ATOM 115 C C . ALA A 1 17 ? -11.926 40.699 16.886 1.00 29.92 ? 32 ALA B C 1 ATOM 116 O O . ALA A 1 17 ? -11.150 40.609 17.835 1.00 26.72 ? 32 ALA B O 1 ATOM 117 C CB . ALA A 1 17 ? -14.181 40.250 17.913 1.00 29.75 ? 32 ALA B CB 1 ATOM 118 N N . LEU A 1 18 ? -11.743 41.520 15.841 1.00 32.64 ? 33 LEU B N 1 ATOM 119 C CA . LEU A 1 18 ? -10.594 42.427 15.685 1.00 32.14 ? 33 LEU B CA 1 ATOM 120 C C . LEU A 1 18 ? -11.044 43.874 15.889 1.00 29.61 ? 33 LEU B C 1 ATOM 121 O O . LEU A 1 18 ? -11.926 44.337 15.199 1.00 27.13 ? 33 LEU B O 1 ATOM 122 C CB . LEU A 1 18 ? -9.996 42.238 14.290 1.00 32.62 ? 33 LEU B CB 1 ATOM 123 C CG . LEU A 1 18 ? -8.987 41.100 14.188 1.00 33.88 ? 33 LEU B CG 1 ATOM 124 C CD1 . LEU A 1 18 ? -9.656 39.759 14.432 1.00 35.17 ? 33 LEU B CD1 1 ATOM 125 C CD2 . LEU A 1 18 ? -8.305 41.114 12.833 1.00 35.25 ? 33 LEU B CD2 1 ATOM 126 N N . TYR A 1 19 ? -10.423 44.568 16.848 1.00 29.56 ? 34 TYR B N 1 ATOM 127 C CA . TYR A 1 19 ? -10.724 45.979 17.106 1.00 30.06 ? 34 TYR B CA 1 ATOM 128 C C . TYR A 1 19 ? -9.431 46.795 17.030 1.00 31.57 ? 34 TYR B C 1 ATOM 129 O O . TYR A 1 19 ? -8.412 46.446 17.651 1.00 31.90 ? 34 TYR B O 1 ATOM 130 C CB . TYR A 1 19 ? -11.410 46.184 18.464 1.00 28.23 ? 34 TYR B CB 1 ATOM 131 C CG . TYR A 1 19 ? -12.629 45.326 18.690 1.00 26.63 ? 34 TYR B CG 1 ATOM 132 C CD1 . TYR A 1 19 ? -12.511 44.054 19.221 1.00 26.88 ? 34 TYR B CD1 1 ATOM 133 C CD2 . TYR A 1 19 ? -13.894 45.765 18.346 1.00 25.28 ? 34 TYR B CD2 1 ATOM 134 C CE1 . TYR A 1 19 ? -13.616 43.242 19.415 1.00 26.17 ? 34 TYR B CE1 1 ATOM 135 C CE2 . TYR A 1 19 ? -15.011 44.973 18.548 1.00 24.81 ? 34 TYR B CE2 1 ATOM 136 C CZ . TYR A 1 19 ? -14.870 43.707 19.080 1.00 24.83 ? 34 TYR B CZ 1 ATOM 137 O OH . TYR A 1 19 ? -15.951 42.917 19.288 1.00 24.43 ? 34 TYR B OH 1 ATOM 138 N N . TRP A 1 20 ? -9.502 47.892 16.268 1.00 32.76 ? 37 TRP B N 1 ATOM 139 C CA . TRP A 1 20 ? -8.497 48.935 16.281 1.00 32.02 ? 37 TRP B CA 1 ATOM 140 C C . TRP A 1 20 ? -9.153 50.260 15.894 1.00 32.38 ? 37 TRP B C 1 ATOM 141 O O . TRP A 1 20 ? -10.090 50.269 15.111 1.00 35.90 ? 37 TRP B O 1 ATOM 142 C CB . TRP A 1 20 ? -7.319 48.564 15.369 1.00 31.00 ? 37 TRP B CB 1 ATOM 143 C CG . TRP A 1 20 ? -7.575 48.626 13.898 1.00 30.81 ? 37 TRP B CG 1 ATOM 144 C CD1 . TRP A 1 20 ? -7.149 49.600 13.047 1.00 32.81 ? 37 TRP B CD1 1 ATOM 145 C CD2 . TRP A 1 20 ? -8.272 47.665 13.084 1.00 31.97 ? 37 TRP B CD2 1 ATOM 146 N NE1 . TRP A 1 20 ? -7.536 49.321 11.762 1.00 33.29 ? 37 TRP B NE1 1 ATOM 147 C CE2 . TRP A 1 20 ? -8.223 48.137 11.752 1.00 32.64 ? 37 TRP B CE2 1 ATOM 148 C CE3 . TRP A 1 20 ? -8.960 46.478 13.342 1.00 31.77 ? 37 TRP B CE3 1 ATOM 149 C CZ2 . TRP A 1 20 ? -8.813 47.454 10.691 1.00 31.49 ? 37 TRP B CZ2 1 ATOM 150 C CZ3 . TRP A 1 20 ? -9.537 45.801 12.288 1.00 32.25 ? 37 TRP B CZ3 1 ATOM 151 C CH2 . TRP A 1 20 ? -9.470 46.285 10.982 1.00 31.09 ? 37 TRP B CH2 1 ATOM 152 N N . GLY A 1 21 ? -8.669 51.359 16.482 1.00 32.92 ? 38 GLY B N 1 ATOM 153 C CA . GLY A 1 21 ? -9.113 52.693 16.136 1.00 33.73 ? 38 GLY B CA 1 ATOM 154 C C . GLY A 1 21 ? -10.625 52.766 16.122 1.00 37.69 ? 38 GLY B C 1 ATOM 155 O O . GLY A 1 21 ? -11.271 52.360 17.100 1.00 43.39 ? 38 GLY B O 1 ATOM 156 N N . HIS A 1 22 ? -11.185 53.246 15.003 1.00 39.57 ? 39 HIS B N 1 ATOM 157 C CA . HIS A 1 22 ? -12.629 53.261 14.785 1.00 42.12 ? 39 HIS B CA 1 ATOM 158 C C . HIS A 1 22 ? -12.998 52.192 13.756 1.00 39.14 ? 39 HIS B C 1 ATOM 159 O O . HIS A 1 22 ? -13.893 52.405 12.954 1.00 37.96 ? 39 HIS B O 1 ATOM 160 C CB . HIS A 1 22 ? -13.088 54.661 14.363 1.00 47.97 ? 39 HIS B CB 1 ATOM 161 C CG . HIS A 1 22 ? -12.956 55.659 15.462 1.00 56.42 ? 39 HIS B CG 1 ATOM 162 N ND1 . HIS A 1 22 ? -12.314 56.873 15.289 1.00 60.28 ? 39 HIS B ND1 1 ATOM 163 C CD2 . HIS A 1 22 ? -13.348 55.608 16.757 1.00 60.22 ? 39 HIS B CD2 1 ATOM 164 C CE1 . HIS A 1 22 ? -12.334 57.540 16.427 1.00 65.55 ? 39 HIS B CE1 1 ATOM 165 N NE2 . HIS A 1 22 ? -12.960 56.781 17.347 1.00 65.83 ? 39 HIS B NE2 1 ATOM 166 N N . SER A 1 23 ? -12.316 51.042 13.833 1.00 35.07 ? 40 SER B N 1 ATOM 167 C CA . SER A 1 23 ? -12.428 49.968 12.873 1.00 33.40 ? 40 SER B CA 1 ATOM 168 C C . SER A 1 23 ? -12.751 48.639 13.570 1.00 32.01 ? 40 SER B C 1 ATOM 169 O O . SER A 1 23 ? -12.579 48.488 14.782 1.00 30.24 ? 40 SER B O 1 ATOM 170 C CB . SER A 1 23 ? -11.178 49.865 12.053 1.00 32.58 ? 40 SER B CB 1 ATOM 171 O OG . SER A 1 23 ? -11.104 50.949 11.151 1.00 32.39 ? 40 SER B OG 1 ATOM 172 N N . PHE A 1 24 ? -13.231 47.687 12.762 1.00 31.11 ? 41 PHE B N 1 ATOM 173 C CA . PHE A 1 24 ? -13.663 46.382 13.217 1.00 30.86 ? 41 PHE B CA 1 ATOM 174 C C . PHE A 1 24 ? -13.575 45.355 12.080 1.00 29.84 ? 41 PHE B C 1 ATOM 175 O O . PHE A 1 24 ? -13.928 45.644 10.937 1.00 29.92 ? 41 PHE B O 1 ATOM 176 C CB . PHE A 1 24 ? -15.107 46.439 13.723 1.00 31.58 ? 41 PHE B CB 1 ATOM 177 C CG . PHE A 1 24 ? -15.698 45.082 13.996 1.00 33.04 ? 41 PHE B CG 1 ATOM 178 C CD1 . PHE A 1 24 ? -15.340 44.375 15.136 1.00 33.29 ? 41 PHE B CD1 1 ATOM 179 C CD2 . PHE A 1 24 ? -16.560 44.486 13.085 1.00 34.68 ? 41 PHE B CD2 1 ATOM 180 C CE1 . PHE A 1 24 ? -15.842 43.103 15.370 1.00 33.20 ? 41 PHE B CE1 1 ATOM 181 C CE2 . PHE A 1 24 ? -17.065 43.215 13.325 1.00 35.35 ? 41 PHE B CE2 1 ATOM 182 C CZ . PHE A 1 24 ? -16.704 42.529 14.466 1.00 34.56 ? 41 PHE B CZ 1 ATOM 183 N N . CYS A 1 25 ? -13.161 44.134 12.427 1.00 30.26 ? 42 CYS B N 1 ATOM 184 C CA . CYS A 1 25 ? -13.275 42.987 11.536 1.00 32.56 ? 42 CYS B CA 1 ATOM 185 C C . CYS A 1 25 ? -13.376 41.682 12.326 1.00 30.77 ? 42 CYS B C 1 ATOM 186 O O . CYS A 1 25 ? -13.196 41.632 13.537 1.00 30.18 ? 42 CYS B O 1 ATOM 187 C CB . CYS A 1 25 ? -12.096 42.917 10.570 1.00 36.42 ? 42 CYS B CB 1 ATOM 188 S SG . CYS A 1 25 ? -12.480 43.708 8.984 1.00 40.83 ? 42 CYS B SG 1 ATOM 189 N N . ALA A 1 26 ? -13.672 40.614 11.587 1.00 29.98 ? 43 ALA B N 1 ATOM 190 C CA . ALA A 1 26 ? -13.728 39.291 12.134 1.00 29.45 ? 43 ALA B CA 1 ATOM 191 C C . ALA A 1 26 ? -12.550 38.493 11.591 1.00 29.26 ? 43 ALA B C 1 ATOM 192 O O . ALA A 1 26 ? -11.913 38.888 10.606 1.00 27.29 ? 43 ALA B O 1 ATOM 193 C CB . ALA A 1 26 ? -15.035 38.637 11.780 1.00 30.48 ? 43 ALA B CB 1 ATOM 194 N N . GLY A 1 27 ? -12.281 37.379 12.262 1.00 27.90 ? 44 GLY B N 1 ATOM 195 C CA . GLY A 1 27 ? -11.281 36.467 11.822 1.00 29.14 ? 44 GLY B CA 1 ATOM 196 C C . GLY A 1 27 ? -11.530 35.078 12.368 1.00 30.28 ? 44 GLY B C 1 ATOM 197 O O . GLY A 1 27 ? -12.467 34.862 13.130 1.00 31.74 ? 44 GLY B O 1 ATOM 198 N N . SER A 1 28 ? -10.667 34.141 11.979 1.00 29.33 ? 45 SER B N 1 ATOM 199 C CA . SER A 1 28 ? -10.833 32.769 12.345 1.00 30.07 ? 45 SER B CA 1 ATOM 200 C C . SER A 1 28 ? -9.551 32.263 13.012 1.00 28.90 ? 45 SER B C 1 ATOM 201 O O . SER A 1 28 ? -8.491 32.309 12.413 1.00 31.45 ? 45 SER B O 1 ATOM 202 C CB . SER A 1 28 ? -11.207 31.980 11.125 1.00 31.19 ? 45 SER B CB 1 ATOM 203 O OG . SER A 1 28 ? -12.380 32.526 10.533 1.00 30.89 ? 45 SER B OG 1 ATOM 204 N N . LEU A 1 29 ? -9.653 31.831 14.270 1.00 27.32 ? 46 LEU B N 1 ATOM 205 C CA . LEU A 1 29 ? -8.526 31.220 14.989 1.00 27.74 ? 46 LEU B CA 1 ATOM 206 C C . LEU A 1 29 ? -8.245 29.847 14.376 1.00 28.14 ? 46 LEU B C 1 ATOM 207 O O . LEU A 1 29 ? -9.117 29.011 14.416 1.00 30.82 ? 46 LEU B O 1 ATOM 208 C CB . LEU A 1 29 ? -8.912 31.090 16.463 1.00 26.64 ? 46 LEU B CB 1 ATOM 209 C CG . LEU A 1 29 ? -7.809 30.659 17.424 1.00 26.93 ? 46 LEU B CG 1 ATOM 210 C CD1 . LEU A 1 29 ? -6.791 31.774 17.627 1.00 26.40 ? 46 LEU B CD1 1 ATOM 211 C CD2 . LEU A 1 29 ? -8.402 30.233 18.772 1.00 26.15 ? 46 LEU B CD2 1 ATOM 212 N N . ILE A 1 30 ? -7.049 29.643 13.803 1.00 29.27 ? 47 ILE B N 1 ATOM 213 C CA . ILE A 1 30 ? -6.654 28.354 13.166 1.00 28.83 ? 47 ILE B CA 1 ATOM 214 C C . ILE A 1 30 ? -5.663 27.585 14.052 1.00 27.09 ? 47 ILE B C 1 ATOM 215 O O . ILE A 1 30 ? -5.450 26.421 13.863 1.00 28.05 ? 47 ILE B O 1 ATOM 216 C CB . ILE A 1 30 ? -6.083 28.559 11.750 1.00 29.75 ? 47 ILE B CB 1 ATOM 217 C CG1 . ILE A 1 30 ? -4.802 29.397 11.749 1.00 30.88 ? 47 ILE B CG1 1 ATOM 218 C CG2 . ILE A 1 30 ? -7.142 29.138 10.836 1.00 30.56 ? 47 ILE B CG2 1 ATOM 219 C CD1 . ILE A 1 30 ? -4.249 29.668 10.364 1.00 31.92 ? 47 ILE B CD1 1 ATOM 220 N N . ALA A 1 31 ? -5.070 28.253 15.027 1.00 27.84 ? 48 ALA B N 1 ATOM 221 C CA . ALA A 1 31 ? -4.222 27.617 16.023 1.00 29.07 ? 48 ALA B CA 1 ATOM 222 C C . ALA A 1 31 ? -4.212 28.528 17.241 1.00 28.55 ? 48 ALA B C 1 ATOM 223 O O . ALA A 1 31 ? -4.575 29.693 17.117 1.00 29.29 ? 48 ALA B O 1 ATOM 224 C CB . ALA A 1 31 ? -2.836 27.418 15.464 1.00 28.41 ? 48 ALA B CB 1 ATOM 225 N N . PRO A 1 32 ? -3.818 28.065 18.444 1.00 29.21 ? 49 PRO B N 1 ATOM 226 C CA . PRO A 1 32 ? -3.887 28.913 19.642 1.00 29.55 ? 49 PRO B CA 1 ATOM 227 C C . PRO A 1 32 ? -3.265 30.302 19.466 1.00 30.38 ? 49 PRO B C 1 ATOM 228 O O . PRO A 1 32 ? -3.809 31.251 20.042 1.00 31.78 ? 49 PRO B O 1 ATOM 229 C CB . PRO A 1 32 ? -3.143 28.096 20.705 1.00 28.43 ? 49 PRO B CB 1 ATOM 230 C CG . PRO A 1 32 ? -3.423 26.675 20.277 1.00 28.08 ? 49 PRO B CG 1 ATOM 231 C CD . PRO A 1 32 ? -3.340 26.712 18.754 1.00 28.33 ? 49 PRO B CD 1 ATOM 232 N N . CYS A 1 33 ? -2.204 30.408 18.641 1.00 31.03 ? 50 CYS B N 1 ATOM 233 C CA . CYS A 1 33 ? -1.468 31.690 18.402 1.00 31.36 ? 50 CYS B CA 1 ATOM 234 C C . CYS A 1 33 ? -1.732 32.321 17.021 1.00 29.38 ? 50 CYS B C 1 ATOM 235 O O . CYS A 1 33 ? -1.118 33.319 16.690 1.00 30.99 ? 50 CYS B O 1 ATOM 236 C CB . CYS A 1 33 ? 0.034 31.474 18.540 1.00 32.88 ? 50 CYS B CB 1 ATOM 237 S SG . CYS A 1 33 ? 0.517 31.036 20.229 1.00 35.23 ? 50 CYS B SG 1 ATOM 238 N N . TRP A 1 34 ? -2.640 31.772 16.216 1.00 27.49 ? 51 TRP B N 1 ATOM 239 C CA . TRP A 1 34 ? -2.750 32.203 14.826 1.00 27.40 ? 51 TRP B CA 1 ATOM 240 C C . TRP A 1 34 ? -4.202 32.512 14.442 1.00 26.40 ? 51 TRP B C 1 ATOM 241 O O . TRP A 1 34 ? -5.113 31.688 14.646 1.00 25.97 ? 51 TRP B O 1 ATOM 242 C CB . TRP A 1 34 ? -2.165 31.137 13.896 1.00 29.25 ? 51 TRP B CB 1 ATOM 243 C CG . TRP A 1 34 ? -0.690 30.943 14.040 1.00 30.07 ? 51 TRP B CG 1 ATOM 244 C CD1 . TRP A 1 34 ? -0.053 29.955 14.728 1.00 30.23 ? 51 TRP B CD1 1 ATOM 245 C CD2 . TRP A 1 34 ? 0.340 31.771 13.479 1.00 31.02 ? 51 TRP B CD2 1 ATOM 246 N NE1 . TRP A 1 34 ? 1.300 30.117 14.645 1.00 31.10 ? 51 TRP B NE1 1 ATOM 247 C CE2 . TRP A 1 34 ? 1.575 31.214 13.876 1.00 31.13 ? 51 TRP B CE2 1 ATOM 248 C CE3 . TRP A 1 34 ? 0.338 32.917 12.681 1.00 30.57 ? 51 TRP B CE3 1 ATOM 249 C CZ2 . TRP A 1 34 ? 2.797 31.766 13.501 1.00 31.57 ? 51 TRP B CZ2 1 ATOM 250 C CZ3 . TRP A 1 34 ? 1.546 33.468 12.320 1.00 32.18 ? 51 TRP B CZ3 1 ATOM 251 C CH2 . TRP A 1 34 ? 2.755 32.900 12.724 1.00 32.80 ? 51 TRP B CH2 1 ATOM 252 N N . VAL A 1 35 ? -4.392 33.671 13.806 1.00 24.17 ? 52 VAL B N 1 ATOM 253 C CA . VAL A 1 35 ? -5.697 34.104 13.342 1.00 23.15 ? 52 VAL B CA 1 ATOM 254 C C . VAL A 1 35 ? -5.609 34.443 11.849 1.00 22.89 ? 52 VAL B C 1 ATOM 255 O O . VAL A 1 35 ? -4.667 35.070 11.388 1.00 23.42 ? 52 VAL B O 1 ATOM 256 C CB . VAL A 1 35 ? -6.183 35.283 14.207 1.00 22.33 ? 52 VAL B CB 1 ATOM 257 C CG1 . VAL A 1 35 ? -7.364 36.032 13.601 1.00 21.94 ? 52 VAL B CG1 1 ATOM 258 C CG2 . VAL A 1 35 ? -6.502 34.802 15.616 1.00 22.36 ? 52 VAL B CG2 1 ATOM 259 N N . LEU A 1 36 ? -6.624 34.024 11.103 1.00 23.87 ? 53 LEU B N 1 ATOM 260 C CA . LEU A 1 36 ? -6.737 34.294 9.685 1.00 26.53 ? 53 LEU B CA 1 ATOM 261 C C . LEU A 1 36 ? -7.891 35.281 9.455 1.00 26.74 ? 53 LEU B C 1 ATOM 262 O O . LEU A 1 36 ? -8.917 35.183 10.103 1.00 28.85 ? 53 LEU B O 1 ATOM 263 C CB . LEU A 1 36 ? -7.001 32.948 9.009 1.00 29.24 ? 53 LEU B CB 1 ATOM 264 C CG . LEU A 1 36 ? -6.423 32.723 7.615 1.00 32.01 ? 53 LEU B CG 1 ATOM 265 C CD1 . LEU A 1 36 ? -4.919 32.942 7.576 1.00 32.05 ? 53 LEU B CD1 1 ATOM 266 C CD2 . LEU A 1 36 ? -6.758 31.302 7.163 1.00 34.59 ? 53 LEU B CD2 1 ATOM 267 N N . THR A 1 37 ? -7.703 36.234 8.537 1.00 27.16 ? 54 THR B N 1 ATOM 268 C CA . THR A 1 37 ? -8.713 37.223 8.195 1.00 26.60 ? 54 THR B CA 1 ATOM 269 C C . THR A 1 37 ? -8.522 37.660 6.741 1.00 25.15 ? 54 THR B C 1 ATOM 270 O O . THR A 1 37 ? -7.747 37.081 6.004 1.00 24.22 ? 54 THR B O 1 ATOM 271 C CB . THR A 1 37 ? -8.656 38.405 9.168 1.00 28.65 ? 54 THR B CB 1 ATOM 272 O OG1 . THR A 1 37 ? -9.664 39.352 8.811 1.00 30.49 ? 54 THR B OG1 1 ATOM 273 C CG2 . THR A 1 37 ? -7.319 39.107 9.166 1.00 29.01 ? 54 THR B CG2 1 ATOM 274 N N . ALA A 1 38 ? -9.257 38.691 6.336 1.00 25.84 ? 55 ALA B N 1 ATOM 275 C CA . ALA A 1 38 ? -9.162 39.211 4.997 1.00 28.18 ? 55 ALA B CA 1 ATOM 276 C C . ALA A 1 38 ? -8.066 40.271 4.981 1.00 30.68 ? 55 ALA B C 1 ATOM 277 O O . ALA A 1 38 ? -7.765 40.881 6.005 1.00 33.64 ? 55 ALA B O 1 ATOM 278 C CB . ALA A 1 38 ? -10.487 39.779 4.554 1.00 27.74 ? 55 ALA B CB 1 ATOM 279 N N . ALA A 1 39 ? -7.471 40.465 3.808 1.00 33.37 ? 56 ALA B N 1 ATOM 280 C CA . ALA A 1 39 ? -6.461 41.488 3.609 1.00 33.68 ? 56 ALA B CA 1 ATOM 281 C C . ALA A 1 39 ? -7.119 42.872 3.675 1.00 32.28 ? 56 ALA B C 1 ATOM 282 O O . ALA A 1 39 ? -6.570 43.782 4.292 1.00 32.58 ? 56 ALA B O 1 ATOM 283 C CB . ALA A 1 39 ? -5.764 41.269 2.289 1.00 34.38 ? 56 ALA B CB 1 ATOM 284 N N . HIS A 1 40 ? -8.295 43.006 3.046 1.00 30.41 ? 57 HIS B N 1 ATOM 285 C CA . HIS A 1 40 ? -8.980 44.302 2.901 1.00 28.59 ? 57 HIS B CA 1 ATOM 286 C C . HIS A 1 40 ? -9.274 44.907 4.277 1.00 26.85 ? 57 HIS B C 1 ATOM 287 O O . HIS A 1 40 ? -9.229 46.106 4.445 1.00 24.97 ? 57 HIS B O 1 ATOM 288 C CB . HIS A 1 40 ? -10.237 44.174 2.030 1.00 28.48 ? 57 HIS B CB 1 ATOM 289 C CG . HIS A 1 40 ? -11.434 43.560 2.685 1.00 30.19 ? 57 HIS B CG 1 ATOM 290 N ND1 . HIS A 1 40 ? -11.928 42.322 2.306 1.00 30.09 ? 57 HIS B ND1 1 ATOM 291 C CD2 . HIS A 1 40 ? -12.255 44.006 3.663 1.00 29.88 ? 57 HIS B CD2 1 ATOM 292 C CE1 . HIS A 1 40 ? -12.995 42.042 3.021 1.00 29.80 ? 57 HIS B CE1 1 ATOM 293 N NE2 . HIS A 1 40 ? -13.225 43.062 3.850 1.00 29.40 ? 57 HIS B NE2 1 ATOM 294 N N . CYS A 1 41 ? -9.562 44.040 5.246 1.00 27.56 ? 58 CYS B N 1 ATOM 295 C CA . CYS A 1 41 ? -9.849 44.412 6.606 1.00 27.44 ? 58 CYS B CA 1 ATOM 296 C C . CYS A 1 41 ? -8.765 45.302 7.192 1.00 25.50 ? 58 CYS B C 1 ATOM 297 O O . CYS A 1 41 ? -9.086 46.237 7.898 1.00 24.39 ? 58 CYS B O 1 ATOM 298 C CB . CYS A 1 41 ? -9.921 43.181 7.490 1.00 30.84 ? 58 CYS B CB 1 ATOM 299 S SG . CYS A 1 41 ? -11.592 42.508 7.593 1.00 34.56 ? 58 CYS B SG 1 ATOM 300 N N . LEU A 1 42 ? -7.506 44.934 6.926 1.00 26.46 ? 59 LEU B N 1 ATOM 301 C CA . LEU A 1 42 ? -6.308 45.580 7.474 1.00 26.76 ? 59 LEU B CA 1 ATOM 302 C C . LEU A 1 42 ? -5.495 46.289 6.377 1.00 26.41 ? 59 LEU B C 1 ATOM 303 O O . LEU A 1 42 ? -4.323 46.553 6.570 1.00 27.01 ? 59 LEU B O 1 ATOM 304 C CB . LEU A 1 42 ? -5.461 44.506 8.156 1.00 27.13 ? 59 LEU B CB 1 ATOM 305 C CG . LEU A 1 42 ? -6.113 43.804 9.345 1.00 29.08 ? 59 LEU B CG 1 ATOM 306 C CD1 . LEU A 1 42 ? -5.377 42.520 9.686 1.00 30.10 ? 59 LEU B CD1 1 ATOM 307 C CD2 . LEU A 1 42 ? -6.169 44.705 10.566 1.00 29.51 ? 59 LEU B CD2 1 ATOM 308 N N . GLN A 1 43 ? -6.123 46.565 5.230 1.00 27.02 ? 60 GLN B N 1 ATOM 309 C CA . GLN A 1 43 ? -5.633 47.459 4.170 1.00 29.15 ? 60 GLN B CA 1 ATOM 310 C C . GLN A 1 43 ? -4.817 48.630 4.738 1.00 29.97 ? 60 GLN B C 1 ATOM 311 O O . GLN A 1 43 ? -3.801 49.035 4.173 1.00 29.82 ? 60 GLN B O 1 ATOM 312 C CB . GLN A 1 43 ? -6.826 48.090 3.439 1.00 31.36 ? 60 GLN B CB 1 ATOM 313 C CG . GLN A 1 43 ? -7.078 47.569 2.034 1.00 32.05 ? 60 GLN B CG 1 ATOM 314 C CD . GLN A 1 43 ? -8.364 48.102 1.455 1.00 32.36 ? 60 GLN B CD 1 ATOM 315 O OE1 . GLN A 1 43 ? -8.894 49.106 1.925 1.00 39.40 ? 60 GLN B OE1 1 ATOM 316 N NE2 . GLN A 1 43 ? -8.877 47.441 0.426 1.00 30.46 ? 60 GLN B NE2 1 ATOM 317 N N . ASP A 1 44 A -5.325 49.223 5.822 1.00 30.57 ? 60 ASP B N 1 ATOM 318 C CA . ASP A 1 44 A -4.805 50.474 6.351 1.00 32.33 ? 60 ASP B CA 1 ATOM 319 C C . ASP A 1 44 A -3.524 50.219 7.148 1.00 30.71 ? 60 ASP B C 1 ATOM 320 O O . ASP A 1 44 A -2.940 51.157 7.638 1.00 33.38 ? 60 ASP B O 1 ATOM 321 C CB . ASP A 1 44 A -5.846 51.192 7.213 1.00 34.57 ? 60 ASP B CB 1 ATOM 322 C CG . ASP A 1 44 A -6.414 50.326 8.336 1.00 40.41 ? 60 ASP B CG 1 ATOM 323 O OD1 . ASP A 1 44 A -6.633 49.115 8.092 1.00 47.24 ? 60 ASP B OD1 1 ATOM 324 O OD2 . ASP A 1 44 A -6.650 50.856 9.445 1.00 39.16 ? 60 ASP B OD2 1 ATOM 325 N N . ARG A 1 45 B -3.130 48.950 7.301 1.00 30.80 ? 60 ARG B N 1 ATOM 326 C CA . ARG A 1 45 B -1.821 48.542 7.831 1.00 30.46 ? 60 ARG B CA 1 ATOM 327 C C . ARG A 1 45 B -1.598 49.098 9.235 1.00 28.71 ? 60 ARG B C 1 ATOM 328 O O . ARG A 1 45 B -0.544 49.647 9.520 1.00 27.74 ? 60 ARG B O 1 ATOM 329 C CB . ARG A 1 45 B -0.694 49.039 6.919 1.00 32.51 ? 60 ARG B CB 1 ATOM 330 C CG . ARG A 1 45 B -0.118 47.990 5.986 1.00 34.03 ? 60 ARG B CG 1 ATOM 331 C CD . ARG A 1 45 B -0.826 47.978 4.661 1.00 36.61 ? 60 ARG B CD 1 ATOM 332 N NE . ARG A 1 45 B -0.047 47.210 3.706 1.00 41.18 ? 60 ARG B NE 1 ATOM 333 C CZ . ARG A 1 45 B -0.465 46.854 2.491 1.00 42.90 ? 60 ARG B CZ 1 ATOM 334 N NH1 . ARG A 1 45 B 0.303 46.070 1.755 1.00 42.49 ? 60 ARG B NH1 1 ATOM 335 N NH2 . ARG A 1 45 B -1.629 47.275 2.015 1.00 40.11 ? 60 ARG B NH2 1 ATOM 336 N N . PRO A 1 46 C -2.549 48.972 10.176 1.00 28.72 ? 60 PRO B N 1 ATOM 337 C CA . PRO A 1 46 C -2.340 49.498 11.522 1.00 30.36 ? 60 PRO B CA 1 ATOM 338 C C . PRO A 1 46 C -1.117 48.843 12.170 1.00 31.11 ? 60 PRO B C 1 ATOM 339 O O . PRO A 1 46 C -0.836 47.689 11.883 1.00 33.63 ? 60 PRO B O 1 ATOM 340 C CB . PRO A 1 46 C -3.593 49.065 12.285 1.00 32.92 ? 60 PRO B CB 1 ATOM 341 C CG . PRO A 1 46 C -4.099 47.865 11.489 1.00 33.18 ? 60 PRO B CG 1 ATOM 342 C CD . PRO A 1 46 C -3.807 48.230 10.044 1.00 31.58 ? 60 PRO B CD 1 ATOM 343 N N . ALA A 1 47 D -0.381 49.588 12.998 1.00 32.12 ? 60 ALA B N 1 ATOM 344 C CA . ALA A 1 47 D 0.715 48.998 13.755 1.00 29.54 ? 60 ALA B CA 1 ATOM 345 C C . ALA A 1 47 D 0.132 47.878 14.609 1.00 28.23 ? 60 ALA B C 1 ATOM 346 O O . ALA A 1 47 D -0.977 47.992 15.130 1.00 26.64 ? 60 ALA B O 1 ATOM 347 C CB . ALA A 1 47 D 1.399 50.025 14.615 1.00 29.74 ? 60 ALA B CB 1 ATOM 348 N N . PRO A 1 48 ? 0.856 46.759 14.781 1.00 26.92 ? 61 PRO B N 1 ATOM 349 C CA . PRO A 1 48 ? 0.283 45.592 15.439 1.00 27.16 ? 61 PRO B CA 1 ATOM 350 C C . PRO A 1 48 ? -0.105 45.897 16.896 1.00 25.99 ? 61 PRO B C 1 ATOM 351 O O . PRO A 1 48 ? -1.038 45.272 17.412 1.00 23.83 ? 61 PRO B O 1 ATOM 352 C CB . PRO A 1 48 ? 1.376 44.518 15.316 1.00 26.82 ? 61 PRO B CB 1 ATOM 353 C CG . PRO A 1 48 ? 2.662 45.278 15.061 1.00 26.53 ? 61 PRO B CG 1 ATOM 354 C CD . PRO A 1 48 ? 2.259 46.575 14.396 1.00 26.91 ? 61 PRO B CD 1 ATOM 355 N N . GLU A 1 49 ? 0.590 46.854 17.534 1.00 25.44 ? 62 GLU B N 1 ATOM 356 C CA . GLU A 1 49 ? 0.287 47.219 18.944 1.00 26.58 ? 62 GLU B CA 1 ATOM 357 C C . GLU A 1 49 ? -1.123 47.821 19.047 1.00 26.90 ? 62 GLU B C 1 ATOM 358 O O . GLU A 1 49 ? -1.723 47.797 20.109 1.00 27.00 ? 62 GLU B O 1 ATOM 359 C CB . GLU A 1 49 ? 1.340 48.154 19.554 1.00 27.13 ? 62 GLU B CB 1 ATOM 360 C CG . GLU A 1 49 ? 1.573 49.453 18.793 1.00 28.56 ? 62 GLU B CG 1 ATOM 361 C CD . GLU A 1 49 ? 2.722 49.415 17.797 1.00 29.64 ? 62 GLU B CD 1 ATOM 362 O OE1 . GLU A 1 49 ? 2.988 48.309 17.258 1.00 29.11 ? 62 GLU B OE1 1 ATOM 363 O OE2 . GLU A 1 49 ? 3.344 50.491 17.560 1.00 30.17 ? 62 GLU B OE2 1 ATOM 364 N N . ASP A 1 50 ? -1.650 48.325 17.925 1.00 27.33 ? 63 ASP B N 1 ATOM 365 C CA . ASP A 1 50 ? -2.923 48.992 17.879 1.00 27.76 ? 63 ASP B CA 1 ATOM 366 C C . ASP A 1 50 ? -4.076 47.986 17.788 1.00 27.89 ? 63 ASP B C 1 ATOM 367 O O . ASP A 1 50 ? -5.216 48.382 17.934 1.00 27.86 ? 63 ASP B O 1 ATOM 368 C CB . ASP A 1 50 ? -3.010 49.942 16.684 1.00 30.83 ? 63 ASP B CB 1 ATOM 369 C CG . ASP A 1 50 ? -2.081 51.146 16.749 1.00 33.71 ? 63 ASP B CG 1 ATOM 370 O OD1 . ASP A 1 50 ? -1.721 51.556 17.890 1.00 29.79 ? 63 ASP B OD1 1 ATOM 371 O OD2 . ASP A 1 50 ? -1.726 51.671 15.640 1.00 38.27 ? 63 ASP B OD2 1 ATOM 372 N N . LEU A 1 51 ? -3.791 46.706 17.526 1.00 29.56 ? 64 LEU B N 1 ATOM 373 C CA . LEU A 1 51 ? -4.849 45.702 17.344 1.00 29.83 ? 64 LEU B CA 1 ATOM 374 C C . LEU A 1 51 ? -5.219 45.087 18.693 1.00 29.88 ? 64 LEU B C 1 ATOM 375 O O . LEU A 1 51 ? -4.340 44.771 19.482 1.00 32.80 ? 64 LEU B O 1 ATOM 376 C CB . LEU A 1 51 ? -4.373 44.590 16.405 1.00 30.27 ? 64 LEU B CB 1 ATOM 377 C CG . LEU A 1 51 ? -4.193 44.960 14.935 1.00 30.93 ? 64 LEU B CG 1 ATOM 378 C CD1 . LEU A 1 51 ? -3.326 43.920 14.240 1.00 31.30 ? 64 LEU B CD1 1 ATOM 379 C CD2 . LEU A 1 51 ? -5.532 45.088 14.231 1.00 32.09 ? 64 LEU B CD2 1 ATOM 380 N N . THR A 1 52 ? -6.519 44.864 18.901 1.00 28.19 ? 65 THR B N 1 ATOM 381 C CA . THR A 1 52 ? -7.035 43.985 19.952 1.00 26.93 ? 65 THR B CA 1 ATOM 382 C C . THR A 1 52 ? -7.819 42.833 19.319 1.00 27.76 ? 65 THR B C 1 ATOM 383 O O . THR A 1 52 ? -8.744 43.055 18.514 1.00 28.18 ? 65 THR B O 1 ATOM 384 C CB . THR A 1 52 ? -7.982 44.733 20.891 1.00 25.84 ? 65 THR B CB 1 ATOM 385 O OG1 . THR A 1 52 ? -7.271 45.893 21.304 1.00 26.41 ? 65 THR B OG1 1 ATOM 386 C CG2 . THR A 1 52 ? -8.426 43.918 22.081 1.00 24.76 ? 65 THR B CG2 1 ATOM 387 N N . VAL A 1 53 ? -7.459 41.607 19.703 1.00 28.22 ? 66 VAL B N 1 ATOM 388 C CA . VAL A 1 53 ? -8.203 40.430 19.310 1.00 29.02 ? 66 VAL B CA 1 ATOM 389 C C . VAL A 1 53 ? -8.937 39.914 20.550 1.00 28.96 ? 66 VAL B C 1 ATOM 390 O O . VAL A 1 53 ? -8.334 39.756 21.612 1.00 28.35 ? 66 VAL B O 1 ATOM 391 C CB . VAL A 1 53 ? -7.298 39.356 18.682 1.00 29.53 ? 66 VAL B CB 1 ATOM 392 C CG1 . VAL A 1 53 ? -8.092 38.120 18.306 1.00 31.47 ? 66 VAL B CG1 1 ATOM 393 C CG2 . VAL A 1 53 ? -6.557 39.881 17.464 1.00 29.96 ? 66 VAL B CG2 1 ATOM 394 N N . VAL A 1 54 ? -10.248 39.696 20.395 1.00 28.74 ? 67 VAL B N 1 ATOM 395 C CA . VAL A 1 54 ? -11.094 39.170 21.446 1.00 29.95 ? 67 VAL B CA 1 ATOM 396 C C . VAL A 1 54 ? -11.577 37.793 20.994 1.00 28.98 ? 67 VAL B C 1 ATOM 397 O O . VAL A 1 54 ? -12.196 37.676 19.941 1.00 30.29 ? 67 VAL B O 1 ATOM 398 C CB . VAL A 1 54 ? -12.279 40.109 21.753 1.00 29.98 ? 67 VAL B CB 1 ATOM 399 C CG1 . VAL A 1 54 ? -13.045 39.689 22.998 1.00 29.51 ? 67 VAL B CG1 1 ATOM 400 C CG2 . VAL A 1 54 ? -11.821 41.549 21.892 1.00 30.36 ? 67 VAL B CG2 1 ATOM 401 N N . LEU A 1 55 ? -11.299 36.773 21.805 1.00 27.98 ? 68 LEU B N 1 ATOM 402 C CA . LEU A 1 55 ? -11.764 35.425 21.524 1.00 30.63 ? 68 LEU B CA 1 ATOM 403 C C . LEU A 1 55 ? -12.879 35.042 22.503 1.00 32.65 ? 68 LEU B C 1 ATOM 404 O O . LEU A 1 55 ? -12.863 35.485 23.665 1.00 32.60 ? 68 LEU B O 1 ATOM 405 C CB . LEU A 1 55 ? -10.585 34.456 21.622 1.00 29.22 ? 68 LEU B CB 1 ATOM 406 C CG . LEU A 1 55 ? -9.447 34.746 20.651 1.00 27.78 ? 68 LEU B CG 1 ATOM 407 C CD1 . LEU A 1 55 ? -8.273 33.843 20.940 1.00 27.00 ? 68 LEU B CD1 1 ATOM 408 C CD2 . LEU A 1 55 ? -9.910 34.594 19.211 1.00 27.88 ? 68 LEU B CD2 1 ATOM 409 N N . GLY A 1 56 ? -13.820 34.218 22.010 1.00 31.48 ? 69 GLY B N 1 ATOM 410 C CA . GLY A 1 56 ? -14.896 33.640 22.802 1.00 31.84 ? 69 GLY B CA 1 ATOM 411 C C . GLY A 1 56 ? -15.949 34.669 23.162 1.00 33.24 ? 69 GLY B C 1 ATOM 412 O O . GLY A 1 56 ? -16.499 34.641 24.260 1.00 36.31 ? 69 GLY B O 1 ATOM 413 N N . GLN A 1 57 ? -16.232 35.565 22.212 1.00 34.02 ? 70 GLN B N 1 ATOM 414 C CA . GLN A 1 57 ? -17.092 36.724 22.399 1.00 33.54 ? 70 GLN B CA 1 ATOM 415 C C . GLN A 1 57 ? -18.464 36.427 21.792 1.00 33.66 ? 70 GLN B C 1 ATOM 416 O O . GLN A 1 57 ? -18.547 35.974 20.673 1.00 32.13 ? 70 GLN B O 1 ATOM 417 C CB . GLN A 1 57 ? -16.460 37.943 21.719 1.00 35.54 ? 70 GLN B CB 1 ATOM 418 C CG . GLN A 1 57 ? -17.244 39.235 21.901 1.00 37.86 ? 70 GLN B CG 1 ATOM 419 C CD . GLN A 1 57 ? -16.416 40.487 21.729 1.00 37.86 ? 70 GLN B CD 1 ATOM 420 O OE1 . GLN A 1 57 ? -15.815 40.714 20.674 1.00 37.61 ? 70 GLN B OE1 1 ATOM 421 N NE2 . GLN A 1 57 ? -16.368 41.304 22.770 1.00 36.02 ? 70 GLN B NE2 1 ATOM 422 N N . GLU A 1 58 ? -19.530 36.730 22.541 1.00 37.71 ? 71 GLU B N 1 ATOM 423 C CA . GLU A 1 58 ? -20.904 36.519 22.108 1.00 35.75 ? 71 GLU B CA 1 ATOM 424 C C . GLU A 1 58 ? -21.425 37.748 21.372 1.00 33.43 ? 71 GLU B C 1 ATOM 425 O O . GLU A 1 58 ? -22.026 37.591 20.325 1.00 32.49 ? 71 GLU B O 1 ATOM 426 C CB . GLU A 1 58 ? -21.829 36.265 23.291 1.00 39.42 ? 71 GLU B CB 1 ATOM 427 C CG . GLU A 1 58 ? -23.227 35.911 22.842 1.00 44.47 ? 71 GLU B CG 1 ATOM 428 C CD . GLU A 1 58 ? -24.214 35.716 23.970 1.00 49.03 ? 71 GLU B CD 1 ATOM 429 O OE1 . GLU A 1 58 ? -24.069 36.414 25.001 1.00 51.84 ? 71 GLU B OE1 1 ATOM 430 O OE2 . GLU A 1 58 ? -25.128 34.874 23.802 1.00 53.63 ? 71 GLU B OE2 1 ATOM 431 N N . ARG A 1 59 ? -21.210 38.937 21.955 1.00 34.19 ? 72 ARG B N 1 ATOM 432 C CA . ARG A 1 59 ? -21.747 40.202 21.428 1.00 37.17 ? 72 ARG B CA 1 ATOM 433 C C . ARG A 1 59 ? -20.620 41.186 21.074 1.00 38.61 ? 72 ARG B C 1 ATOM 434 O O . ARG A 1 59 ? -19.704 41.435 21.873 1.00 37.15 ? 72 ARG B O 1 ATOM 435 C CB . ARG A 1 59 ? -22.687 40.880 22.427 1.00 38.10 ? 72 ARG B CB 1 ATOM 436 C CG . ARG A 1 59 ? -23.829 40.005 22.915 1.00 40.84 ? 72 ARG B CG 1 ATOM 437 C CD . ARG A 1 59 ? -24.654 40.700 23.980 1.00 41.39 ? 72 ARG B CD 1 ATOM 438 N NE . ARG A 1 59 ? -25.524 41.708 23.389 1.00 44.01 ? 72 ARG B NE 1 ATOM 439 C CZ . ARG A 1 59 ? -25.967 42.789 24.020 1.00 43.74 ? 72 ARG B CZ 1 ATOM 440 N NH1 . ARG A 1 59 ? -25.570 43.042 25.254 1.00 47.77 ? 72 ARG B NH1 1 ATOM 441 N NH2 . ARG A 1 59 ? -26.799 43.614 23.413 1.00 40.88 ? 72 ARG B NH2 1 ATOM 442 N N . ARG A 1 60 ? -20.748 41.773 19.875 1.00 38.14 ? 73 ARG B N 1 ATOM 443 C CA . ARG A 1 60 ? -19.851 42.775 19.331 1.00 36.73 ? 73 ARG B CA 1 ATOM 444 C C . ARG A 1 60 ? -19.558 43.817 20.405 1.00 36.37 ? 73 ARG B C 1 ATOM 445 O O . ARG A 1 60 ? -20.445 44.531 20.857 1.00 38.78 ? 73 ARG B O 1 ATOM 446 C CB . ARG A 1 60 ? -20.455 43.450 18.095 1.00 37.76 ? 73 ARG B CB 1 ATOM 447 C CG . ARG A 1 60 ? -19.427 44.045 17.143 1.00 39.04 ? 73 ARG B CG 1 ATOM 448 C CD . ARG A 1 60 ? -20.036 44.972 16.107 1.00 40.13 ? 73 ARG B CD 1 ATOM 449 N NE . ARG A 1 60 ? -20.475 46.224 16.708 1.00 41.15 ? 73 ARG B NE 1 ATOM 450 C CZ . ARG A 1 60 ? -21.711 46.711 16.645 1.00 40.70 ? 73 ARG B CZ 1 ATOM 451 N NH1 . ARG A 1 60 ? -22.001 47.856 17.239 1.00 44.78 ? 73 ARG B NH1 1 ATOM 452 N NH2 . ARG A 1 60 ? -22.647 46.067 15.978 1.00 36.74 ? 73 ARG B NH2 1 ATOM 453 N N . ASN A 1 61 ? -18.297 43.833 20.826 1.00 36.17 ? 74 ASN B N 1 ATOM 454 C CA . ASN A 1 61 ? -17.705 44.865 21.638 1.00 36.85 ? 74 ASN B CA 1 ATOM 455 C C . ASN A 1 61 ? -18.236 44.798 23.076 1.00 35.54 ? 74 ASN B C 1 ATOM 456 O O . ASN A 1 61 ? -18.077 45.752 23.828 1.00 33.83 ? 74 ASN B O 1 ATOM 457 C CB . ASN A 1 61 ? -17.860 46.248 20.996 1.00 37.17 ? 74 ASN B CB 1 ATOM 458 C CG . ASN A 1 61 ? -16.789 47.206 21.469 1.00 37.90 ? 74 ASN B CG 1 ATOM 459 O OD1 . ASN A 1 61 ? -17.085 48.365 21.742 1.00 37.13 ? 74 ASN B OD1 1 ATOM 460 N ND2 . ASN A 1 61 ? -15.559 46.710 21.589 1.00 39.89 ? 74 ASN B ND2 1 ATOM 461 N N . HIS A 1 62 ? -18.766 43.637 23.472 1.00 37.07 ? 75 HIS B N 1 ATOM 462 C CA . HIS A 1 62 ? -19.195 43.393 24.837 1.00 41.07 ? 75 HIS B CA 1 ATOM 463 C C . HIS A 1 62 ? -18.231 42.444 25.549 1.00 42.79 ? 75 HIS B C 1 ATOM 464 O O . HIS A 1 62 ? -17.885 41.373 25.014 1.00 45.97 ? 75 HIS B O 1 ATOM 465 C CB . HIS A 1 62 ? -20.581 42.755 24.870 1.00 46.98 ? 75 HIS B CB 1 ATOM 466 C CG . HIS A 1 62 ? -21.697 43.731 24.802 1.00 54.91 ? 75 HIS B CG 1 ATOM 467 N ND1 . HIS A 1 62 ? -22.132 44.273 23.601 1.00 61.05 ? 75 HIS B ND1 1 ATOM 468 C CD2 . HIS A 1 62 ? -22.477 44.249 25.772 1.00 58.61 ? 75 HIS B CD2 1 ATOM 469 C CE1 . HIS A 1 62 ? -23.134 45.093 23.835 1.00 61.83 ? 75 HIS B CE1 1 ATOM 470 N NE2 . HIS A 1 62 ? -23.363 45.095 25.160 1.00 65.96 ? 75 HIS B NE2 1 ATOM 471 N N . SER A 1 63 ? -17.972 42.790 26.809 1.00 42.34 ? 76 SER B N 1 ATOM 472 C CA . SER A 1 63 ? -17.208 41.928 27.737 1.00 41.51 ? 76 SER B CA 1 ATOM 473 C C . SER A 1 63 ? -18.112 40.746 28.096 1.00 40.80 ? 76 SER B C 1 ATOM 474 O O . SER A 1 63 ? -19.334 40.882 28.010 1.00 37.90 ? 76 SER B O 1 ATOM 475 C CB . SER A 1 63 ? -16.782 42.688 28.942 1.00 43.62 ? 76 SER B CB 1 ATOM 476 O OG . SER A 1 63 ? -16.438 44.009 28.578 1.00 52.41 ? 76 SER B OG 1 ATOM 477 N N . CYS A 1 64 ? -17.514 39.628 28.479 1.00 42.87 ? 77 CYS B N 1 ATOM 478 C CA . CYS A 1 64 ? -18.232 38.372 28.736 1.00 42.04 ? 77 CYS B CA 1 ATOM 479 C C . CYS A 1 64 ? -17.326 37.463 29.577 1.00 41.69 ? 77 CYS B C 1 ATOM 480 O O . CYS A 1 64 ? -16.120 37.555 29.481 1.00 41.10 ? 77 CYS B O 1 ATOM 481 C CB . CYS A 1 64 ? -18.695 37.749 27.414 1.00 42.15 ? 77 CYS B CB 1 ATOM 482 S SG . CYS A 1 64 ? -17.458 36.804 26.472 1.00 42.84 ? 77 CYS B SG 1 ATOM 483 N N . GLU A 1 65 ? -17.913 36.614 30.424 1.00 46.21 ? 78 GLU B N 1 ATOM 484 C CA . GLU A 1 65 ? -17.143 35.717 31.306 1.00 51.79 ? 78 GLU B CA 1 ATOM 485 C C . GLU A 1 65 ? -16.030 35.012 30.527 1.00 47.38 ? 78 GLU B C 1 ATOM 486 O O . GLU A 1 65 ? -14.872 35.109 30.913 1.00 48.92 ? 78 GLU B O 1 ATOM 487 C CB . GLU A 1 65 ? -18.042 34.673 31.980 1.00 62.98 ? 78 GLU B CB 1 ATOM 488 C CG . GLU A 1 65 ? -17.553 34.249 33.354 1.00 69.34 ? 78 GLU B CG 1 ATOM 489 C CD . GLU A 1 65 ? -18.003 35.179 34.473 1.00 78.58 ? 78 GLU B CD 1 ATOM 490 O OE1 . GLU A 1 65 ? -17.124 35.781 35.127 1.00 82.40 ? 78 GLU B OE1 1 ATOM 491 O OE2 . GLU A 1 65 ? -19.237 35.304 34.686 1.00 82.28 ? 78 GLU B OE2 1 ATOM 492 N N . PRO A 1 66 ? -16.321 34.280 29.425 1.00 42.45 ? 79 PRO B N 1 ATOM 493 C CA . PRO A 1 66 ? -15.290 33.535 28.700 1.00 40.90 ? 79 PRO B CA 1 ATOM 494 C C . PRO A 1 66 ? -14.526 34.286 27.589 1.00 39.00 ? 79 PRO B C 1 ATOM 495 O O . PRO A 1 66 ? -13.749 33.671 26.858 1.00 38.86 ? 79 PRO B O 1 ATOM 496 C CB . PRO A 1 66 ? -16.127 32.400 28.083 1.00 40.70 ? 79 PRO B CB 1 ATOM 497 C CG . PRO A 1 66 ? -17.438 33.066 27.727 1.00 41.67 ? 79 PRO B CG 1 ATOM 498 C CD . PRO A 1 66 ? -17.654 34.093 28.822 1.00 42.62 ? 79 PRO B CD 1 ATOM 499 N N . CYS A 1 67 ? -14.735 35.598 27.463 1.00 35.97 ? 80 CYS B N 1 ATOM 500 C CA . CYS A 1 67 ? -13.983 36.411 26.523 1.00 36.90 ? 80 CYS B CA 1 ATOM 501 C C . CYS A 1 67 ? -12.484 36.371 26.869 1.00 35.75 ? 80 CYS B C 1 ATOM 502 O O . CYS A 1 67 ? -12.110 36.338 28.030 1.00 33.34 ? 80 CYS B O 1 ATOM 503 C CB . CYS A 1 67 ? -14.477 37.855 26.515 1.00 38.99 ? 80 CYS B CB 1 ATOM 504 S SG . CYS A 1 67 ? -16.018 38.088 25.591 1.00 41.29 ? 80 CYS B SG 1 ATOM 505 N N . GLN A 1 68 ? -11.638 36.355 25.831 1.00 33.99 ? 81 GLN B N 1 ATOM 506 C CA . GLN A 1 68 ? -10.195 36.412 25.970 1.00 30.98 ? 81 GLN B CA 1 ATOM 507 C C . GLN A 1 68 ? -9.662 37.511 25.061 1.00 28.90 ? 81 GLN B C 1 ATOM 508 O O . GLN A 1 68 ? -9.932 37.506 23.865 1.00 29.59 ? 81 GLN B O 1 ATOM 509 C CB . GLN A 1 68 ? -9.548 35.074 25.618 1.00 30.55 ? 81 GLN B CB 1 ATOM 510 C CG . GLN A 1 68 ? -9.566 34.091 26.773 1.00 30.93 ? 81 GLN B CG 1 ATOM 511 C CD . GLN A 1 68 ? -8.961 32.769 26.387 1.00 30.67 ? 81 GLN B CD 1 ATOM 512 O OE1 . GLN A 1 68 ? -7.752 32.653 26.189 1.00 31.04 ? 81 GLN B OE1 1 ATOM 513 N NE2 . GLN A 1 68 ? -9.803 31.757 26.305 1.00 29.76 ? 81 GLN B NE2 1 ATOM 514 N N . THR A 1 69 ? -8.882 38.419 25.651 1.00 28.47 ? 82 THR B N 1 ATOM 515 C CA . THR A 1 69 ? -8.386 39.585 24.962 1.00 29.40 ? 82 THR B CA 1 ATOM 516 C C . THR A 1 69 ? -6.877 39.472 24.786 1.00 29.26 ? 82 THR B C 1 ATOM 517 O O . THR A 1 69 ? -6.168 39.498 25.768 1.00 30.38 ? 82 THR B O 1 ATOM 518 C CB . THR A 1 69 ? -8.690 40.865 25.740 1.00 29.71 ? 82 THR B CB 1 ATOM 519 O OG1 . THR A 1 69 ? -10.101 41.071 25.795 1.00 31.80 ? 82 THR B OG1 1 ATOM 520 C CG2 . THR A 1 69 ? -8.047 42.078 25.112 1.00 31.56 ? 82 THR B CG2 1 ATOM 521 N N . LEU A 1 70 ? -6.410 39.379 23.537 1.00 29.60 ? 83 LEU B N 1 ATOM 522 C CA . LEU A 1 70 ? -4.984 39.249 23.251 1.00 30.26 ? 83 LEU B CA 1 ATOM 523 C C . LEU A 1 70 ? -4.527 40.424 22.392 1.00 29.70 ? 83 LEU B C 1 ATOM 524 O O . LEU A 1 70 ? -5.328 41.005 21.670 1.00 28.53 ? 83 LEU B O 1 ATOM 525 C CB . LEU A 1 70 ? -4.714 37.940 22.506 1.00 32.57 ? 83 LEU B CB 1 ATOM 526 C CG . LEU A 1 70 ? -4.943 36.653 23.292 1.00 32.55 ? 83 LEU B CG 1 ATOM 527 C CD1 . LEU A 1 70 ? -6.414 36.304 23.344 1.00 34.56 ? 83 LEU B CD1 1 ATOM 528 C CD2 . LEU A 1 70 ? -4.170 35.513 22.668 1.00 33.60 ? 83 LEU B CD2 1 ATOM 529 N N . ALA A 1 71 ? -3.223 40.723 22.488 1.00 30.62 ? 84 ALA B N 1 ATOM 530 C CA . ALA A 1 71 ? -2.485 41.625 21.586 1.00 28.20 ? 84 ALA B CA 1 ATOM 531 C C . ALA A 1 71 ? -1.979 40.821 20.382 1.00 27.23 ? 84 ALA B C 1 ATOM 532 O O . ALA A 1 71 ? -2.150 39.599 20.327 1.00 28.90 ? 84 ALA B O 1 ATOM 533 C CB . ALA A 1 71 ? -1.342 42.251 22.335 1.00 26.97 ? 84 ALA B CB 1 ATOM 534 N N . VAL A 1 72 ? -1.353 41.514 19.435 1.00 25.38 ? 85 VAL B N 1 ATOM 535 C CA . VAL A 1 72 ? -0.849 40.925 18.222 1.00 25.92 ? 85 VAL B CA 1 ATOM 536 C C . VAL A 1 72 ? 0.656 41.197 18.155 1.00 26.32 ? 85 VAL B C 1 ATOM 537 O O . VAL A 1 72 ? 1.072 42.337 18.341 1.00 29.47 ? 85 VAL B O 1 ATOM 538 C CB . VAL A 1 72 ? -1.583 41.526 17.009 1.00 26.73 ? 85 VAL B CB 1 ATOM 539 C CG1 . VAL A 1 72 ? -1.035 41.039 15.674 1.00 29.08 ? 85 VAL B CG1 1 ATOM 540 C CG2 . VAL A 1 72 ? -3.071 41.279 17.087 1.00 26.48 ? 85 VAL B CG2 1 ATOM 541 N N . ARG A 1 73 ? 1.448 40.158 17.867 1.00 27.13 ? 86 ARG B N 1 ATOM 542 C CA . ARG A 1 73 ? 2.902 40.270 17.715 1.00 27.92 ? 86 ARG B CA 1 ATOM 543 C C . ARG A 1 73 ? 3.231 40.994 16.417 1.00 27.64 ? 86 ARG B C 1 ATOM 544 O O . ARG A 1 73 ? 3.999 41.956 16.400 1.00 29.87 ? 86 ARG B O 1 ATOM 545 C CB . ARG A 1 73 ? 3.576 38.902 17.606 1.00 29.29 ? 86 ARG B CB 1 ATOM 546 C CG . ARG A 1 73 ? 4.147 38.381 18.912 1.00 31.17 ? 86 ARG B CG 1 ATOM 547 C CD . ARG A 1 73 ? 5.042 37.171 18.697 1.00 30.73 ? 86 ARG B CD 1 ATOM 548 N NE . ARG A 1 73 ? 5.341 36.550 19.984 1.00 31.40 ? 86 ARG B NE 1 ATOM 549 C CZ . ARG A 1 73 ? 6.346 36.894 20.789 1.00 31.14 ? 86 ARG B CZ 1 ATOM 550 N NH1 . ARG A 1 73 ? 6.394 36.408 22.022 1.00 30.48 ? 86 ARG B NH1 1 ATOM 551 N NH2 . ARG A 1 73 ? 7.296 37.704 20.355 1.00 28.40 ? 86 ARG B NH2 1 ATOM 552 N N . SER A 1 74 ? 2.617 40.491 15.348 1.00 28.15 ? 87 SER B N 1 ATOM 553 C CA . SER A 1 74 ? 2.986 40.760 13.974 1.00 29.67 ? 87 SER B CA 1 ATOM 554 C C . SER A 1 74 ? 1.856 40.233 13.099 1.00 27.41 ? 87 SER B C 1 ATOM 555 O O . SER A 1 74 ? 1.096 39.409 13.553 1.00 27.86 ? 87 SER B O 1 ATOM 556 C CB . SER A 1 74 ? 4.305 40.088 13.615 1.00 31.72 ? 87 SER B CB 1 ATOM 557 O OG . SER A 1 74 ? 4.192 38.655 13.626 1.00 35.82 ? 87 SER B OG 1 ATOM 558 N N . TYR A 1 75 ? 1.784 40.684 11.850 1.00 27.39 ? 88 TYR B N 1 ATOM 559 C CA . TYR A 1 75 ? 0.831 40.133 10.913 1.00 29.17 ? 88 TYR B CA 1 ATOM 560 C C . TYR A 1 75 ? 1.262 40.434 9.475 1.00 31.79 ? 88 TYR B C 1 ATOM 561 O O . TYR A 1 75 ? 2.040 41.343 9.239 1.00 33.28 ? 88 TYR B O 1 ATOM 562 C CB . TYR A 1 75 ? -0.569 40.660 11.224 1.00 28.52 ? 88 TYR B CB 1 ATOM 563 C CG . TYR A 1 75 ? -0.800 42.114 10.911 1.00 27.80 ? 88 TYR B CG 1 ATOM 564 C CD1 . TYR A 1 75 ? -1.154 42.519 9.637 1.00 28.27 ? 88 TYR B CD1 1 ATOM 565 C CD2 . TYR A 1 75 ? -0.717 43.081 11.895 1.00 27.88 ? 88 TYR B CD2 1 ATOM 566 C CE1 . TYR A 1 75 ? -1.369 43.852 9.339 1.00 28.16 ? 88 TYR B CE1 1 ATOM 567 C CE2 . TYR A 1 75 ? -0.921 44.422 11.613 1.00 27.76 ? 88 TYR B CE2 1 ATOM 568 C CZ . TYR A 1 75 ? -1.257 44.809 10.330 1.00 27.62 ? 88 TYR B CZ 1 ATOM 569 O OH . TYR A 1 75 ? -1.505 46.118 10.037 1.00 27.16 ? 88 TYR B OH 1 ATOM 570 N N . ARG A 1 76 ? 0.717 39.674 8.523 1.00 34.07 ? 89 ARG B N 1 ATOM 571 C CA . ARG A 1 76 ? 1.106 39.772 7.130 1.00 37.83 ? 89 ARG B CA 1 ATOM 572 C C . ARG A 1 76 ? -0.129 39.683 6.236 1.00 36.93 ? 89 ARG B C 1 ATOM 573 O O . ARG A 1 76 ? -0.896 38.735 6.338 1.00 42.84 ? 89 ARG B O 1 ATOM 574 C CB . ARG A 1 76 ? 2.043 38.627 6.739 1.00 41.99 ? 89 ARG B CB 1 ATOM 575 C CG . ARG A 1 76 ? 3.499 39.032 6.621 1.00 51.28 ? 89 ARG B CG 1 ATOM 576 C CD . ARG A 1 76 ? 3.721 39.950 5.434 1.00 63.56 ? 89 ARG B CD 1 ATOM 577 N NE . ARG A 1 76 ? 5.066 40.520 5.402 1.00 71.26 ? 89 ARG B NE 1 ATOM 578 C CZ . ARG A 1 76 ? 6.035 40.141 4.571 1.00 78.28 ? 89 ARG B CZ 1 ATOM 579 N NH1 . ARG A 1 76 ? 5.928 39.016 3.878 1.00 72.28 ? 89 ARG B NH1 1 ATOM 580 N NH2 . ARG A 1 76 ? 7.101 40.909 4.423 1.00 83.94 ? 89 ARG B NH2 1 ATOM 581 N N . LEU A 1 77 ? -0.280 40.673 5.356 1.00 33.48 ? 90 LEU B N 1 ATOM 582 C CA . LEU A 1 77 ? -1.205 40.631 4.235 1.00 30.47 ? 90 LEU B CA 1 ATOM 583 C C . LEU A 1 77 ? -0.534 39.856 3.111 1.00 29.27 ? 90 LEU B C 1 ATOM 584 O O . LEU A 1 77 ? 0.671 39.881 3.005 1.00 28.34 ? 90 LEU B O 1 ATOM 585 C CB . LEU A 1 77 ? -1.521 42.048 3.745 1.00 29.00 ? 90 LEU B CB 1 ATOM 586 C CG . LEU A 1 77 ? -2.659 42.779 4.453 1.00 30.41 ? 90 LEU B CG 1 ATOM 587 C CD1 . LEU A 1 77 ? -2.366 43.005 5.932 1.00 29.29 ? 90 LEU B CD1 1 ATOM 588 C CD2 . LEU A 1 77 ? -2.933 44.103 3.762 1.00 31.48 ? 90 LEU B CD2 1 ATOM 589 N N . HIS A 1 78 ? -1.345 39.222 2.264 1.00 30.46 ? 91 HIS B N 1 ATOM 590 C CA . HIS A 1 78 ? -0.869 38.617 1.048 1.00 30.75 ? 91 HIS B CA 1 ATOM 591 C C . HIS A 1 78 ? -0.329 39.708 0.117 1.00 30.04 ? 91 HIS B C 1 ATOM 592 O O . HIS A 1 78 ? -1.049 40.622 -0.256 1.00 28.20 ? 91 HIS B O 1 ATOM 593 C CB . HIS A 1 78 ? -1.963 37.776 0.386 1.00 32.73 ? 91 HIS B CB 1 ATOM 594 C CG . HIS A 1 78 ? -1.406 36.875 -0.659 1.00 35.35 ? 91 HIS B CG 1 ATOM 595 N ND1 . HIS A 1 78 ? -1.039 37.335 -1.910 1.00 34.82 ? 91 HIS B ND1 1 ATOM 596 C CD2 . HIS A 1 78 ? -1.092 35.563 -0.623 1.00 37.82 ? 91 HIS B CD2 1 ATOM 597 C CE1 . HIS A 1 78 ? -0.537 36.339 -2.603 1.00 36.03 ? 91 HIS B CE1 1 ATOM 598 N NE2 . HIS A 1 78 ? -0.552 35.237 -1.833 1.00 37.92 ? 91 HIS B NE2 1 ATOM 599 N N . GLU A 1 79 ? 0.948 39.552 -0.248 1.00 31.74 ? 92 GLU B N 1 ATOM 600 C CA . GLU A 1 79 ? 1.735 40.433 -1.120 1.00 33.30 ? 92 GLU B CA 1 ATOM 601 C C . GLU A 1 79 ? 0.975 40.870 -2.379 1.00 31.37 ? 92 GLU B C 1 ATOM 602 O O . GLU A 1 79 ? 1.216 41.960 -2.877 1.00 30.30 ? 92 GLU B O 1 ATOM 603 C CB . GLU A 1 79 ? 2.984 39.693 -1.608 1.00 37.05 ? 92 GLU B CB 1 ATOM 604 C CG . GLU A 1 79 ? 4.020 39.441 -0.526 1.00 41.97 ? 92 GLU B CG 1 ATOM 605 C CD . GLU A 1 79 ? 3.817 38.205 0.345 1.00 45.39 ? 92 GLU B CD 1 ATOM 606 O OE1 . GLU A 1 79 ? 2.910 37.393 0.023 1.00 41.81 ? 92 GLU B OE1 1 ATOM 607 O OE2 . GLU A 1 79 ? 4.578 38.058 1.352 1.00 47.08 ? 92 GLU B OE2 1 ATOM 608 N N . ALA A 1 80 ? 0.142 39.983 -2.939 1.00 32.35 ? 93 ALA B N 1 ATOM 609 C CA . ALA A 1 80 ? -0.491 40.204 -4.252 1.00 32.52 ? 93 ALA B CA 1 ATOM 610 C C . ALA A 1 80 ? -1.958 40.628 -4.119 1.00 34.27 ? 93 ALA B C 1 ATOM 611 O O . ALA A 1 80 ? -2.644 40.674 -5.140 1.00 36.49 ? 93 ALA B O 1 ATOM 612 C CB . ALA A 1 80 ? -0.399 38.955 -5.081 1.00 31.88 ? 93 ALA B CB 1 ATOM 613 N N . PHE A 1 81 ? -2.427 40.944 -2.898 1.00 32.56 ? 94 PHE B N 1 ATOM 614 C CA . PHE A 1 81 ? -3.816 41.348 -2.666 1.00 31.93 ? 94 PHE B CA 1 ATOM 615 C C . PHE A 1 81 ? -4.155 42.571 -3.517 1.00 32.08 ? 94 PHE B C 1 ATOM 616 O O . PHE A 1 81 ? -3.544 43.593 -3.333 1.00 33.01 ? 94 PHE B O 1 ATOM 617 C CB . PHE A 1 81 ? -4.088 41.710 -1.205 1.00 32.07 ? 94 PHE B CB 1 ATOM 618 C CG . PHE A 1 81 ? -5.396 42.433 -1.034 1.00 31.54 ? 94 PHE B CG 1 ATOM 619 C CD1 . PHE A 1 81 ? -6.588 41.811 -1.370 1.00 34.40 ? 94 PHE B CD1 1 ATOM 620 C CD2 . PHE A 1 81 ? -5.441 43.747 -0.612 1.00 31.99 ? 94 PHE B CD2 1 ATOM 621 C CE1 . PHE A 1 81 ? -7.799 42.486 -1.267 1.00 35.76 ? 94 PHE B CE1 1 ATOM 622 C CE2 . PHE A 1 81 ? -6.650 44.422 -0.503 1.00 33.68 ? 94 PHE B CE2 1 ATOM 623 C CZ . PHE A 1 81 ? -7.828 43.792 -0.826 1.00 34.73 ? 94 PHE B CZ 1 ATOM 624 N N . SER A 1 82 ? -5.141 42.441 -4.415 1.00 32.56 ? 95 SER B N 1 ATOM 625 C CA . SER A 1 82 ? -5.568 43.520 -5.302 1.00 34.82 ? 95 SER B CA 1 ATOM 626 C C . SER A 1 82 ? -6.873 44.135 -4.814 1.00 38.56 ? 95 SER B C 1 ATOM 627 O O . SER A 1 82 ? -7.882 43.440 -4.711 1.00 40.96 ? 95 SER B O 1 ATOM 628 C CB . SER A 1 82 ? -5.761 43.037 -6.711 1.00 36.32 ? 95 SER B CB 1 ATOM 629 O OG . SER A 1 82 ? -6.506 43.995 -7.471 1.00 36.64 ? 95 SER B OG 1 ATOM 630 N N . PRO A 1 83 ? -6.906 45.454 -4.519 1.00 39.85 ? 96 PRO B N 1 ATOM 631 C CA . PRO A 1 83 ? -8.164 46.140 -4.215 1.00 38.62 ? 96 PRO B CA 1 ATOM 632 C C . PRO A 1 83 ? -8.998 46.542 -5.443 1.00 39.15 ? 96 PRO B C 1 ATOM 633 O O . PRO A 1 83 ? -10.062 47.158 -5.270 1.00 39.36 ? 96 PRO B O 1 ATOM 634 C CB . PRO A 1 83 ? -7.704 47.384 -3.441 1.00 40.85 ? 96 PRO B CB 1 ATOM 635 C CG . PRO A 1 83 ? -6.309 47.672 -3.985 1.00 41.76 ? 96 PRO B CG 1 ATOM 636 C CD . PRO A 1 83 ? -5.729 46.325 -4.378 1.00 40.68 ? 96 PRO B CD 1 ATOM 637 N N . VAL A 1 84 ? -8.526 46.196 -6.651 1.00 38.62 ? 97 VAL B N 1 ATOM 638 C CA . VAL A 1 84 ? -9.321 46.299 -7.899 1.00 38.90 ? 97 VAL B CA 1 ATOM 639 C C . VAL A 1 84 ? -10.155 45.017 -8.088 1.00 38.47 ? 97 VAL B C 1 ATOM 640 O O . VAL A 1 84 ? -11.385 45.053 -8.257 1.00 38.20 ? 97 VAL B O 1 ATOM 641 C CB . VAL A 1 84 ? -8.408 46.518 -9.120 1.00 37.36 ? 97 VAL B CB 1 ATOM 642 C CG1 . VAL A 1 84 ? -9.203 46.683 -10.399 1.00 36.22 ? 97 VAL B CG1 1 ATOM 643 C CG2 . VAL A 1 84 ? -7.466 47.684 -8.924 1.00 37.60 ? 97 VAL B CG2 1 ATOM 644 N N . SER A 1 85 ? -9.448 43.880 -8.096 1.00 37.91 ? 98 SER B N 1 ATOM 645 C CA . SER A 1 85 ? -10.000 42.563 -8.400 1.00 36.42 ? 98 SER B CA 1 ATOM 646 C C . SER A 1 85 ? -10.482 41.839 -7.133 1.00 35.14 ? 98 SER B C 1 ATOM 647 O O . SER A 1 85 ? -11.270 40.912 -7.245 1.00 34.09 ? 98 SER B O 1 ATOM 648 C CB . SER A 1 85 ? -8.980 41.740 -9.139 1.00 37.08 ? 98 SER B CB 1 ATOM 649 O OG . SER A 1 85 ? -7.877 41.418 -8.304 1.00 37.84 ? 98 SER B OG 1 ATOM 650 N N . TYR A 1 86 ? -9.972 42.264 -5.963 1.00 34.14 ? 99 TYR B N 1 ATOM 651 C CA . TYR A 1 86 ? -10.205 41.680 -4.634 1.00 34.09 ? 99 TYR B CA 1 ATOM 652 C C . TYR A 1 86 ? -9.482 40.328 -4.489 1.00 33.91 ? 99 TYR B C 1 ATOM 653 O O . TYR A 1 86 ? -9.727 39.599 -3.529 1.00 31.39 ? 99 TYR B O 1 ATOM 654 C CB . TYR A 1 86 ? -11.700 41.531 -4.337 1.00 34.22 ? 99 TYR B CB 1 ATOM 655 C CG . TYR A 1 86 ? -12.522 42.799 -4.254 1.00 36.11 ? 99 TYR B CG 1 ATOM 656 C CD1 . TYR A 1 86 ? -11.968 44.034 -3.944 1.00 36.41 ? 99 TYR B CD1 1 ATOM 657 C CD2 . TYR A 1 86 ? -13.895 42.743 -4.434 1.00 35.24 ? 99 TYR B CD2 1 ATOM 658 C CE1 . TYR A 1 86 ? -12.747 45.177 -3.856 1.00 35.96 ? 99 TYR B CE1 1 ATOM 659 C CE2 . TYR A 1 86 ? -14.689 43.870 -4.339 1.00 36.55 ? 99 TYR B CE2 1 ATOM 660 C CZ . TYR A 1 86 ? -14.116 45.095 -4.049 1.00 38.19 ? 99 TYR B CZ 1 ATOM 661 O OH . TYR A 1 86 ? -14.915 46.201 -3.946 1.00 39.40 ? 99 TYR B OH 1 ATOM 662 N N . GLN A 1 87 ? -8.572 40.009 -5.419 1.00 33.64 ? 100 GLN B N 1 ATOM 663 C CA . GLN A 1 87 ? -7.928 38.691 -5.451 1.00 34.69 ? 100 GLN B CA 1 ATOM 664 C C . GLN A 1 87 ? -6.869 38.597 -4.344 1.00 32.78 ? 100 GLN B C 1 ATOM 665 O O . GLN A 1 87 ? -6.271 39.575 -3.965 1.00 33.74 ? 100 GLN B O 1 ATOM 666 C CB . GLN A 1 87 ? -7.316 38.413 -6.827 1.00 36.35 ? 100 GLN B CB 1 ATOM 667 C CG . GLN A 1 87 ? -6.718 37.018 -6.938 1.00 39.14 ? 100 GLN B CG 1 ATOM 668 C CD . GLN A 1 87 ? -6.235 36.643 -8.318 1.00 40.87 ? 100 GLN B CD 1 ATOM 669 O OE1 . GLN A 1 87 ? -5.795 37.479 -9.098 1.00 42.06 ? 100 GLN B OE1 1 ATOM 670 N NE2 . GLN A 1 87 ? -6.291 35.356 -8.620 1.00 44.31 ? 100 GLN B NE2 1 ATOM 671 N N . HIS A 1 88 ? -6.645 37.381 -3.848 1.00 33.48 ? 101 HIS B N 1 ATOM 672 C CA . HIS A 1 88 ? -5.680 37.103 -2.805 1.00 33.74 ? 101 HIS B CA 1 ATOM 673 C C . HIS A 1 88 ? -6.048 37.855 -1.523 1.00 32.49 ? 101 HIS B C 1 ATOM 674 O O . HIS A 1 88 ? -5.193 38.453 -0.875 1.00 31.89 ? 101 HIS B O 1 ATOM 675 C CB . HIS A 1 88 ? -4.266 37.454 -3.280 1.00 35.60 ? 101 HIS B CB 1 ATOM 676 C CG . HIS A 1 88 ? -3.902 36.838 -4.586 1.00 36.59 ? 101 HIS B CG 1 ATOM 677 N ND1 . HIS A 1 88 ? -4.146 35.507 -4.863 1.00 34.65 ? 101 HIS B ND1 1 ATOM 678 C CD2 . HIS A 1 88 ? -3.291 37.355 -5.674 1.00 35.14 ? 101 HIS B CD2 1 ATOM 679 C CE1 . HIS A 1 88 ? -3.708 35.238 -6.072 1.00 36.78 ? 101 HIS B CE1 1 ATOM 680 N NE2 . HIS A 1 88 ? -3.193 36.354 -6.596 1.00 35.53 ? 101 HIS B NE2 1 ATOM 681 N N . ASP A 1 89 ? -7.324 37.787 -1.144 1.00 30.30 ? 102 ASP B N 1 ATOM 682 C CA . ASP A 1 89 ? -7.809 38.547 -0.012 1.00 29.70 ? 102 ASP B CA 1 ATOM 683 C C . ASP A 1 89 ? -7.649 37.732 1.283 1.00 29.13 ? 102 ASP B C 1 ATOM 684 O O . ASP A 1 89 ? -8.626 37.207 1.830 1.00 26.09 ? 102 ASP B O 1 ATOM 685 C CB . ASP A 1 89 ? -9.257 38.982 -0.241 1.00 29.11 ? 102 ASP B CB 1 ATOM 686 C CG . ASP A 1 89 ? -9.707 39.989 0.788 1.00 30.40 ? 102 ASP B CG 1 ATOM 687 O OD1 . ASP A 1 89 ? -8.816 40.497 1.509 1.00 31.91 ? 102 ASP B OD1 1 ATOM 688 O OD2 . ASP A 1 89 ? -10.930 40.252 0.869 1.00 29.47 ? 102 ASP B OD2 1 ATOM 689 N N . LEU A 1 90 ? -6.419 37.640 1.795 1.00 29.00 ? 103 LEU B N 1 ATOM 690 C CA . LEU A 1 90 ? -6.265 37.116 3.154 1.00 32.81 ? 103 LEU B CA 1 ATOM 691 C C . LEU A 1 90 ? -5.024 37.689 3.819 1.00 28.79 ? 103 LEU B C 1 ATOM 692 O O . LEU A 1 90 ? -4.155 38.239 3.161 1.00 27.11 ? 103 LEU B O 1 ATOM 693 C CB . LEU A 1 90 ? -6.202 35.582 3.174 1.00 36.79 ? 103 LEU B CB 1 ATOM 694 C CG . LEU A 1 90 ? -4.828 34.960 2.947 1.00 37.61 ? 103 LEU B CG 1 ATOM 695 C CD1 . LEU A 1 90 ? -4.855 33.464 3.202 1.00 38.87 ? 103 LEU B CD1 1 ATOM 696 C CD2 . LEU A 1 90 ? -4.365 35.238 1.532 1.00 42.04 ? 103 LEU B CD2 1 ATOM 697 N N . ALA A 1 91 ? -4.981 37.467 5.132 1.00 26.88 ? 104 ALA B N 1 ATOM 698 C CA . ALA A 1 91 ? -3.937 37.940 6.003 1.00 27.83 ? 104 ALA B CA 1 ATOM 699 C C . ALA A 1 91 ? -3.827 37.014 7.216 1.00 27.53 ? 104 ALA B C 1 ATOM 700 O O . ALA A 1 91 ? -4.800 36.391 7.634 1.00 25.06 ? 104 ALA B O 1 ATOM 701 C CB . ALA A 1 91 ? -4.232 39.353 6.434 1.00 28.20 ? 104 ALA B CB 1 ATOM 702 N N . LEU A 1 92 ? -2.624 36.961 7.787 1.00 28.13 ? 105 LEU B N 1 ATOM 703 C CA . LEU A 1 92 ? -2.318 36.032 8.850 1.00 29.16 ? 105 LEU B CA 1 ATOM 704 C C . LEU A 1 92 ? -1.733 36.824 10.017 1.00 28.69 ? 105 LEU B C 1 ATOM 705 O O . LEU A 1 92 ? -0.806 37.586 9.808 1.00 31.23 ? 105 LEU B O 1 ATOM 706 C CB . LEU A 1 92 ? -1.340 34.991 8.293 1.00 29.28 ? 105 LEU B CB 1 ATOM 707 C CG . LEU A 1 92 ? -0.837 33.942 9.281 1.00 29.67 ? 105 LEU B CG 1 ATOM 708 C CD1 . LEU A 1 92 ? -1.963 33.021 9.748 1.00 29.48 ? 105 LEU B CD1 1 ATOM 709 C CD2 . LEU A 1 92 ? 0.296 33.143 8.667 1.00 28.71 ? 105 LEU B CD2 1 ATOM 710 N N . LEU A 1 93 ? -2.338 36.686 11.203 1.00 28.30 ? 106 LEU B N 1 ATOM 711 C CA . LEU A 1 93 ? -1.897 37.379 12.414 1.00 29.47 ? 106 LEU B CA 1 ATOM 712 C C . LEU A 1 93 ? -1.250 36.376 13.357 1.00 28.79 ? 106 LEU B C 1 ATOM 713 O O . LEU A 1 93 ? -1.847 35.366 13.667 1.00 30.98 ? 106 LEU B O 1 ATOM 714 C CB . LEU A 1 93 ? -3.085 38.005 13.151 1.00 29.99 ? 106 LEU B CB 1 ATOM 715 C CG . LEU A 1 93 ? -3.639 39.292 12.562 1.00 30.44 ? 106 LEU B CG 1 ATOM 716 C CD1 . LEU A 1 93 ? -4.396 39.010 11.277 1.00 30.68 ? 106 LEU B CD1 1 ATOM 717 C CD2 . LEU A 1 93 ? -4.539 39.985 13.567 1.00 31.34 ? 106 LEU B CD2 1 ATOM 718 N N . ARG A 1 94 ? -0.077 36.728 13.869 1.00 28.23 ? 107 ARG B N 1 ATOM 719 C CA . ARG A 1 94 ? 0.524 36.034 14.994 1.00 28.43 ? 107 ARG B CA 1 ATOM 720 C C . ARG A 1 94 ? 0.141 36.798 16.263 1.00 26.03 ? 107 ARG B C 1 ATOM 721 O O . ARG A 1 94 ? 0.448 37.955 16.383 1.00 24.05 ? 107 ARG B O 1 ATOM 722 C CB . ARG A 1 94 ? 2.045 35.957 14.809 1.00 28.98 ? 107 ARG B CB 1 ATOM 723 C CG . ARG A 1 94 ? 2.799 35.303 15.957 1.00 28.52 ? 107 ARG B CG 1 ATOM 724 C CD . ARG A 1 94 ? 2.354 33.882 16.159 1.00 29.57 ? 107 ARG B CD 1 ATOM 725 N NE . ARG A 1 94 ? 3.294 33.088 16.924 1.00 28.00 ? 107 ARG B NE 1 ATOM 726 C CZ . ARG A 1 94 ? 3.449 33.182 18.227 1.00 26.57 ? 107 ARG B CZ 1 ATOM 727 N NH1 . ARG A 1 94 ? 4.233 32.317 18.838 1.00 25.60 ? 107 ARG B NH1 1 ATOM 728 N NH2 . ARG A 1 94 ? 2.838 34.135 18.910 1.00 26.68 ? 107 ARG B NH2 1 ATOM 729 N N . LEU A 1 95 ? -0.543 36.125 17.185 1.00 26.56 ? 108 LEU B N 1 ATOM 730 C CA . LEU A 1 95 ? -0.932 36.719 18.456 1.00 29.64 ? 108 LEU B CA 1 ATOM 731 C C . LEU A 1 95 ? 0.269 36.779 19.415 1.00 29.10 ? 108 LEU B C 1 ATOM 732 O O . LEU A 1 95 ? 1.257 36.078 19.218 1.00 32.78 ? 108 LEU B O 1 ATOM 733 C CB . LEU A 1 95 ? -2.063 35.887 19.070 1.00 31.97 ? 108 LEU B CB 1 ATOM 734 C CG . LEU A 1 95 ? -3.326 35.744 18.224 1.00 33.31 ? 108 LEU B CG 1 ATOM 735 C CD1 . LEU A 1 95 ? -4.212 34.623 18.746 1.00 34.29 ? 108 LEU B CD1 1 ATOM 736 C CD2 . LEU A 1 95 ? -4.103 37.046 18.177 1.00 34.51 ? 108 LEU B CD2 1 ATOM 737 N N . GLN A 1 96 ? 0.136 37.600 20.466 1.00 27.21 ? 109 GLN B N 1 ATOM 738 C CA . GLN A 1 96 ? 1.149 37.805 21.501 1.00 28.11 ? 109 GLN B CA 1 ATOM 739 C C . GLN A 1 96 ? 0.870 36.907 22.711 1.00 26.95 ? 109 GLN B C 1 ATOM 740 O O . GLN A 1 96 ? -0.164 37.039 23.330 1.00 26.54 ? 109 GLN B O 1 ATOM 741 C CB . GLN A 1 96 ? 1.103 39.261 21.979 1.00 31.29 ? 109 GLN B CB 1 ATOM 742 C CG . GLN A 1 96 ? 2.126 39.622 23.057 1.00 31.28 ? 109 GLN B CG 1 ATOM 743 C CD . GLN A 1 96 ? 3.512 39.462 22.497 1.00 31.27 ? 109 GLN B CD 1 ATOM 744 O OE1 . GLN A 1 96 ? 3.899 40.156 21.559 1.00 36.77 ? 109 GLN B OE1 1 ATOM 745 N NE2 . GLN A 1 96 ? 4.236 38.493 23.020 1.00 29.94 ? 109 GLN B NE2 1 ATOM 746 N N . GLU A 1 97 A 1.828 36.044 23.064 1.00 26.50 ? 109 GLU B N 1 ATOM 747 C CA . GLU A 1 97 A 1.787 35.231 24.286 1.00 26.04 ? 109 GLU B CA 1 ATOM 748 C C . GLU A 1 97 A 1.648 36.150 25.506 1.00 26.14 ? 109 GLU B C 1 ATOM 749 O O . GLU A 1 97 A 2.312 37.160 25.559 1.00 26.57 ? 109 GLU B O 1 ATOM 750 C CB . GLU A 1 97 A 3.096 34.456 24.453 1.00 27.73 ? 109 GLU B CB 1 ATOM 751 C CG . GLU A 1 97 A 3.322 33.308 23.471 1.00 28.16 ? 109 GLU B CG 1 ATOM 752 C CD . GLU A 1 97 A 3.794 33.657 22.063 1.00 28.48 ? 109 GLU B CD 1 ATOM 753 O OE1 . GLU A 1 97 A 3.889 34.864 21.710 1.00 30.58 ? 109 GLU B OE1 1 ATOM 754 O OE2 . GLU A 1 97 A 4.042 32.717 21.309 1.00 26.24 ? 109 GLU B OE2 1 ATOM 755 N N . ASP A 1 98 B 0.815 35.783 26.490 1.00 27.40 ? 109 ASP B N 1 ATOM 756 C CA . ASP A 1 98 B 0.770 36.495 27.787 1.00 28.68 ? 109 ASP B CA 1 ATOM 757 C C . ASP A 1 98 B 2.090 36.219 28.526 1.00 30.03 ? 109 ASP B C 1 ATOM 758 O O . ASP A 1 98 B 2.970 35.553 27.962 1.00 32.26 ? 109 ASP B O 1 ATOM 759 C CB . ASP A 1 98 B -0.437 36.077 28.634 1.00 30.25 ? 109 ASP B CB 1 ATOM 760 C CG . ASP A 1 98 B -0.529 34.596 28.984 1.00 31.87 ? 109 ASP B CG 1 ATOM 761 O OD1 . ASP A 1 98 B 0.512 34.002 29.289 1.00 32.20 ? 109 ASP B OD1 1 ATOM 762 O OD2 . ASP A 1 98 B -1.659 34.049 28.967 1.00 33.63 ? 109 ASP B OD2 1 ATOM 763 N N . ALA A 1 99 C 2.238 36.746 29.752 1.00 29.30 ? 109 ALA B N 1 ATOM 764 C CA . ALA A 1 99 C 3.497 36.727 30.502 1.00 28.22 ? 109 ALA B CA 1 ATOM 765 C C . ALA A 1 99 C 3.921 35.337 30.975 1.00 29.90 ? 109 ALA B C 1 ATOM 766 O O . ALA A 1 99 C 5.096 35.116 31.201 1.00 34.03 ? 109 ALA B O 1 ATOM 767 C CB . ALA A 1 99 C 3.376 37.666 31.668 1.00 28.57 ? 109 ALA B CB 1 ATOM 768 N N . ASP A 1 100 D 2.954 34.437 31.180 1.00 32.29 ? 109 ASP B N 1 ATOM 769 C CA . ASP A 1 100 D 3.176 32.983 31.085 1.00 34.89 ? 109 ASP B CA 1 ATOM 770 C C . ASP A 1 100 D 3.362 32.752 29.588 1.00 37.83 ? 109 ASP B C 1 ATOM 771 O O . ASP A 1 100 D 3.274 33.686 28.807 1.00 51.64 ? 109 ASP B O 1 ATOM 772 C CB . ASP A 1 100 D 2.026 32.228 31.748 1.00 35.42 ? 109 ASP B CB 1 ATOM 773 C CG . ASP A 1 100 D 1.689 32.812 33.118 1.00 40.70 ? 109 ASP B CG 1 ATOM 774 O OD1 . ASP A 1 100 D 2.607 32.873 33.985 1.00 44.60 ? 109 ASP B OD1 1 ATOM 775 O OD2 . ASP A 1 100 D 0.535 33.268 33.303 1.00 40.86 ? 109 ASP B OD2 1 ATOM 776 N N . GLY A 1 101 E 3.623 31.559 29.113 1.00 34.84 ? 109 GLY B N 1 ATOM 777 C CA . GLY A 1 101 E 3.990 31.570 27.673 1.00 37.11 ? 109 GLY B CA 1 ATOM 778 C C . GLY A 1 101 E 2.837 31.340 26.699 1.00 35.57 ? 109 GLY B C 1 ATOM 779 O O . GLY A 1 101 E 3.080 30.869 25.585 1.00 34.98 ? 109 GLY B O 1 ATOM 780 N N . SER A 1 102 ? 1.592 31.648 27.082 1.00 35.45 ? 110 SER B N 1 ATOM 781 C CA . SER A 1 102 ? 0.410 31.136 26.329 1.00 36.73 ? 110 SER B CA 1 ATOM 782 C C . SER A 1 102 ? -0.293 32.243 25.519 1.00 34.77 ? 110 SER B C 1 ATOM 783 O O . SER A 1 102 ? -0.388 33.386 25.963 1.00 31.79 ? 110 SER B O 1 ATOM 784 C CB . SER A 1 102 ? -0.547 30.434 27.245 1.00 35.95 ? 110 SER B CB 1 ATOM 785 O OG . SER A 1 102 ? -0.619 31.105 28.489 1.00 39.90 ? 110 SER B OG 1 ATOM 786 N N . CYS A 1 103 ? -0.834 31.809 24.383 1.00 34.09 ? 111 CYS B N 1 ATOM 787 C CA . CYS A 1 103 ? -1.684 32.610 23.475 1.00 34.57 ? 111 CYS B CA 1 ATOM 788 C C . CYS A 1 103 ? -3.034 32.015 23.880 1.00 34.45 ? 111 CYS B C 1 ATOM 789 O O . CYS A 1 103 ? -3.136 31.515 25.005 1.00 33.57 ? 111 CYS B O 1 ATOM 790 C CB . CYS A 1 103 ? -1.525 32.179 22.022 1.00 34.95 ? 111 CYS B CB 1 ATOM 791 S SG . CYS A 1 103 ? 0.041 32.619 21.231 1.00 36.01 ? 111 CYS B SG 1 ATOM 792 N N . ALA A 1 104 ? -4.025 32.056 22.998 1.00 32.75 ? 112 ALA B N 1 ATOM 793 C CA . ALA A 1 104 ? -5.336 31.478 23.348 1.00 34.43 ? 112 ALA B CA 1 ATOM 794 C C . ALA A 1 104 ? -5.332 30.266 24.283 1.00 35.83 ? 112 ALA B C 1 ATOM 795 O O . ALA A 1 104 ? -4.658 29.280 23.977 1.00 39.25 ? 112 ALA B O 1 ATOM 796 C CB . ALA A 1 104 ? -6.114 31.184 22.098 1.00 34.99 ? 112 ALA B CB 1 ATOM 797 N N . LEU A 1 105 ? -6.068 30.363 25.389 1.00 35.10 ? 113 LEU B N 1 ATOM 798 C CA . LEU A 1 105 ? -6.279 29.268 26.311 1.00 35.98 ? 113 LEU B CA 1 ATOM 799 C C . LEU A 1 105 ? -7.549 28.539 25.881 1.00 36.01 ? 113 LEU B C 1 ATOM 800 O O . LEU A 1 105 ? -8.605 29.138 25.864 1.00 36.90 ? 113 LEU B O 1 ATOM 801 C CB . LEU A 1 105 ? -6.414 29.836 27.721 1.00 36.97 ? 113 LEU B CB 1 ATOM 802 C CG . LEU A 1 105 ? -5.255 30.724 28.170 1.00 36.98 ? 113 LEU B CG 1 ATOM 803 C CD1 . LEU A 1 105 ? -5.619 31.483 29.445 1.00 35.17 ? 113 LEU B CD1 1 ATOM 804 C CD2 . LEU A 1 105 ? -4.000 29.884 28.352 1.00 36.28 ? 113 LEU B CD2 1 ATOM 805 N N . LEU A 1 106 ? -7.424 27.270 25.488 1.00 36.87 ? 114 LEU B N 1 ATOM 806 C CA . LEU A 1 106 ? -8.556 26.537 24.972 1.00 36.71 ? 114 LEU B CA 1 ATOM 807 C C . LEU A 1 106 ? -9.596 26.382 26.078 1.00 36.82 ? 114 LEU B C 1 ATOM 808 O O . LEU A 1 106 ? -9.262 26.232 27.243 1.00 37.34 ? 114 LEU B O 1 ATOM 809 C CB . LEU A 1 106 ? -8.124 25.168 24.455 1.00 38.74 ? 114 LEU B CB 1 ATOM 810 C CG . LEU A 1 106 ? -7.120 25.181 23.310 1.00 42.08 ? 114 LEU B CG 1 ATOM 811 C CD1 . LEU A 1 106 ? -7.032 23.800 22.692 1.00 46.57 ? 114 LEU B CD1 1 ATOM 812 C CD2 . LEU A 1 106 ? -7.479 26.216 22.255 1.00 43.43 ? 114 LEU B CD2 1 ATOM 813 N N . SER A 1 107 ? -10.857 26.455 25.659 1.00 36.94 ? 115 SER B N 1 ATOM 814 C CA . SER A 1 107 ? -12.003 26.391 26.503 1.00 37.16 ? 115 SER B CA 1 ATOM 815 C C . SER A 1 107 ? -13.155 25.880 25.642 1.00 39.62 ? 115 SER B C 1 ATOM 816 O O . SER A 1 107 ? -12.992 25.708 24.435 1.00 34.42 ? 115 SER B O 1 ATOM 817 C CB . SER A 1 107 ? -12.284 27.738 27.121 1.00 37.21 ? 115 SER B CB 1 ATOM 818 O OG . SER A 1 107 ? -12.916 28.615 26.189 1.00 38.93 ? 115 SER B OG 1 ATOM 819 N N . PRO A 1 108 ? -14.349 25.608 26.218 1.00 43.29 ? 116 PRO B N 1 ATOM 820 C CA . PRO A 1 108 ? -15.505 25.276 25.386 1.00 42.69 ? 116 PRO B CA 1 ATOM 821 C C . PRO A 1 108 ? -15.973 26.453 24.503 1.00 41.66 ? 116 PRO B C 1 ATOM 822 O O . PRO A 1 108 ? -16.788 26.238 23.599 1.00 40.77 ? 116 PRO B O 1 ATOM 823 C CB . PRO A 1 108 ? -16.551 24.830 26.428 1.00 45.04 ? 116 PRO B CB 1 ATOM 824 C CG . PRO A 1 108 ? -16.150 25.520 27.725 1.00 43.13 ? 116 PRO B CG 1 ATOM 825 C CD . PRO A 1 108 ? -14.643 25.587 27.667 1.00 42.92 ? 116 PRO B CD 1 ATOM 826 N N . TYR A 1 109 ? -15.452 27.670 24.755 1.00 43.27 ? 117 TYR B N 1 ATOM 827 C CA . TYR A 1 109 ? -15.824 28.906 24.017 1.00 43.08 ? 117 TYR B CA 1 ATOM 828 C C . TYR A 1 109 ? -14.723 29.370 23.053 1.00 39.82 ? 117 TYR B C 1 ATOM 829 O O . TYR A 1 109 ? -14.974 30.227 22.217 1.00 38.36 ? 117 TYR B O 1 ATOM 830 C CB . TYR A 1 109 ? -16.153 30.031 24.999 1.00 44.23 ? 117 TYR B CB 1 ATOM 831 C CG . TYR A 1 109 ? -17.203 29.653 26.009 1.00 50.41 ? 117 TYR B CG 1 ATOM 832 C CD1 . TYR A 1 109 ? -18.548 29.635 25.671 1.00 50.75 ? 117 TYR B CD1 1 ATOM 833 C CD2 . TYR A 1 109 ? -16.850 29.259 27.291 1.00 55.57 ? 117 TYR B CD2 1 ATOM 834 C CE1 . TYR A 1 109 ? -19.515 29.248 26.586 1.00 52.01 ? 117 TYR B CE1 1 ATOM 835 C CE2 . TYR A 1 109 ? -17.807 28.882 28.220 1.00 54.90 ? 117 TYR B CE2 1 ATOM 836 C CZ . TYR A 1 109 ? -19.143 28.877 27.864 1.00 52.42 ? 117 TYR B CZ 1 ATOM 837 O OH . TYR A 1 109 ? -20.082 28.511 28.778 1.00 54.78 ? 117 TYR B OH 1 ATOM 838 N N . VAL A 1 110 ? -13.518 28.804 23.168 1.00 36.89 ? 118 VAL B N 1 ATOM 839 C CA . VAL A 1 110 ? -12.368 29.268 22.422 1.00 35.58 ? 118 VAL B CA 1 ATOM 840 C C . VAL A 1 110 ? -11.613 28.050 21.891 1.00 33.32 ? 118 VAL B C 1 ATOM 841 O O . VAL A 1 110 ? -10.995 27.321 22.636 1.00 34.71 ? 118 VAL B O 1 ATOM 842 C CB . VAL A 1 110 ? -11.469 30.159 23.302 1.00 36.45 ? 118 VAL B CB 1 ATOM 843 C CG1 . VAL A 1 110 ? -10.122 30.452 22.646 1.00 34.92 ? 118 VAL B CG1 1 ATOM 844 C CG2 . VAL A 1 110 ? -12.184 31.448 23.694 1.00 35.72 ? 118 VAL B CG2 1 ATOM 845 N N . GLN A 1 111 ? -11.644 27.868 20.579 1.00 32.59 ? 119 GLN B N 1 ATOM 846 C CA . GLN A 1 111 ? -11.213 26.633 19.972 1.00 35.22 ? 119 GLN B CA 1 ATOM 847 C C . GLN A 1 111 ? -10.769 26.958 18.555 1.00 32.94 ? 119 GLN B C 1 ATOM 848 O O . GLN A 1 111 ? -11.482 27.642 17.832 1.00 33.28 ? 119 GLN B O 1 ATOM 849 C CB . GLN A 1 111 ? -12.372 25.624 19.991 1.00 40.44 ? 119 GLN B CB 1 ATOM 850 C CG . GLN A 1 111 ? -11.960 24.166 20.149 1.00 45.25 ? 119 GLN B CG 1 ATOM 851 C CD . GLN A 1 111 ? -11.404 23.847 21.519 1.00 46.07 ? 119 GLN B CD 1 ATOM 852 O OE1 . GLN A 1 111 ? -11.892 24.336 22.537 1.00 44.36 ? 119 GLN B OE1 1 ATOM 853 N NE2 . GLN A 1 111 ? -10.371 23.013 21.550 1.00 46.05 ? 119 GLN B NE2 1 ATOM 854 N N . PRO A 1 112 ? -9.586 26.500 18.104 1.00 33.88 ? 120 PRO B N 1 ATOM 855 C CA . PRO A 1 112 ? -9.161 26.743 16.731 1.00 33.99 ? 120 PRO B CA 1 ATOM 856 C C . PRO A 1 112 ? -10.036 25.902 15.795 1.00 34.77 ? 120 PRO B C 1 ATOM 857 O O . PRO A 1 112 ? -10.770 25.049 16.264 1.00 37.44 ? 120 PRO B O 1 ATOM 858 C CB . PRO A 1 112 ? -7.687 26.311 16.681 1.00 33.91 ? 120 PRO B CB 1 ATOM 859 C CG . PRO A 1 112 ? -7.308 26.020 18.127 1.00 34.97 ? 120 PRO B CG 1 ATOM 860 C CD . PRO A 1 112 ? -8.598 25.725 18.864 1.00 34.70 ? 120 PRO B CD 1 ATOM 861 N N . VAL A 1 113 ? -9.961 26.173 14.493 1.00 34.17 ? 121 VAL B N 1 ATOM 862 C CA . VAL A 1 113 ? -10.607 25.354 13.499 1.00 35.13 ? 121 VAL B CA 1 ATOM 863 C C . VAL A 1 113 ? -9.537 24.918 12.497 1.00 37.66 ? 121 VAL B C 1 ATOM 864 O O . VAL A 1 113 ? -8.803 25.755 11.977 1.00 37.51 ? 121 VAL B O 1 ATOM 865 C CB . VAL A 1 113 ? -11.775 26.097 12.827 1.00 33.73 ? 121 VAL B CB 1 ATOM 866 C CG1 . VAL A 1 113 ? -11.344 27.440 12.255 1.00 34.54 ? 121 VAL B CG1 1 ATOM 867 C CG2 . VAL A 1 113 ? -12.449 25.239 11.761 1.00 32.68 ? 121 VAL B CG2 1 ATOM 868 N N . CYS A 1 114 ? -9.458 23.606 12.256 1.00 41.54 ? 122 CYS B N 1 ATOM 869 C CA . CYS A 1 114 ? -8.489 23.024 11.343 1.00 46.79 ? 122 CYS B CA 1 ATOM 870 C C . CYS A 1 114 ? -8.564 23.711 9.977 1.00 42.58 ? 122 CYS B C 1 ATOM 871 O O . CYS A 1 114 ? -9.624 24.152 9.529 1.00 38.76 ? 122 CYS B O 1 ATOM 872 C CB . CYS A 1 114 ? -8.732 21.535 11.113 1.00 57.35 ? 122 CYS B CB 1 ATOM 873 S SG . CYS A 1 114 ? -8.671 20.508 12.605 1.00 68.02 ? 122 CYS B SG 1 ATOM 874 N N . LEU A 1 115 ? -7.414 23.769 9.313 1.00 40.63 ? 123 LEU B N 1 ATOM 875 C CA . LEU A 1 115 ? -7.358 24.140 7.934 1.00 41.37 ? 123 LEU B CA 1 ATOM 876 C C . LEU A 1 115 ? -7.855 22.964 7.111 1.00 41.16 ? 123 LEU B C 1 ATOM 877 O O . LEU A 1 115 ? -7.898 21.839 7.593 1.00 40.77 ? 123 LEU B O 1 ATOM 878 C CB . LEU A 1 115 ? -5.912 24.492 7.574 1.00 43.44 ? 123 LEU B CB 1 ATOM 879 C CG . LEU A 1 115 ? -5.364 25.745 8.252 1.00 45.76 ? 123 LEU B CG 1 ATOM 880 C CD1 . LEU A 1 115 ? -3.904 25.965 7.885 1.00 47.47 ? 123 LEU B CD1 1 ATOM 881 C CD2 . LEU A 1 115 ? -6.198 26.975 7.897 1.00 44.99 ? 123 LEU B CD2 1 ATOM 882 N N . PRO A 1 116 ? -8.240 23.179 5.841 1.00 45.20 ? 124 PRO B N 1 ATOM 883 C CA . PRO A 1 116 ? -8.582 22.063 4.961 1.00 51.24 ? 124 PRO B CA 1 ATOM 884 C C . PRO A 1 116 ? -7.292 21.374 4.493 1.00 55.85 ? 124 PRO B C 1 ATOM 885 O O . PRO A 1 116 ? -6.211 21.741 4.966 1.00 56.92 ? 124 PRO B O 1 ATOM 886 C CB . PRO A 1 116 ? -9.357 22.758 3.832 1.00 51.79 ? 124 PRO B CB 1 ATOM 887 C CG . PRO A 1 116 ? -8.783 24.167 3.778 1.00 46.76 ? 124 PRO B CG 1 ATOM 888 C CD . PRO A 1 116 ? -8.363 24.493 5.195 1.00 44.55 ? 124 PRO B CD 1 ATOM 889 N N . SER A 1 117 ? -7.408 20.377 3.603 1.00 61.96 ? 125 SER B N 1 ATOM 890 C CA . SER A 1 117 ? -6.238 19.864 2.853 1.00 64.03 ? 125 SER B CA 1 ATOM 891 C C . SER A 1 117 ? -6.465 19.959 1.333 1.00 62.51 ? 125 SER B C 1 ATOM 892 O O . SER A 1 117 ? -5.546 19.735 0.556 1.00 57.07 ? 125 SER B O 1 ATOM 893 C CB . SER A 1 117 ? -5.890 18.469 3.277 1.00 65.68 ? 125 SER B CB 1 ATOM 894 O OG . SER A 1 117 ? -6.626 17.525 2.517 1.00 75.17 ? 125 SER B OG 1 ATOM 895 N N . GLY A 1 118 ? -7.684 20.318 0.918 1.00 68.22 ? 126 GLY B N 1 ATOM 896 C CA . GLY A 1 118 ? -8.013 20.523 -0.483 1.00 76.54 ? 126 GLY B CA 1 ATOM 897 C C . GLY A 1 118 ? -7.724 19.288 -1.324 1.00 82.21 ? 126 GLY B C 1 ATOM 898 O O . GLY A 1 118 ? -6.927 19.349 -2.260 1.00 81.82 ? 126 GLY B O 1 ATOM 899 N N . ALA A 1 119 ? -8.385 18.175 -0.980 1.00 83.91 ? 127 ALA B N 1 ATOM 900 C CA . ALA A 1 119 ? -8.221 16.883 -1.651 1.00 84.11 ? 127 ALA B CA 1 ATOM 901 C C . ALA A 1 119 ? -9.573 16.162 -1.696 1.00 80.18 ? 127 ALA B C 1 ATOM 902 O O . ALA A 1 119 ? -10.462 16.461 -0.900 1.00 76.82 ? 127 ALA B O 1 ATOM 903 C CB . ALA A 1 119 ? -7.171 16.058 -0.937 1.00 82.66 ? 127 ALA B CB 1 ATOM 904 N N . PRO A 1 122 ? -13.210 20.594 -2.982 1.00 104.35 ? 130 PRO B N 1 ATOM 905 C CA . PRO A 1 122 ? -13.307 19.186 -2.577 1.00 102.74 ? 130 PRO B CA 1 ATOM 906 C C . PRO A 1 122 ? -14.418 18.939 -1.543 1.00 99.24 ? 130 PRO B C 1 ATOM 907 O O . PRO A 1 122 ? -14.256 18.103 -0.654 1.00 89.94 ? 130 PRO B O 1 ATOM 908 C CB . PRO A 1 122 ? -11.932 18.871 -1.968 1.00 102.26 ? 130 PRO B CB 1 ATOM 909 C CG . PRO A 1 122 ? -10.996 19.841 -2.647 1.00 103.16 ? 130 PRO B CG 1 ATOM 910 C CD . PRO A 1 122 ? -11.827 21.080 -2.901 1.00 101.11 ? 130 PRO B CD 1 ATOM 911 N N . SER A 1 123 ? -15.533 19.670 -1.675 1.00 101.43 ? 131 SER B N 1 ATOM 912 C CA . SER A 1 123 ? -16.619 19.665 -0.688 1.00 104.33 ? 131 SER B CA 1 ATOM 913 C C . SER A 1 123 ? -17.917 20.200 -1.313 1.00 103.57 ? 131 SER B C 1 ATOM 914 O O . SER A 1 123 ? -18.493 21.153 -0.811 1.00 109.62 ? 131 SER B O 1 ATOM 915 C CB . SER A 1 123 ? -16.237 20.471 0.537 1.00 104.53 ? 131 SER B CB 1 ATOM 916 O OG . SER A 1 123 ? -15.113 19.911 1.197 1.00 103.85 ? 131 SER B OG 1 ATOM 917 N N . GLU A 1 124 ? -18.375 19.564 -2.398 1.00 105.27 ? 132 GLU B N 1 ATOM 918 C CA . GLU A 1 124 ? -19.596 19.965 -3.126 1.00 106.91 ? 132 GLU B CA 1 ATOM 919 C C . GLU A 1 124 ? -20.847 19.602 -2.302 1.00 108.24 ? 132 GLU B C 1 ATOM 920 O O . GLU A 1 124 ? -21.199 18.426 -2.198 1.00 107.93 ? 132 GLU B O 1 ATOM 921 C CB . GLU A 1 124 ? -19.621 19.289 -4.505 1.00 105.93 ? 132 GLU B CB 1 ATOM 922 C CG . GLU A 1 124 ? -20.808 19.679 -5.377 1.00 104.52 ? 132 GLU B CG 1 ATOM 923 C CD . GLU A 1 124 ? -20.781 21.109 -5.896 1.00 105.52 ? 132 GLU B CD 1 ATOM 924 O OE1 . GLU A 1 124 ? -19.716 21.523 -6.407 1.00 106.35 ? 132 GLU B OE1 1 ATOM 925 O OE2 . GLU A 1 124 ? -21.821 21.809 -5.786 1.00 89.09 ? 132 GLU B OE2 1 ATOM 926 N N . THR A 1 125 ? -21.505 20.624 -1.728 1.00 106.18 ? 133 THR B N 1 ATOM 927 C CA . THR A 1 125 ? -22.852 20.534 -1.077 1.00 104.91 ? 133 THR B CA 1 ATOM 928 C C . THR A 1 125 ? -22.790 19.744 0.242 1.00 104.66 ? 133 THR B C 1 ATOM 929 O O . THR A 1 125 ? -23.605 18.842 0.477 1.00 97.36 ? 133 THR B O 1 ATOM 930 C CB . THR A 1 125 ? -23.910 19.971 -2.037 1.00 93.85 ? 133 THR B CB 1 ATOM 931 O OG1 . THR A 1 125 ? -23.760 20.711 -3.248 1.00 90.83 ? 133 THR B OG1 1 ATOM 932 C CG2 . THR A 1 125 ? -25.329 20.101 -1.525 1.00 86.58 ? 133 THR B CG2 1 ATOM 933 N N . THR A 1 126 ? -21.840 20.119 1.110 1.00 101.16 ? 134 THR B N 1 ATOM 934 C CA . THR A 1 126 ? -21.809 19.694 2.515 1.00 99.46 ? 134 THR B CA 1 ATOM 935 C C . THR A 1 126 ? -22.607 20.708 3.346 1.00 91.74 ? 134 THR B C 1 ATOM 936 O O . THR A 1 126 ? -23.083 21.722 2.820 1.00 91.32 ? 134 THR B O 1 ATOM 937 C CB . THR A 1 126 ? -20.370 19.589 3.045 1.00 102.72 ? 134 THR B CB 1 ATOM 938 O OG1 . THR A 1 126 ? -19.515 19.163 1.983 1.00 105.06 ? 134 THR B OG1 1 ATOM 939 C CG2 . THR A 1 126 ? -20.225 18.636 4.212 1.00 99.04 ? 134 THR B CG2 1 ATOM 940 N N . LEU A 1 127 ? -22.749 20.419 4.643 1.00 80.40 ? 135 LEU B N 1 ATOM 941 C CA . LEU A 1 127 ? -23.228 21.390 5.635 1.00 71.32 ? 135 LEU B CA 1 ATOM 942 C C . LEU A 1 127 ? -22.140 22.451 5.869 1.00 62.70 ? 135 LEU B C 1 ATOM 943 O O . LEU A 1 127 ? -21.132 22.147 6.509 1.00 55.45 ? 135 LEU B O 1 ATOM 944 C CB . LEU A 1 127 ? -23.543 20.641 6.935 1.00 69.87 ? 135 LEU B CB 1 ATOM 945 C CG . LEU A 1 127 ? -24.780 21.112 7.692 1.00 63.91 ? 135 LEU B CG 1 ATOM 946 C CD1 . LEU A 1 127 ? -26.032 20.553 7.037 1.00 61.62 ? 135 LEU B CD1 1 ATOM 947 C CD2 . LEU A 1 127 ? -24.710 20.710 9.162 1.00 62.79 ? 135 LEU B CD2 1 ATOM 948 N N . CYS A 1 128 ? -22.342 23.673 5.342 1.00 55.91 ? 136 CYS B N 1 ATOM 949 C CA . CYS A 1 128 ? -21.404 24.799 5.543 1.00 47.95 ? 136 CYS B CA 1 ATOM 950 C C . CYS A 1 128 ? -22.122 25.961 6.223 1.00 44.29 ? 136 CYS B C 1 ATOM 951 O O . CYS A 1 128 ? -23.160 26.404 5.769 1.00 47.63 ? 136 CYS B O 1 ATOM 952 C CB . CYS A 1 128 ? -20.796 25.308 4.242 1.00 48.16 ? 136 CYS B CB 1 ATOM 953 S SG . CYS A 1 128 ? -19.759 24.089 3.390 1.00 53.62 ? 136 CYS B SG 1 ATOM 954 N N . GLN A 1 129 ? -21.531 26.456 7.309 1.00 41.54 ? 137 GLN B N 1 ATOM 955 C CA . GLN A 1 129 ? -22.051 27.601 8.029 1.00 39.61 ? 137 GLN B CA 1 ATOM 956 C C . GLN A 1 129 ? -21.119 28.809 7.840 1.00 36.57 ? 137 GLN B C 1 ATOM 957 O O . GLN A 1 129 ? -19.907 28.664 7.764 1.00 35.40 ? 137 GLN B O 1 ATOM 958 C CB . GLN A 1 129 ? -22.190 27.242 9.508 1.00 42.34 ? 137 GLN B CB 1 ATOM 959 C CG . GLN A 1 129 ? -23.181 26.115 9.762 1.00 45.42 ? 137 GLN B CG 1 ATOM 960 C CD . GLN A 1 129 ? -22.711 25.162 10.833 1.00 48.72 ? 137 GLN B CD 1 ATOM 961 O OE1 . GLN A 1 129 ? -22.067 25.567 11.803 1.00 48.01 ? 137 GLN B OE1 1 ATOM 962 N NE2 . GLN A 1 129 ? -23.031 23.883 10.654 1.00 49.13 ? 137 GLN B NE2 1 ATOM 963 N N . VAL A 1 130 ? -21.712 30.005 7.765 1.00 33.80 ? 138 VAL B N 1 ATOM 964 C CA . VAL A 1 130 ? -21.001 31.284 7.887 1.00 33.18 ? 138 VAL B CA 1 ATOM 965 C C . VAL A 1 130 ? -21.454 31.951 9.201 1.00 30.93 ? 138 VAL B C 1 ATOM 966 O O . VAL A 1 130 ? -22.575 31.719 9.646 1.00 30.22 ? 138 VAL B O 1 ATOM 967 C CB . VAL A 1 130 ? -21.290 32.153 6.649 1.00 34.07 ? 138 VAL B CB 1 ATOM 968 C CG1 . VAL A 1 130 ? -22.671 32.779 6.716 1.00 35.81 ? 138 VAL B CG1 1 ATOM 969 C CG2 . VAL A 1 130 ? -20.246 33.222 6.423 1.00 34.27 ? 138 VAL B CG2 1 ATOM 970 N N . ALA A 1 131 ? -20.585 32.740 9.846 1.00 29.07 ? 139 ALA B N 1 ATOM 971 C CA . ALA A 1 131 ? -20.967 33.461 11.084 1.00 30.19 ? 139 ALA B CA 1 ATOM 972 C C . ALA A 1 131 ? -20.356 34.871 11.123 1.00 31.18 ? 139 ALA B C 1 ATOM 973 O O . ALA A 1 131 ? -19.295 35.127 10.540 1.00 33.90 ? 139 ALA B O 1 ATOM 974 C CB . ALA A 1 131 ? -20.569 32.656 12.289 1.00 29.28 ? 139 ALA B CB 1 ATOM 975 N N . GLY A 1 132 ? -21.035 35.802 11.801 1.00 31.06 ? 140 GLY B N 1 ATOM 976 C CA . GLY A 1 132 ? -20.542 37.188 11.859 1.00 31.94 ? 140 GLY B CA 1 ATOM 977 C C . GLY A 1 132 ? -21.456 38.144 12.612 1.00 32.15 ? 140 GLY B C 1 ATOM 978 O O . GLY A 1 132 ? -22.607 37.834 12.947 1.00 32.37 ? 140 GLY B O 1 ATOM 979 N N . TRP A 1 133 ? -20.913 39.336 12.875 1.00 30.41 ? 141 TRP B N 1 ATOM 980 C CA . TRP A 1 133 ? -21.605 40.393 13.561 1.00 27.99 ? 141 TRP B CA 1 ATOM 981 C C . TRP A 1 133 ? -21.963 41.524 12.586 1.00 26.25 ? 141 TRP B C 1 ATOM 982 O O . TRP A 1 133 ? -22.365 42.611 13.005 1.00 25.52 ? 141 TRP B O 1 ATOM 983 C CB . TRP A 1 133 ? -20.730 40.923 14.698 1.00 28.04 ? 141 TRP B CB 1 ATOM 984 C CG . TRP A 1 133 ? -20.522 40.018 15.872 1.00 27.61 ? 141 TRP B CG 1 ATOM 985 C CD1 . TRP A 1 133 ? -21.365 39.827 16.927 1.00 28.60 ? 141 TRP B CD1 1 ATOM 986 C CD2 . TRP A 1 133 ? -19.330 39.282 16.187 1.00 26.80 ? 141 TRP B CD2 1 ATOM 987 N NE1 . TRP A 1 133 ? -20.791 39.003 17.863 1.00 27.52 ? 141 TRP B NE1 1 ATOM 988 C CE2 . TRP A 1 133 ? -19.544 38.654 17.432 1.00 26.54 ? 141 TRP B CE2 1 ATOM 989 C CE3 . TRP A 1 133 ? -18.105 39.099 15.539 1.00 26.22 ? 141 TRP B CE3 1 ATOM 990 C CZ2 . TRP A 1 133 ? -18.583 37.853 18.037 1.00 27.02 ? 141 TRP B CZ2 1 ATOM 991 C CZ3 . TRP A 1 133 ? -17.156 38.304 16.137 1.00 26.56 ? 141 TRP B CZ3 1 ATOM 992 C CH2 . TRP A 1 133 ? -17.395 37.689 17.367 1.00 26.41 ? 141 TRP B CH2 1 ATOM 993 N N . GLY A 1 134 ? -21.836 41.273 11.283 1.00 25.91 ? 142 GLY B N 1 ATOM 994 C CA . GLY A 1 134 ? -22.084 42.298 10.275 1.00 26.93 ? 142 GLY B CA 1 ATOM 995 C C . GLY A 1 134 ? -23.555 42.676 10.142 1.00 28.21 ? 142 GLY B C 1 ATOM 996 O O . GLY A 1 134 ? -24.413 42.387 10.986 1.00 29.74 ? 142 GLY B O 1 ATOM 997 N N . HIS A 1 135 ? -23.851 43.340 9.031 1.00 30.34 ? 143 HIS B N 1 ATOM 998 C CA . HIS A 1 135 ? -25.176 43.823 8.739 1.00 31.16 ? 143 HIS B CA 1 ATOM 999 C C . HIS A 1 135 ? -26.136 42.640 8.591 1.00 32.24 ? 143 HIS B C 1 ATOM 1000 O O . HIS A 1 135 ? -25.796 41.653 7.947 1.00 31.99 ? 143 HIS B O 1 ATOM 1001 C CB . HIS A 1 135 ? -25.167 44.669 7.459 1.00 30.87 ? 143 HIS B CB 1 ATOM 1002 C CG . HIS A 1 135 ? -24.577 46.024 7.643 1.00 30.80 ? 143 HIS B CG 1 ATOM 1003 N ND1 . HIS A 1 135 ? -23.964 46.707 6.607 1.00 29.51 ? 143 HIS B ND1 1 ATOM 1004 C CD2 . HIS A 1 135 ? -24.489 46.810 8.738 1.00 31.27 ? 143 HIS B CD2 1 ATOM 1005 C CE1 . HIS A 1 135 ? -23.529 47.863 7.054 1.00 30.34 ? 143 HIS B CE1 1 ATOM 1006 N NE2 . HIS A 1 135 ? -23.841 47.952 8.360 1.00 32.00 ? 143 HIS B NE2 1 ATOM 1007 N N . GLN A 1 136 ? -27.344 42.802 9.149 1.00 34.23 ? 144 GLN B N 1 ATOM 1008 C CA . GLN A 1 136 ? -28.404 41.809 9.100 1.00 34.60 ? 144 GLN B CA 1 ATOM 1009 C C . GLN A 1 136 ? -29.212 41.951 7.809 1.00 37.10 ? 144 GLN B C 1 ATOM 1010 O O . GLN A 1 136 ? -30.017 41.074 7.529 1.00 40.23 ? 144 GLN B O 1 ATOM 1011 C CB . GLN A 1 136 ? -29.293 41.919 10.338 1.00 34.62 ? 144 GLN B CB 1 ATOM 1012 C CG . GLN A 1 136 ? -28.760 41.105 11.509 1.00 34.82 ? 144 GLN B CG 1 ATOM 1013 C CD . GLN A 1 136 ? -29.041 41.727 12.851 1.00 35.44 ? 144 GLN B CD 1 ATOM 1014 O OE1 . GLN A 1 136 ? -28.802 42.911 13.073 1.00 40.12 ? 144 GLN B OE1 1 ATOM 1015 N NE2 . GLN A 1 136 ? -29.503 40.913 13.780 1.00 33.80 ? 144 GLN B NE2 1 ATOM 1016 N N . PHE A 1 137 ? -28.986 43.039 7.052 1.00 39.65 ? 145 PHE B N 1 ATOM 1017 C CA . PHE A 1 137 ? -29.574 43.299 5.707 1.00 40.23 ? 145 PHE B CA 1 ATOM 1018 C C . PHE A 1 137 ? -28.764 44.416 5.028 1.00 40.61 ? 145 PHE B C 1 ATOM 1019 O O . PHE A 1 137 ? -28.294 45.337 5.705 1.00 36.47 ? 145 PHE B O 1 ATOM 1020 C CB . PHE A 1 137 ? -31.063 43.665 5.802 1.00 39.80 ? 145 PHE B CB 1 ATOM 1021 C CG . PHE A 1 137 ? -31.375 44.873 6.654 1.00 40.75 ? 145 PHE B CG 1 ATOM 1022 C CD1 . PHE A 1 137 ? -31.590 44.747 8.025 1.00 42.30 ? 145 PHE B CD1 1 ATOM 1023 C CD2 . PHE A 1 137 ? -31.452 46.143 6.094 1.00 41.56 ? 145 PHE B CD2 1 ATOM 1024 C CE1 . PHE A 1 137 ? -31.861 45.862 8.814 1.00 42.25 ? 145 PHE B CE1 1 ATOM 1025 C CE2 . PHE A 1 137 ? -31.719 47.258 6.882 1.00 41.68 ? 145 PHE B CE2 1 ATOM 1026 C CZ . PHE A 1 137 ? -31.926 47.116 8.241 1.00 42.70 ? 145 PHE B CZ 1 ATOM 1027 N N . GLU A 1 138 ? -28.608 44.346 3.698 1.00 42.82 ? 146 GLU B N 1 ATOM 1028 C CA . GLU A 1 138 ? -27.784 45.333 2.965 1.00 47.65 ? 146 GLU B CA 1 ATOM 1029 C C . GLU A 1 138 ? -28.204 46.764 3.318 1.00 45.67 ? 146 GLU B C 1 ATOM 1030 O O . GLU A 1 138 ? -29.379 47.119 3.253 1.00 43.47 ? 146 GLU B O 1 ATOM 1031 C CB . GLU A 1 138 ? -27.884 45.195 1.446 1.00 51.76 ? 146 GLU B CB 1 ATOM 1032 C CG . GLU A 1 138 ? -27.272 46.378 0.708 1.00 53.49 ? 146 GLU B CG 1 ATOM 1033 C CD . GLU A 1 138 ? -27.281 46.272 -0.805 1.00 61.40 ? 146 GLU B CD 1 ATOM 1034 O OE1 . GLU A 1 138 ? -26.608 47.105 -1.445 1.00 69.67 ? 146 GLU B OE1 1 ATOM 1035 O OE2 . GLU A 1 138 ? -27.959 45.361 -1.344 1.00 68.55 ? 146 GLU B OE2 1 ATOM 1036 N N . GLY A 1 139 ? -27.209 47.587 3.648 1.00 44.91 ? 147 GLY B N 1 ATOM 1037 C CA . GLY A 1 139 ? -27.433 48.986 3.967 1.00 45.69 ? 147 GLY B CA 1 ATOM 1038 C C . GLY A 1 139 ? -28.243 49.174 5.240 1.00 43.15 ? 147 GLY B C 1 ATOM 1039 O O . GLY A 1 139 ? -28.952 50.141 5.362 1.00 39.22 ? 147 GLY B O 1 ATOM 1040 N N . ALA A 1 140 ? -28.137 48.232 6.186 1.00 45.71 ? 148 ALA B N 1 ATOM 1041 C CA . ALA A 1 140 ? -28.567 48.453 7.576 1.00 43.49 ? 148 ALA B CA 1 ATOM 1042 C C . ALA A 1 140 ? -27.675 49.539 8.191 1.00 41.22 ? 148 ALA B C 1 ATOM 1043 O O . ALA A 1 140 ? -26.645 49.876 7.630 1.00 37.31 ? 148 ALA B O 1 ATOM 1044 C CB . ALA A 1 140 ? -28.500 47.164 8.358 1.00 42.12 ? 148 ALA B CB 1 ATOM 1045 N N . GLU A 1 141 ? -28.087 50.065 9.344 1.00 42.99 ? 149 GLU B N 1 ATOM 1046 C CA . GLU A 1 141 ? -27.527 51.296 9.900 1.00 46.85 ? 149 GLU B CA 1 ATOM 1047 C C . GLU A 1 141 ? -26.366 50.958 10.837 1.00 45.01 ? 149 GLU B C 1 ATOM 1048 O O . GLU A 1 141 ? -25.434 51.754 10.967 1.00 46.35 ? 149 GLU B O 1 ATOM 1049 C CB . GLU A 1 141 ? -28.623 52.071 10.641 1.00 53.87 ? 149 GLU B CB 1 ATOM 1050 C CG . GLU A 1 141 ? -28.671 53.556 10.315 1.00 61.76 ? 149 GLU B CG 1 ATOM 1051 C CD . GLU A 1 141 ? -30.072 54.124 10.119 1.00 66.76 ? 149 GLU B CD 1 ATOM 1052 O OE1 . GLU A 1 141 ? -30.395 54.509 8.969 1.00 70.15 ? 149 GLU B OE1 1 ATOM 1053 O OE2 . GLU A 1 141 ? -30.842 54.185 11.111 1.00 66.21 ? 149 GLU B OE2 1 ATOM 1054 N N . GLU A 1 142 ? -26.469 49.795 11.501 1.00 44.37 ? 150 GLU B N 1 ATOM 1055 C CA . GLU A 1 142 ? -25.490 49.299 12.475 1.00 44.06 ? 150 GLU B CA 1 ATOM 1056 C C . GLU A 1 142 ? -25.195 47.813 12.203 1.00 41.48 ? 150 GLU B C 1 ATOM 1057 O O . GLU A 1 142 ? -26.019 47.069 11.661 1.00 41.96 ? 150 GLU B O 1 ATOM 1058 C CB . GLU A 1 142 ? -25.984 49.503 13.915 1.00 46.60 ? 150 GLU B CB 1 ATOM 1059 C CG . GLU A 1 142 ? -26.101 50.969 14.345 1.00 48.94 ? 150 GLU B CG 1 ATOM 1060 C CD . GLU A 1 142 ? -25.693 51.294 15.783 1.00 52.51 ? 150 GLU B CD 1 ATOM 1061 O OE1 . GLU A 1 142 ? -25.145 52.416 16.028 1.00 50.24 ? 150 GLU B OE1 1 ATOM 1062 O OE2 . GLU A 1 142 ? -25.901 50.430 16.665 1.00 54.49 ? 150 GLU B OE2 1 ATOM 1063 N N . TYR A 1 143 ? -23.991 47.392 12.593 1.00 36.76 ? 151 TYR B N 1 ATOM 1064 C CA . TYR A 1 143 ? -23.612 45.988 12.667 1.00 34.30 ? 151 TYR B CA 1 ATOM 1065 C C . TYR A 1 143 ? -24.463 45.315 13.754 1.00 31.35 ? 151 TYR B C 1 ATOM 1066 O O . TYR A 1 143 ? -24.975 45.982 14.664 1.00 30.41 ? 151 TYR B O 1 ATOM 1067 C CB . TYR A 1 143 ? -22.115 45.865 12.987 1.00 33.33 ? 151 TYR B CB 1 ATOM 1068 C CG . TYR A 1 143 ? -21.157 46.236 11.876 1.00 33.69 ? 151 TYR B CG 1 ATOM 1069 C CD1 . TYR A 1 143 ? -21.486 46.081 10.535 1.00 32.01 ? 151 TYR B CD1 1 ATOM 1070 C CD2 . TYR A 1 143 ? -19.883 46.699 12.173 1.00 33.80 ? 151 TYR B CD2 1 ATOM 1071 C CE1 . TYR A 1 143 ? -20.588 46.393 9.529 1.00 32.14 ? 151 TYR B CE1 1 ATOM 1072 C CE2 . TYR A 1 143 ? -18.970 47.010 11.178 1.00 32.78 ? 151 TYR B CE2 1 ATOM 1073 C CZ . TYR A 1 143 ? -19.325 46.859 9.851 1.00 32.61 ? 151 TYR B CZ 1 ATOM 1074 O OH . TYR A 1 143 ? -18.431 47.167 8.865 1.00 33.33 ? 151 TYR B OH 1 ATOM 1075 N N . ALA A 1 144 ? -24.589 43.993 13.674 1.00 29.34 ? 152 ALA B N 1 ATOM 1076 C CA . ALA A 1 144 ? -25.341 43.211 14.672 1.00 28.88 ? 152 ALA B CA 1 ATOM 1077 C C . ALA A 1 144 ? -24.650 43.293 16.047 1.00 28.26 ? 152 ALA B C 1 ATOM 1078 O O . ALA A 1 144 ? -23.469 43.594 16.131 1.00 26.96 ? 152 ALA B O 1 ATOM 1079 C CB . ALA A 1 144 ? -25.444 41.786 14.190 1.00 27.74 ? 152 ALA B CB 1 ATOM 1080 N N . SER A 1 145 ? -25.391 42.999 17.120 1.00 28.65 ? 153 SER B N 1 ATOM 1081 C CA . SER A 1 145 ? -24.816 42.860 18.473 1.00 31.36 ? 153 SER B CA 1 ATOM 1082 C C . SER A 1 145 ? -24.449 41.387 18.759 1.00 34.92 ? 153 SER B C 1 ATOM 1083 O O . SER A 1 145 ? -23.279 41.052 18.911 1.00 36.40 ? 153 SER B O 1 ATOM 1084 C CB . SER A 1 145 ? -25.736 43.422 19.529 1.00 29.83 ? 153 SER B CB 1 ATOM 1085 O OG . SER A 1 145 ? -25.166 43.270 20.823 1.00 29.94 ? 153 SER B OG 1 ATOM 1086 N N . PHE A 1 146 ? -25.453 40.507 18.842 1.00 37.61 ? 154 PHE B N 1 ATOM 1087 C CA . PHE A 1 146 ? -25.237 39.048 18.996 1.00 36.87 ? 154 PHE B CA 1 ATOM 1088 C C . PHE A 1 146 ? -24.707 38.476 17.683 1.00 32.96 ? 154 PHE B C 1 ATOM 1089 O O . PHE A 1 146 ? -25.095 38.934 16.609 1.00 30.34 ? 154 PHE B O 1 ATOM 1090 C CB . PHE A 1 146 ? -26.529 38.303 19.350 1.00 37.09 ? 154 PHE B CB 1 ATOM 1091 C CG . PHE A 1 146 ? -27.047 38.618 20.726 1.00 36.78 ? 154 PHE B CG 1 ATOM 1092 C CD1 . PHE A 1 146 ? -27.803 39.756 20.948 1.00 37.57 ? 154 PHE B CD1 1 ATOM 1093 C CD2 . PHE A 1 146 ? -26.746 37.796 21.797 1.00 37.79 ? 154 PHE B CD2 1 ATOM 1094 C CE1 . PHE A 1 146 ? -28.270 40.053 22.218 1.00 38.85 ? 154 PHE B CE1 1 ATOM 1095 C CE2 . PHE A 1 146 ? -27.214 38.090 23.067 1.00 38.25 ? 154 PHE B CE2 1 ATOM 1096 C CZ . PHE A 1 146 ? -27.972 39.220 23.274 1.00 39.49 ? 154 PHE B CZ 1 ATOM 1097 N N . LEU A 1 147 ? -23.850 37.461 17.806 1.00 31.22 ? 155 LEU B N 1 ATOM 1098 C CA . LEU A 1 147 ? -23.316 36.778 16.663 1.00 32.80 ? 155 LEU B CA 1 ATOM 1099 C C . LEU A 1 147 ? -24.464 36.074 15.927 1.00 32.75 ? 155 LEU B C 1 ATOM 1100 O O . LEU A 1 147 ? -25.400 35.596 16.556 1.00 29.49 ? 155 LEU B O 1 ATOM 1101 C CB . LEU A 1 147 ? -22.249 35.782 17.123 1.00 32.37 ? 155 LEU B CB 1 ATOM 1102 C CG . LEU A 1 147 ? -21.600 34.965 16.005 1.00 29.99 ? 155 LEU B CG 1 ATOM 1103 C CD1 . LEU A 1 147 ? -20.738 35.852 15.124 1.00 28.99 ? 155 LEU B CD1 1 ATOM 1104 C CD2 . LEU A 1 147 ? -20.781 33.836 16.597 1.00 29.19 ? 155 LEU B CD2 1 ATOM 1105 N N . GLN A 1 148 ? -24.382 36.066 14.594 1.00 33.52 ? 156 GLN B N 1 ATOM 1106 C CA . GLN A 1 148 ? -25.380 35.448 13.736 1.00 36.16 ? 156 GLN B CA 1 ATOM 1107 C C . GLN A 1 148 ? -24.702 34.286 13.019 1.00 36.20 ? 156 GLN B C 1 ATOM 1108 O O . GLN A 1 148 ? -23.497 34.311 12.849 1.00 40.14 ? 156 GLN B O 1 ATOM 1109 C CB . GLN A 1 148 ? -25.953 36.421 12.698 1.00 37.31 ? 156 GLN B CB 1 ATOM 1110 C CG . GLN A 1 148 ? -26.509 37.717 13.282 1.00 36.57 ? 156 GLN B CG 1 ATOM 1111 C CD . GLN A 1 148 ? -27.905 37.563 13.837 1.00 37.31 ? 156 GLN B CD 1 ATOM 1112 O OE1 . GLN A 1 148 ? -28.833 37.140 13.138 1.00 33.09 ? 156 GLN B OE1 1 ATOM 1113 N NE2 . GLN A 1 148 ? -28.056 37.929 15.104 1.00 35.90 ? 156 GLN B NE2 1 ATOM 1114 N N . GLU A 1 149 ? -25.501 33.286 12.637 1.00 34.89 ? 157 GLU B N 1 ATOM 1115 C CA . GLU A 1 149 ? -25.060 32.133 11.875 1.00 34.34 ? 157 GLU B CA 1 ATOM 1116 C C . GLU A 1 149 ? -26.069 31.895 10.748 1.00 34.18 ? 157 GLU B C 1 ATOM 1117 O O . GLU A 1 149 ? -27.243 32.244 10.869 1.00 31.84 ? 157 GLU B O 1 ATOM 1118 C CB . GLU A 1 149 ? -24.894 30.896 12.777 1.00 35.34 ? 157 GLU B CB 1 ATOM 1119 C CG . GLU A 1 149 ? -26.030 30.647 13.775 1.00 35.73 ? 157 GLU B CG 1 ATOM 1120 C CD . GLU A 1 149 ? -25.983 29.358 14.601 1.00 34.93 ? 157 GLU B CD 1 ATOM 1121 O OE1 . GLU A 1 149 ? -24.890 28.866 14.932 1.00 32.05 ? 157 GLU B OE1 1 ATOM 1122 O OE2 . GLU A 1 149 ? -27.060 28.837 14.926 1.00 37.03 ? 157 GLU B OE2 1 ATOM 1123 N N . ALA A 1 150 ? -25.592 31.297 9.655 1.00 35.64 ? 158 ALA B N 1 ATOM 1124 C CA . ALA A 1 150 ? -26.453 30.842 8.572 1.00 37.03 ? 158 ALA B CA 1 ATOM 1125 C C . ALA A 1 150 ? -25.825 29.623 7.893 1.00 38.79 ? 158 ALA B C 1 ATOM 1126 O O . ALA A 1 150 ? -24.619 29.502 7.861 1.00 38.98 ? 158 ALA B O 1 ATOM 1127 C CB . ALA A 1 150 ? -26.679 31.957 7.591 1.00 37.98 ? 158 ALA B CB 1 ATOM 1128 N N . GLN A 1 151 ? -26.668 28.713 7.391 1.00 43.11 ? 159 GLN B N 1 ATOM 1129 C CA . GLN A 1 151 ? -26.211 27.622 6.564 1.00 43.60 ? 159 GLN B CA 1 ATOM 1130 C C . GLN A 1 151 ? -26.227 28.124 5.134 1.00 41.48 ? 159 GLN B C 1 ATOM 1131 O O . GLN A 1 151 ? -27.155 28.795 4.708 1.00 41.79 ? 159 GLN B O 1 ATOM 1132 C CB . GLN A 1 151 ? -27.085 26.379 6.669 1.00 50.03 ? 159 GLN B CB 1 ATOM 1133 C CG . GLN A 1 151 ? -27.121 25.801 8.072 1.00 62.41 ? 159 GLN B CG 1 ATOM 1134 C CD . GLN A 1 151 ? -26.667 24.364 8.101 1.00 76.71 ? 159 GLN B CD 1 ATOM 1135 O OE1 . GLN A 1 151 ? -26.957 23.598 7.183 1.00 92.14 ? 159 GLN B OE1 1 ATOM 1136 N NE2 . GLN A 1 151 ? -25.947 23.990 9.155 1.00 82.98 ? 159 GLN B NE2 1 ATOM 1137 N N . VAL A 1 152 ? -25.176 27.777 4.413 1.00 40.12 ? 160 VAL B N 1 ATOM 1138 C CA . VAL A 1 152 ? -24.982 28.281 3.118 1.00 41.69 ? 160 VAL B CA 1 ATOM 1139 C C . VAL A 1 152 ? -24.240 27.212 2.321 1.00 41.98 ? 160 VAL B C 1 ATOM 1140 O O . VAL A 1 152 ? -23.292 26.606 2.812 1.00 40.45 ? 160 VAL B O 1 ATOM 1141 C CB . VAL A 1 152 ? -24.251 29.634 3.203 1.00 43.73 ? 160 VAL B CB 1 ATOM 1142 C CG1 . VAL A 1 152 ? -22.763 29.491 3.512 1.00 41.70 ? 160 VAL B CG1 1 ATOM 1143 C CG2 . VAL A 1 152 ? -24.482 30.445 1.948 1.00 45.97 ? 160 VAL B CG2 1 ATOM 1144 N N . PRO A 1 153 ? -24.734 26.851 1.119 1.00 45.87 ? 161 PRO B N 1 ATOM 1145 C CA . PRO A 1 153 ? -24.116 25.786 0.330 1.00 47.57 ? 161 PRO B CA 1 ATOM 1146 C C . PRO A 1 153 ? -22.974 26.289 -0.565 1.00 48.36 ? 161 PRO B C 1 ATOM 1147 O O . PRO A 1 153 ? -23.058 27.397 -1.101 1.00 47.82 ? 161 PRO B O 1 ATOM 1148 C CB . PRO A 1 153 ? -25.312 25.298 -0.502 1.00 46.79 ? 161 PRO B CB 1 ATOM 1149 C CG . PRO A 1 153 ? -26.106 26.567 -0.771 1.00 47.23 ? 161 PRO B CG 1 ATOM 1150 C CD . PRO A 1 153 ? -25.968 27.374 0.503 1.00 46.29 ? 161 PRO B CD 1 ATOM 1151 N N . PHE A 1 154 ? -21.945 25.448 -0.729 1.00 52.45 ? 162 PHE B N 1 ATOM 1152 C CA . PHE A 1 154 ? -20.845 25.665 -1.677 1.00 57.39 ? 162 PHE B CA 1 ATOM 1153 C C . PHE A 1 154 ? -21.449 25.813 -3.075 1.00 53.54 ? 162 PHE B C 1 ATOM 1154 O O . PHE A 1 154 ? -22.584 25.455 -3.270 1.00 56.95 ? 162 PHE B O 1 ATOM 1155 C CB . PHE A 1 154 ? -19.846 24.511 -1.551 1.00 67.14 ? 162 PHE B CB 1 ATOM 1156 C CG . PHE A 1 154 ? -18.632 24.560 -2.449 1.00 82.57 ? 162 PHE B CG 1 ATOM 1157 C CD1 . PHE A 1 154 ? -18.721 24.195 -3.790 1.00 94.84 ? 162 PHE B CD1 1 ATOM 1158 C CD2 . PHE A 1 154 ? -17.385 24.907 -1.945 1.00 83.11 ? 162 PHE B CD2 1 ATOM 1159 C CE1 . PHE A 1 154 ? -17.603 24.219 -4.616 1.00 96.00 ? 162 PHE B CE1 1 ATOM 1160 C CE2 . PHE A 1 154 ? -16.267 24.922 -2.771 1.00 90.16 ? 162 PHE B CE2 1 ATOM 1161 C CZ . PHE A 1 154 ? -16.376 24.585 -4.106 1.00 92.72 ? 162 PHE B CZ 1 ATOM 1162 N N . LEU A 1 155 ? -20.701 26.391 -4.017 1.00 56.23 ? 163 LEU B N 1 ATOM 1163 C CA . LEU A 1 155 ? -21.132 26.483 -5.415 1.00 59.91 ? 163 LEU B CA 1 ATOM 1164 C C . LEU A 1 155 ? -19.952 26.219 -6.344 1.00 63.15 ? 163 LEU B C 1 ATOM 1165 O O . LEU A 1 155 ? -18.822 26.611 -6.057 1.00 64.30 ? 163 LEU B O 1 ATOM 1166 C CB . LEU A 1 155 ? -21.716 27.866 -5.704 1.00 62.59 ? 163 LEU B CB 1 ATOM 1167 C CG . LEU A 1 155 ? -23.168 28.078 -5.283 1.00 70.55 ? 163 LEU B CG 1 ATOM 1168 C CD1 . LEU A 1 155 ? -23.618 29.478 -5.662 1.00 73.77 ? 163 LEU B CD1 1 ATOM 1169 C CD2 . LEU A 1 155 ? -24.093 27.039 -5.908 1.00 75.04 ? 163 LEU B CD2 1 ATOM 1170 N N . SER A 1 156 ? -20.247 25.569 -7.472 1.00 70.18 ? 164 SER B N 1 ATOM 1171 C CA . SER A 1 156 ? -19.243 25.263 -8.452 1.00 73.03 ? 164 SER B CA 1 ATOM 1172 C C . SER A 1 156 ? -18.711 26.578 -9.016 1.00 67.69 ? 164 SER B C 1 ATOM 1173 O O . SER A 1 156 ? -19.397 27.593 -8.959 1.00 63.09 ? 164 SER B O 1 ATOM 1174 C CB . SER A 1 156 ? -19.774 24.382 -9.543 1.00 77.96 ? 164 SER B CB 1 ATOM 1175 O OG . SER A 1 156 ? -18.759 24.122 -10.505 1.00 88.81 ? 164 SER B OG 1 ATOM 1176 N N . LEU A 1 157 ? -17.485 26.525 -9.539 1.00 67.18 ? 165 LEU B N 1 ATOM 1177 C CA . LEU A 1 157 ? -16.889 27.643 -10.238 1.00 69.05 ? 165 LEU B CA 1 ATOM 1178 C C . LEU A 1 157 ? -17.650 27.894 -11.543 1.00 65.19 ? 165 LEU B C 1 ATOM 1179 O O . LEU A 1 157 ? -17.986 29.035 -11.849 1.00 60.57 ? 165 LEU B O 1 ATOM 1180 C CB . LEU A 1 157 ? -15.415 27.353 -10.528 1.00 69.35 ? 165 LEU B CB 1 ATOM 1181 C CG . LEU A 1 157 ? -14.595 28.595 -10.862 1.00 74.35 ? 165 LEU B CG 1 ATOM 1182 C CD1 . LEU A 1 157 ? -13.768 29.020 -9.657 1.00 76.18 ? 165 LEU B CD1 1 ATOM 1183 C CD2 . LEU A 1 157 ? -13.715 28.368 -12.085 1.00 75.08 ? 165 LEU B CD2 1 ATOM 1184 N N . GLU A 1 158 ? -17.887 26.819 -12.305 1.00 67.17 ? 166 GLU B N 1 ATOM 1185 C CA . GLU A 1 158 ? -18.686 26.873 -13.521 1.00 70.74 ? 166 GLU B CA 1 ATOM 1186 C C . GLU A 1 158 ? -19.953 27.688 -13.249 1.00 70.94 ? 166 GLU B C 1 ATOM 1187 O O . GLU A 1 158 ? -20.215 28.684 -13.930 1.00 62.54 ? 166 GLU B O 1 ATOM 1188 C CB . GLU A 1 158 ? -19.072 25.469 -13.992 1.00 78.00 ? 166 GLU B CB 1 ATOM 1189 C CG . GLU A 1 158 ? -18.086 24.840 -14.966 1.00 85.20 ? 166 GLU B CG 1 ATOM 1190 C CD . GLU A 1 158 ? -18.744 23.999 -16.051 1.00 91.80 ? 166 GLU B CD 1 ATOM 1191 O OE1 . GLU A 1 158 ? -18.493 22.770 -16.103 1.00 92.37 ? 166 GLU B OE1 1 ATOM 1192 O OE2 . GLU A 1 158 ? -19.515 24.575 -16.844 1.00 95.61 ? 166 GLU B OE2 1 ATOM 1193 N N . ARG A 1 159 ? -20.703 27.262 -12.222 1.00 74.99 ? 167 ARG B N 1 ATOM 1194 C CA . ARG A 1 159 ? -22.021 27.831 -11.894 1.00 79.00 ? 167 ARG B CA 1 ATOM 1195 C C . ARG A 1 159 ? -21.868 29.277 -11.393 1.00 76.27 ? 167 ARG B C 1 ATOM 1196 O O . ARG A 1 159 ? -22.671 30.137 -11.749 1.00 71.71 ? 167 ARG B O 1 ATOM 1197 C CB . ARG A 1 159 ? -22.769 26.930 -10.900 1.00 86.57 ? 167 ARG B CB 1 ATOM 1198 C CG . ARG A 1 159 ? -23.639 25.864 -11.563 1.00 91.23 ? 167 ARG B CG 1 ATOM 1199 C CD . ARG A 1 159 ? -23.682 24.526 -10.833 1.00 95.43 ? 167 ARG B CD 1 ATOM 1200 N NE . ARG A 1 159 ? -24.297 24.593 -9.510 1.00 94.14 ? 167 ARG B NE 1 ATOM 1201 C CZ . ARG A 1 159 ? -23.866 23.938 -8.432 1.00 90.60 ? 167 ARG B CZ 1 ATOM 1202 N NH1 . ARG A 1 159 ? -22.744 23.238 -8.467 1.00 85.27 ? 167 ARG B NH1 1 ATOM 1203 N NH2 . ARG A 1 159 ? -24.560 23.994 -7.311 1.00 89.92 ? 167 ARG B NH2 1 ATOM 1204 N N . CYS A 1 160 ? -20.824 29.546 -10.600 1.00 73.66 ? 168 CYS B N 1 ATOM 1205 C CA . CYS A 1 160 ? -20.612 30.871 -10.013 1.00 66.70 ? 168 CYS B CA 1 ATOM 1206 C C . CYS A 1 160 ? -20.101 31.884 -11.046 1.00 60.53 ? 168 CYS B C 1 ATOM 1207 O O . CYS A 1 160 ? -20.469 33.062 -10.996 1.00 52.16 ? 168 CYS B O 1 ATOM 1208 C CB . CYS A 1 160 ? -19.617 30.828 -8.863 1.00 69.17 ? 168 CYS B CB 1 ATOM 1209 S SG . CYS A 1 160 ? -19.540 32.415 -7.993 1.00 73.83 ? 168 CYS B SG 1 ATOM 1210 N N . SER A 1 161 ? -19.237 31.428 -11.960 1.00 59.69 ? 169 SER B N 1 ATOM 1211 C CA . SER A 1 161 ? -18.647 32.293 -12.990 1.00 59.07 ? 169 SER B CA 1 ATOM 1212 C C . SER A 1 161 ? -19.608 32.501 -14.171 1.00 59.20 ? 169 SER B C 1 ATOM 1213 O O . SER A 1 161 ? -19.225 33.121 -15.154 1.00 59.16 ? 169 SER B O 1 ATOM 1214 C CB . SER A 1 161 ? -17.331 31.747 -13.474 1.00 58.44 ? 169 SER B CB 1 ATOM 1215 O OG . SER A 1 161 ? -17.523 30.533 -14.182 1.00 60.24 ? 169 SER B OG 1 ATOM 1216 N N . ALA A 1 162 A -20.837 31.977 -14.080 1.00 57.26 ? 169 ALA B N 1 ATOM 1217 C CA . ALA A 1 162 A -21.840 32.156 -15.111 1.00 57.29 ? 169 ALA B CA 1 ATOM 1218 C C . ALA A 1 162 A -22.031 33.646 -15.385 1.00 61.41 ? 169 ALA B C 1 ATOM 1219 O O . ALA A 1 162 A -22.059 34.437 -14.446 1.00 63.43 ? 169 ALA B O 1 ATOM 1220 C CB . ALA A 1 162 A -23.125 31.508 -14.671 1.00 59.79 ? 169 ALA B CB 1 ATOM 1221 N N . PRO A 1 163 B -22.156 34.080 -16.665 1.00 66.09 ? 169 PRO B N 1 ATOM 1222 C CA . PRO A 1 163 B -22.238 35.505 -17.002 1.00 64.62 ? 169 PRO B CA 1 ATOM 1223 C C . PRO A 1 163 B -23.206 36.368 -16.180 1.00 59.79 ? 169 PRO B C 1 ATOM 1224 O O . PRO A 1 163 B -22.949 37.543 -16.001 1.00 55.19 ? 169 PRO B O 1 ATOM 1225 C CB . PRO A 1 163 B -22.685 35.483 -18.474 1.00 65.13 ? 169 PRO B CB 1 ATOM 1226 C CG . PRO A 1 163 B -22.028 34.236 -19.016 1.00 67.47 ? 169 PRO B CG 1 ATOM 1227 C CD . PRO A 1 163 B -22.125 33.238 -17.875 1.00 68.80 ? 169 PRO B CD 1 ATOM 1228 N N . ASP A 1 164 ? -24.303 35.784 -15.701 1.00 62.47 ? 170 ASP B N 1 ATOM 1229 C CA . ASP A 1 164 ? -25.351 36.554 -15.015 1.00 68.40 ? 170 ASP B CA 1 ATOM 1230 C C . ASP A 1 164 ? -25.304 36.302 -13.498 1.00 67.77 ? 170 ASP B C 1 ATOM 1231 O O . ASP A 1 164 ? -26.162 36.784 -12.753 1.00 69.37 ? 170 ASP B O 1 ATOM 1232 C CB . ASP A 1 164 ? -26.728 36.246 -15.613 1.00 70.92 ? 170 ASP B CB 1 ATOM 1233 C CG . ASP A 1 164 ? -27.013 34.766 -15.795 1.00 72.39 ? 170 ASP B CG 1 ATOM 1234 O OD1 . ASP A 1 164 ? -26.166 33.934 -15.381 1.00 76.99 ? 170 ASP B OD1 1 ATOM 1235 O OD2 . ASP A 1 164 ? -28.070 34.457 -16.360 1.00 73.57 ? 170 ASP B OD2 1 ATOM 1236 N N . VAL A 1 165 ? -24.305 35.542 -13.043 1.00 65.26 ? 171 VAL B N 1 ATOM 1237 C CA . VAL A 1 165 ? -24.014 35.411 -11.625 1.00 61.31 ? 171 VAL B CA 1 ATOM 1238 C C . VAL A 1 165 ? -22.908 36.379 -11.190 1.00 55.85 ? 171 VAL B C 1 ATOM 1239 O O . VAL A 1 165 ? -23.233 37.403 -10.617 1.00 54.85 ? 171 VAL B O 1 ATOM 1240 C CB . VAL A 1 165 ? -23.651 33.961 -11.239 1.00 62.41 ? 171 VAL B CB 1 ATOM 1241 C CG1 . VAL A 1 165 ? -23.329 33.825 -9.754 1.00 59.20 ? 171 VAL B CG1 1 ATOM 1242 C CG2 . VAL A 1 165 ? -24.759 32.996 -11.638 1.00 62.23 ? 171 VAL B CG2 1 ATOM 1243 N N . HIS A 1 166 ? -21.639 36.058 -11.495 1.00 51.26 ? 172 HIS B N 1 ATOM 1244 C CA . HIS A 1 166 ? -20.470 36.866 -11.103 1.00 50.66 ? 172 HIS B CA 1 ATOM 1245 C C . HIS A 1 166 ? -19.475 36.948 -12.272 1.00 53.54 ? 172 HIS B C 1 ATOM 1246 O O . HIS A 1 166 ? -18.495 37.676 -12.188 1.00 55.44 ? 172 HIS B O 1 ATOM 1247 C CB . HIS A 1 166 ? -19.757 36.356 -9.841 1.00 47.37 ? 172 HIS B CB 1 ATOM 1248 C CG . HIS A 1 166 ? -20.449 36.713 -8.568 1.00 45.84 ? 172 HIS B CG 1 ATOM 1249 N ND1 . HIS A 1 166 ? -20.811 38.012 -8.267 1.00 44.09 ? 172 HIS B ND1 1 ATOM 1250 C CD2 . HIS A 1 166 ? -20.840 35.951 -7.519 1.00 43.21 ? 172 HIS B CD2 1 ATOM 1251 C CE1 . HIS A 1 166 ? -21.401 38.032 -7.084 1.00 45.28 ? 172 HIS B CE1 1 ATOM 1252 N NE2 . HIS A 1 166 ? -21.436 36.777 -6.607 1.00 42.21 ? 172 HIS B NE2 1 ATOM 1253 N N . GLY A 1 167 ? -19.710 36.204 -13.355 1.00 56.63 ? 173 GLY B N 1 ATOM 1254 C CA . GLY A 1 167 ? -18.874 36.290 -14.547 1.00 57.29 ? 173 GLY B CA 1 ATOM 1255 C C . GLY A 1 167 ? -17.415 35.980 -14.248 1.00 57.29 ? 173 GLY B C 1 ATOM 1256 O O . GLY A 1 167 ? -17.086 35.007 -13.575 1.00 59.20 ? 173 GLY B O 1 ATOM 1257 N N . SER A 1 168 ? -16.523 36.827 -14.758 1.00 58.21 ? 174 SER B N 1 ATOM 1258 C CA . SER A 1 168 ? -15.099 36.591 -14.660 1.00 60.23 ? 174 SER B CA 1 ATOM 1259 C C . SER A 1 168 ? -14.490 37.385 -13.495 1.00 61.49 ? 174 SER B C 1 ATOM 1260 O O . SER A 1 168 ? -13.272 37.485 -13.409 1.00 61.82 ? 174 SER B O 1 ATOM 1261 C CB . SER A 1 168 ? -14.457 36.947 -15.952 1.00 60.43 ? 174 SER B CB 1 ATOM 1262 O OG . SER A 1 168 ? -14.995 38.173 -16.401 1.00 58.93 ? 174 SER B OG 1 ATOM 1263 N N . SER A 1 169 ? -15.340 37.941 -12.613 1.00 58.76 ? 175 SER B N 1 ATOM 1264 C CA . SER A 1 169 ? -14.921 38.459 -11.295 1.00 52.63 ? 175 SER B CA 1 ATOM 1265 C C . SER A 1 169 ? -14.305 37.342 -10.438 1.00 52.00 ? 175 SER B C 1 ATOM 1266 O O . SER A 1 169 ? -13.419 37.600 -9.618 1.00 57.74 ? 175 SER B O 1 ATOM 1267 C CB . SER A 1 169 ? -16.062 39.106 -10.556 1.00 50.58 ? 175 SER B CB 1 ATOM 1268 O OG . SER A 1 169 ? -16.289 40.426 -11.013 1.00 51.75 ? 175 SER B OG 1 ATOM 1269 N N . ILE A 1 170 ? -14.781 36.105 -10.608 1.00 46.39 ? 176 ILE B N 1 ATOM 1270 C CA . ILE A 1 170 ? -14.299 35.008 -9.801 1.00 45.93 ? 176 ILE B CA 1 ATOM 1271 C C . ILE A 1 170 ? -12.940 34.551 -10.324 1.00 43.17 ? 176 ILE B C 1 ATOM 1272 O O . ILE A 1 170 ? -12.882 33.901 -11.338 1.00 44.35 ? 176 ILE B O 1 ATOM 1273 C CB . ILE A 1 170 ? -15.294 33.845 -9.785 1.00 45.98 ? 176 ILE B CB 1 ATOM 1274 C CG1 . ILE A 1 170 ? -16.701 34.320 -9.434 1.00 48.25 ? 176 ILE B CG1 1 ATOM 1275 C CG2 . ILE A 1 170 ? -14.802 32.774 -8.829 1.00 47.88 ? 176 ILE B CG2 1 ATOM 1276 C CD1 . ILE A 1 170 ? -16.779 35.042 -8.111 1.00 51.01 ? 176 ILE B CD1 1 ATOM 1277 N N . LEU A 1 171 ? -11.874 34.892 -9.591 1.00 43.90 ? 177 LEU B N 1 ATOM 1278 C CA . LEU A 1 171 ? -10.505 34.552 -9.951 1.00 45.46 ? 177 LEU B CA 1 ATOM 1279 C C . LEU A 1 171 ? -9.977 33.445 -9.042 1.00 46.84 ? 177 LEU B C 1 ATOM 1280 O O . LEU A 1 171 ? -10.465 33.246 -7.926 1.00 45.95 ? 177 LEU B O 1 ATOM 1281 C CB . LEU A 1 171 ? -9.630 35.795 -9.806 1.00 47.28 ? 177 LEU B CB 1 ATOM 1282 C CG . LEU A 1 171 ? -10.048 36.991 -10.652 1.00 49.53 ? 177 LEU B CG 1 ATOM 1283 C CD1 . LEU A 1 171 ? -9.363 38.258 -10.157 1.00 48.75 ? 177 LEU B CD1 1 ATOM 1284 C CD2 . LEU A 1 171 ? -9.740 36.731 -12.119 1.00 49.04 ? 177 LEU B CD2 1 ATOM 1285 N N . PRO A 1 172 ? -8.936 32.700 -9.479 1.00 44.97 ? 178 PRO B N 1 ATOM 1286 C CA . PRO A 1 172 ? -8.305 31.710 -8.610 1.00 42.53 ? 178 PRO B CA 1 ATOM 1287 C C . PRO A 1 172 ? -8.040 32.295 -7.209 1.00 40.36 ? 178 PRO B C 1 ATOM 1288 O O . PRO A 1 172 ? -7.623 33.454 -7.078 1.00 35.85 ? 178 PRO B O 1 ATOM 1289 C CB . PRO A 1 172 ? -7.017 31.311 -9.358 1.00 42.73 ? 178 PRO B CB 1 ATOM 1290 C CG . PRO A 1 172 ? -6.933 32.227 -10.583 1.00 42.34 ? 178 PRO B CG 1 ATOM 1291 C CD . PRO A 1 172 ? -8.335 32.739 -10.823 1.00 43.30 ? 178 PRO B CD 1 ATOM 1292 N N . GLY A 1 173 ? -8.296 31.476 -6.181 1.00 39.99 ? 179 GLY B N 1 ATOM 1293 C CA . GLY A 1 173 ? -8.163 31.851 -4.769 1.00 40.26 ? 179 GLY B CA 1 ATOM 1294 C C . GLY A 1 173 ? -9.484 32.336 -4.193 1.00 38.37 ? 179 GLY B C 1 ATOM 1295 O O . GLY A 1 173 ? -9.567 32.677 -3.006 1.00 33.16 ? 179 GLY B O 1 ATOM 1296 N N . MET A 1 174 ? -10.506 32.384 -5.061 1.00 38.64 ? 180 MET B N 1 ATOM 1297 C CA . MET A 1 174 ? -11.873 32.713 -4.695 1.00 39.77 ? 180 MET B CA 1 ATOM 1298 C C . MET A 1 174 ? -12.752 31.458 -4.770 1.00 43.21 ? 180 MET B C 1 ATOM 1299 O O . MET A 1 174 ? -12.365 30.428 -5.316 1.00 50.42 ? 180 MET B O 1 ATOM 1300 C CB . MET A 1 174 ? -12.455 33.777 -5.628 1.00 36.88 ? 180 MET B CB 1 ATOM 1301 C CG . MET A 1 174 ? -11.759 35.095 -5.543 1.00 34.09 ? 180 MET B CG 1 ATOM 1302 S SD . MET A 1 174 ? -12.642 36.326 -6.499 1.00 36.13 ? 180 MET B SD 1 ATOM 1303 C CE . MET A 1 174 ? -11.370 37.587 -6.579 1.00 37.10 ? 180 MET B CE 1 ATOM 1304 N N . LEU A 1 175 ? -13.975 31.605 -4.257 1.00 47.31 ? 181 LEU B N 1 ATOM 1305 C CA . LEU A 1 175 ? -14.880 30.521 -3.910 1.00 43.92 ? 181 LEU B CA 1 ATOM 1306 C C . LEU A 1 175 ? -16.247 31.146 -3.594 1.00 45.76 ? 181 LEU B C 1 ATOM 1307 O O . LEU A 1 175 ? -16.311 32.198 -2.929 1.00 44.66 ? 181 LEU B O 1 ATOM 1308 C CB . LEU A 1 175 ? -14.251 29.820 -2.703 1.00 41.22 ? 181 LEU B CB 1 ATOM 1309 C CG . LEU A 1 175 ? -15.022 28.679 -2.058 1.00 38.38 ? 181 LEU B CG 1 ATOM 1310 C CD1 . LEU A 1 175 ? -14.098 27.914 -1.114 1.00 37.84 ? 181 LEU B CD1 1 ATOM 1311 C CD2 . LEU A 1 175 ? -16.242 29.189 -1.309 1.00 38.04 ? 181 LEU B CD2 1 ATOM 1312 N N . CYS A 1 176 ? -17.325 30.533 -4.101 1.00 47.07 ? 182 CYS B N 1 ATOM 1313 C CA . CYS A 1 176 ? -18.679 31.063 -3.916 1.00 46.70 ? 182 CYS B CA 1 ATOM 1314 C C . CYS A 1 176 ? -19.492 30.114 -3.041 1.00 43.35 ? 182 CYS B C 1 ATOM 1315 O O . CYS A 1 176 ? -19.241 28.920 -3.008 1.00 44.50 ? 182 CYS B O 1 ATOM 1316 C CB . CYS A 1 176 ? -19.376 31.276 -5.249 1.00 51.29 ? 182 CYS B CB 1 ATOM 1317 S SG . CYS A 1 176 ? -18.297 32.086 -6.451 1.00 58.94 ? 182 CYS B SG 1 ATOM 1318 N N . ALA A 1 177 ? -20.457 30.684 -2.326 1.00 41.54 ? 183 ALA B N 1 ATOM 1319 C CA . ALA A 1 177 ? -21.241 29.965 -1.358 1.00 43.45 ? 183 ALA B CA 1 ATOM 1320 C C . ALA A 1 177 ? -22.445 30.831 -1.016 1.00 45.93 ? 183 ALA B C 1 ATOM 1321 O O . ALA A 1 177 ? -22.268 31.979 -0.628 1.00 45.15 ? 183 ALA B O 1 ATOM 1322 C CB . ALA A 1 177 ? -20.424 29.657 -0.128 1.00 41.94 ? 183 ALA B CB 1 ATOM 1323 N N . GLY A 1 178 ? -23.644 30.266 -1.182 1.00 50.47 ? 184 GLY B N 1 ATOM 1324 C CA . GLY A 1 178 ? -24.882 31.039 -1.207 1.00 52.53 ? 184 GLY B CA 1 ATOM 1325 C C . GLY A 1 178 ? -25.947 30.359 -2.042 1.00 53.77 ? 184 GLY B C 1 ATOM 1326 O O . GLY A 1 178 ? -25.690 29.365 -2.726 1.00 55.77 ? 184 GLY B O 1 ATOM 1327 N N . PHE A 1 179 A -27.153 30.917 -1.963 1.00 55.37 ? 184 PHE B N 1 ATOM 1328 C CA . PHE A 1 179 A -28.272 30.499 -2.753 1.00 52.63 ? 184 PHE B CA 1 ATOM 1329 C C . PHE A 1 179 A -28.458 31.497 -3.893 1.00 50.66 ? 184 PHE B C 1 ATOM 1330 O O . PHE A 1 179 A -28.499 32.702 -3.644 1.00 48.47 ? 184 PHE B O 1 ATOM 1331 C CB . PHE A 1 179 A -29.529 30.441 -1.890 1.00 54.22 ? 184 PHE B CB 1 ATOM 1332 C CG . PHE A 1 179 A -29.387 29.635 -0.627 1.00 54.49 ? 184 PHE B CG 1 ATOM 1333 C CD1 . PHE A 1 179 A -29.568 28.263 -0.641 1.00 53.87 ? 184 PHE B CD1 1 ATOM 1334 C CD2 . PHE A 1 179 A -29.090 30.252 0.577 1.00 56.09 ? 184 PHE B CD2 1 ATOM 1335 C CE1 . PHE A 1 179 A -29.450 27.524 0.525 1.00 56.19 ? 184 PHE B CE1 1 ATOM 1336 C CE2 . PHE A 1 179 A -28.974 29.513 1.743 1.00 57.66 ? 184 PHE B CE2 1 ATOM 1337 C CZ . PHE A 1 179 A -29.156 28.151 1.715 1.00 58.89 ? 184 PHE B CZ 1 ATOM 1338 N N . LEU A 1 180 ? -28.578 30.968 -5.118 1.00 50.85 ? 185 LEU B N 1 ATOM 1339 C CA . LEU A 1 180 ? -28.783 31.756 -6.323 1.00 52.16 ? 185 LEU B CA 1 ATOM 1340 C C . LEU A 1 180 ? -30.099 32.522 -6.216 1.00 47.76 ? 185 LEU B C 1 ATOM 1341 O O . LEU A 1 180 ? -30.225 33.598 -6.767 1.00 45.37 ? 185 LEU B O 1 ATOM 1342 C CB . LEU A 1 180 ? -28.804 30.836 -7.545 1.00 59.09 ? 185 LEU B CB 1 ATOM 1343 C CG . LEU A 1 180 ? -27.456 30.244 -7.955 1.00 65.54 ? 185 LEU B CG 1 ATOM 1344 C CD1 . LEU A 1 180 ? -27.633 29.142 -8.995 1.00 66.46 ? 185 LEU B CD1 1 ATOM 1345 C CD2 . LEU A 1 180 ? -26.525 31.333 -8.479 1.00 67.40 ? 185 LEU B CD2 1 ATOM 1346 N N . GLU A 1 181 ? -31.069 31.956 -5.497 1.00 47.38 ? 186 GLU B N 1 ATOM 1347 C CA . GLU A 1 181 ? -32.342 32.641 -5.274 1.00 51.55 ? 186 GLU B CA 1 ATOM 1348 C C . GLU A 1 181 ? -32.165 33.815 -4.292 1.00 48.57 ? 186 GLU B C 1 ATOM 1349 O O . GLU A 1 181 ? -33.049 34.647 -4.206 1.00 45.08 ? 186 GLU B O 1 ATOM 1350 C CB . GLU A 1 181 ? -33.429 31.660 -4.812 1.00 54.66 ? 186 GLU B CB 1 ATOM 1351 C CG . GLU A 1 181 ? -33.143 30.946 -3.500 1.00 57.58 ? 186 GLU B CG 1 ATOM 1352 C CD . GLU A 1 181 ? -32.511 29.571 -3.642 1.00 63.09 ? 186 GLU B CD 1 ATOM 1353 O OE1 . GLU A 1 181 ? -31.753 29.357 -4.621 1.00 64.96 ? 186 GLU B OE1 1 ATOM 1354 O OE2 . GLU A 1 181 ? -32.766 28.716 -2.767 1.00 66.22 ? 186 GLU B OE2 1 ATOM 1355 N N . GLY A 1 182 ? -31.036 33.866 -3.562 1.00 47.68 ? 187 GLY B N 1 ATOM 1356 C CA . GLY A 1 182 ? -30.706 34.950 -2.611 1.00 43.81 ? 187 GLY B CA 1 ATOM 1357 C C . GLY A 1 182 ? -31.285 34.668 -1.236 1.00 41.23 ? 187 GLY B C 1 ATOM 1358 O O . GLY A 1 182 ? -31.726 33.569 -0.977 1.00 42.88 ? 187 GLY B O 1 ATOM 1359 N N . GLY A 1 183 ? -31.289 35.677 -0.363 1.00 38.76 ? 188 GLY B N 1 ATOM 1360 C CA . GLY A 1 183 ? -32.054 35.652 0.886 1.00 38.45 ? 188 GLY B CA 1 ATOM 1361 C C . GLY A 1 183 ? -31.200 35.329 2.102 1.00 38.76 ? 188 GLY B C 1 ATOM 1362 O O . GLY A 1 183 ? -31.465 35.810 3.217 1.00 38.84 ? 188 GLY B O 1 ATOM 1363 N N . THR A 1 184 A -30.175 34.498 1.905 1.00 39.40 ? 188 THR B N 1 ATOM 1364 C CA . THR A 1 184 A -29.203 34.256 2.955 1.00 40.20 ? 188 THR B CA 1 ATOM 1365 C C . THR A 1 184 A -27.793 34.429 2.403 1.00 38.18 ? 188 THR B C 1 ATOM 1366 O O . THR A 1 184 A -27.494 33.934 1.288 1.00 40.32 ? 188 THR B O 1 ATOM 1367 C CB . THR A 1 184 A -29.420 32.888 3.601 1.00 41.95 ? 188 THR B CB 1 ATOM 1368 O OG1 . THR A 1 184 A -30.526 33.116 4.474 1.00 45.65 ? 188 THR B OG1 1 ATOM 1369 C CG2 . THR A 1 184 A -28.216 32.377 4.365 1.00 43.14 ? 188 THR B CG2 1 ATOM 1370 N N . ASP A 1 185 ? -26.955 35.119 3.199 1.00 35.14 ? 189 ASP B N 1 ATOM 1371 C CA . ASP A 1 185 ? -25.618 35.558 2.772 1.00 36.35 ? 189 ASP B CA 1 ATOM 1372 C C . ASP A 1 185 ? -24.884 36.286 3.900 1.00 37.32 ? 189 ASP B C 1 ATOM 1373 O O . ASP A 1 185 ? -25.475 36.678 4.921 1.00 38.98 ? 189 ASP B O 1 ATOM 1374 C CB . ASP A 1 185 ? -25.703 36.526 1.588 1.00 36.71 ? 189 ASP B CB 1 ATOM 1375 C CG . ASP A 1 185 ? -24.475 36.563 0.703 1.00 35.32 ? 189 ASP B CG 1 ATOM 1376 O OD1 . ASP A 1 185 ? -23.498 35.876 1.030 1.00 35.46 ? 189 ASP B OD1 1 ATOM 1377 O OD2 . ASP A 1 185 ? -24.516 37.281 -0.311 1.00 37.35 ? 189 ASP B OD2 1 ATOM 1378 N N . ALA A 1 186 ? -23.581 36.483 3.676 1.00 36.87 ? 190 ALA B N 1 ATOM 1379 C CA . ALA A 1 186 ? -22.769 37.396 4.466 1.00 38.36 ? 190 ALA B CA 1 ATOM 1380 C C . ALA A 1 186 ? -23.031 38.834 4.009 1.00 36.67 ? 190 ALA B C 1 ATOM 1381 O O . ALA A 1 186 ? -23.530 39.078 2.922 1.00 35.38 ? 190 ALA B O 1 ATOM 1382 C CB . ALA A 1 186 ? -21.308 37.040 4.332 1.00 39.24 ? 190 ALA B CB 1 ATOM 1383 N N . CYS A 1 187 ? -22.663 39.785 4.860 1.00 38.01 ? 191 CYS B N 1 ATOM 1384 C CA . CYS A 1 187 ? -22.813 41.199 4.537 1.00 39.38 ? 191 CYS B CA 1 ATOM 1385 C C . CYS A 1 187 ? -21.591 41.987 5.052 1.00 36.56 ? 191 CYS B C 1 ATOM 1386 O O . CYS A 1 187 ? -20.660 41.427 5.657 1.00 35.28 ? 191 CYS B O 1 ATOM 1387 C CB . CYS A 1 187 ? -24.141 41.716 5.087 1.00 38.33 ? 191 CYS B CB 1 ATOM 1388 S SG . CYS A 1 187 ? -24.881 43.070 4.126 1.00 42.11 ? 191 CYS B SG 1 ATOM 1389 N N . GLN A 1 188 ? -21.579 43.287 4.752 1.00 33.95 ? 192 GLN B N 1 ATOM 1390 C CA . GLN A 1 188 ? -20.574 44.198 5.265 1.00 34.60 ? 192 GLN B CA 1 ATOM 1391 C C . GLN A 1 188 ? -20.508 44.048 6.792 1.00 34.10 ? 192 GLN B C 1 ATOM 1392 O O . GLN A 1 188 ? -21.531 44.084 7.485 1.00 31.84 ? 192 GLN B O 1 ATOM 1393 C CB . GLN A 1 188 ? -20.886 45.635 4.835 1.00 34.54 ? 192 GLN B CB 1 ATOM 1394 C CG . GLN A 1 188 ? -20.364 45.970 3.443 1.00 34.62 ? 192 GLN B CG 1 ATOM 1395 C CD . GLN A 1 188 ? -21.201 45.347 2.355 1.00 35.17 ? 192 GLN B CD 1 ATOM 1396 O OE1 . GLN A 1 188 ? -22.403 45.576 2.286 1.00 37.20 ? 192 GLN B OE1 1 ATOM 1397 N NE2 . GLN A 1 188 ? -20.581 44.543 1.506 1.00 34.31 ? 192 GLN B NE2 1 ATOM 1398 N N . GLY A 1 189 ? -19.287 43.835 7.288 1.00 32.30 ? 193 GLY B N 1 ATOM 1399 C CA . GLY A 1 189 ? -19.020 43.641 8.696 1.00 31.23 ? 193 GLY B CA 1 ATOM 1400 C C . GLY A 1 189 ? -18.752 42.189 9.028 1.00 30.13 ? 193 GLY B C 1 ATOM 1401 O O . GLY A 1 189 ? -18.380 41.854 10.157 1.00 28.93 ? 193 GLY B O 1 ATOM 1402 N N . ASP A 1 190 ? -18.947 41.312 8.045 1.00 30.63 ? 194 ASP B N 1 ATOM 1403 C CA . ASP A 1 190 ? -18.753 39.888 8.283 1.00 32.75 ? 194 ASP B CA 1 ATOM 1404 C C . ASP A 1 190 ? -17.337 39.474 7.858 1.00 30.98 ? 194 ASP B C 1 ATOM 1405 O O . ASP A 1 190 ? -16.916 38.356 8.137 1.00 26.97 ? 194 ASP B O 1 ATOM 1406 C CB . ASP A 1 190 ? -19.854 39.066 7.605 1.00 32.18 ? 194 ASP B CB 1 ATOM 1407 C CG . ASP A 1 190 ? -21.186 39.128 8.333 1.00 31.27 ? 194 ASP B CG 1 ATOM 1408 O OD1 . ASP A 1 190 ? -21.185 39.282 9.594 1.00 28.61 ? 194 ASP B OD1 1 ATOM 1409 O OD2 . ASP A 1 190 ? -22.213 38.998 7.639 1.00 31.83 ? 194 ASP B OD2 1 ATOM 1410 N N . SER A 1 191 ? -16.588 40.399 7.246 1.00 32.11 ? 195 SER B N 1 ATOM 1411 C CA . SER A 1 191 ? -15.357 40.024 6.601 1.00 32.64 ? 195 SER B CA 1 ATOM 1412 C C . SER A 1 191 ? -14.240 39.751 7.594 1.00 32.75 ? 195 SER B C 1 ATOM 1413 O O . SER A 1 191 ? -14.136 40.358 8.664 1.00 31.47 ? 195 SER B O 1 ATOM 1414 C CB . SER A 1 191 ? -14.902 40.995 5.593 1.00 33.74 ? 195 SER B CB 1 ATOM 1415 O OG . SER A 1 191 ? -15.404 40.612 4.331 1.00 35.73 ? 195 SER B OG 1 ATOM 1416 N N . GLY A 1 192 ? -13.389 38.842 7.111 1.00 34.08 ? 196 GLY B N 1 ATOM 1417 C CA . GLY A 1 192 ? -12.396 38.163 7.846 1.00 34.74 ? 196 GLY B CA 1 ATOM 1418 C C . GLY A 1 192 ? -12.932 36.880 8.437 1.00 34.01 ? 196 GLY B C 1 ATOM 1419 O O . GLY A 1 192 ? -12.161 36.009 8.784 1.00 38.15 ? 196 GLY B O 1 ATOM 1420 N N . GLY A 1 193 ? -14.257 36.765 8.534 1.00 31.67 ? 197 GLY B N 1 ATOM 1421 C CA . GLY A 1 193 ? -14.862 35.759 9.364 1.00 31.50 ? 197 GLY B CA 1 ATOM 1422 C C . GLY A 1 193 ? -14.947 34.404 8.667 1.00 31.78 ? 197 GLY B C 1 ATOM 1423 O O . GLY A 1 193 ? -14.701 34.289 7.464 1.00 29.93 ? 197 GLY B O 1 ATOM 1424 N N . PRO A 1 194 ? -15.375 33.362 9.415 1.00 31.64 ? 198 PRO B N 1 ATOM 1425 C CA . PRO A 1 194 ? -15.344 31.982 8.941 1.00 31.64 ? 198 PRO B CA 1 ATOM 1426 C C . PRO A 1 194 ? -16.491 31.554 8.016 1.00 32.84 ? 198 PRO B C 1 ATOM 1427 O O . PRO A 1 194 ? -17.650 31.914 8.248 1.00 29.15 ? 198 PRO B O 1 ATOM 1428 C CB . PRO A 1 194 ? -15.460 31.186 10.245 1.00 31.50 ? 198 PRO B CB 1 ATOM 1429 C CG . PRO A 1 194 ? -16.323 32.053 11.113 1.00 31.75 ? 198 PRO B CG 1 ATOM 1430 C CD . PRO A 1 194 ? -15.895 33.468 10.787 1.00 31.98 ? 198 PRO B CD 1 ATOM 1431 N N . LEU A 1 195 ? -16.101 30.820 6.962 1.00 35.18 ? 199 LEU B N 1 ATOM 1432 C CA . LEU A 1 195 ? -16.901 29.803 6.281 1.00 35.91 ? 199 LEU B CA 1 ATOM 1433 C C . LEU A 1 195 ? -16.321 28.421 6.622 1.00 36.53 ? 199 LEU B C 1 ATOM 1434 O O . LEU A 1 195 ? -15.182 28.094 6.314 1.00 36.30 ? 199 LEU B O 1 ATOM 1435 C CB . LEU A 1 195 ? -16.878 30.051 4.769 1.00 35.24 ? 199 LEU B CB 1 ATOM 1436 C CG . LEU A 1 195 ? -17.758 29.119 3.935 1.00 34.84 ? 199 LEU B CG 1 ATOM 1437 C CD1 . LEU A 1 195 ? -19.230 29.456 4.141 1.00 36.72 ? 199 LEU B CD1 1 ATOM 1438 C CD2 . LEU A 1 195 ? -17.398 29.185 2.453 1.00 32.60 ? 199 LEU B CD2 1 ATOM 1439 N N . VAL A 1 196 ? -17.141 27.653 7.334 1.00 41.44 ? 200 VAL B N 1 ATOM 1440 C CA . VAL A 1 196 ? -16.764 26.343 7.935 1.00 42.47 ? 200 VAL B CA 1 ATOM 1441 C C . VAL A 1 196 ? -17.635 25.208 7.383 1.00 42.14 ? 200 VAL B C 1 ATOM 1442 O O . VAL A 1 196 ? -18.847 25.388 7.288 1.00 39.66 ? 200 VAL B O 1 ATOM 1443 C CB . VAL A 1 196 ? -16.905 26.486 9.461 1.00 42.99 ? 200 VAL B CB 1 ATOM 1444 C CG1 . VAL A 1 196 ? -17.281 25.194 10.151 1.00 46.06 ? 200 VAL B CG1 1 ATOM 1445 C CG2 . VAL A 1 196 ? -15.670 27.107 10.081 1.00 43.00 ? 200 VAL B CG2 1 ATOM 1446 N N . CYS A 1 197 ? -17.013 24.073 7.058 1.00 46.61 ? 201 CYS B N 1 ATOM 1447 C CA . CYS A 1 197 ? -17.718 22.882 6.517 1.00 52.04 ? 201 CYS B CA 1 ATOM 1448 C C . CYS A 1 197 ? -17.296 21.636 7.317 1.00 62.93 ? 201 CYS B C 1 ATOM 1449 O O . CYS A 1 197 ? -16.415 21.725 8.180 1.00 61.95 ? 201 CYS B O 1 ATOM 1450 C CB . CYS A 1 197 ? -17.488 22.763 5.013 1.00 49.34 ? 201 CYS B CB 1 ATOM 1451 S SG . CYS A 1 197 ? -17.822 24.307 4.109 1.00 47.15 ? 201 CYS B SG 1 ATOM 1452 N N . GLU A 1 198 ? -18.027 20.528 7.156 1.00 82.35 ? 202 GLU B N 1 ATOM 1453 C CA . GLU A 1 198 ? -17.762 19.336 8.012 1.00 87.96 ? 202 GLU B CA 1 ATOM 1454 C C . GLU A 1 198 ? -17.610 18.048 7.195 1.00 92.74 ? 202 GLU B C 1 ATOM 1455 O O . GLU A 1 198 ? -18.144 17.990 6.079 1.00 94.28 ? 202 GLU B O 1 ATOM 1456 C CB . GLU A 1 198 ? -18.867 19.193 9.056 1.00 84.95 ? 202 GLU B CB 1 ATOM 1457 C CG . GLU A 1 198 ? -20.203 18.826 8.442 1.00 90.65 ? 202 GLU B CG 1 ATOM 1458 C CD . GLU A 1 198 ? -21.400 19.026 9.352 1.00 92.36 ? 202 GLU B CD 1 ATOM 1459 O OE1 . GLU A 1 198 ? -21.378 19.975 10.161 1.00 86.87 ? 202 GLU B OE1 1 ATOM 1460 O OE2 . GLU A 1 198 ? -22.350 18.233 9.246 1.00 88.38 ? 202 GLU B OE2 1 ATOM 1461 N N . ASP A 1 199 ? -16.905 17.066 7.775 1.00 94.98 ? 203 ASP B N 1 ATOM 1462 C CA . ASP A 1 199 ? -16.583 15.748 7.159 1.00 90.53 ? 203 ASP B CA 1 ATOM 1463 C C . ASP A 1 199 ? -17.861 15.078 6.648 1.00 84.24 ? 203 ASP B C 1 ATOM 1464 O O . ASP A 1 199 ? -17.734 13.961 6.115 1.00 76.08 ? 203 ASP B O 1 ATOM 1465 C CB . ASP A 1 199 ? -15.839 14.849 8.154 1.00 89.96 ? 203 ASP B CB 1 ATOM 1466 C CG . ASP A 1 199 ? -14.692 14.049 7.553 1.00 91.31 ? 203 ASP B CG 1 ATOM 1467 O OD1 . ASP A 1 199 ? -14.886 13.454 6.481 1.00 91.80 ? 203 ASP B OD1 1 ATOM 1468 O OD2 . ASP A 1 199 ? -13.610 14.024 8.167 1.00 79.18 ? 203 ASP B OD2 1 ATOM 1469 N N . ARG A 1 205 ? -15.833 16.244 11.394 1.00 77.14 ? 206 ARG B N 1 ATOM 1470 C CA . ARG A 1 205 ? -14.625 17.036 11.153 1.00 80.03 ? 206 ARG B CA 1 ATOM 1471 C C . ARG A 1 205 ? -15.029 18.441 10.692 1.00 75.91 ? 206 ARG B C 1 ATOM 1472 O O . ARG A 1 205 ? -15.830 18.574 9.768 1.00 71.52 ? 206 ARG B O 1 ATOM 1473 C CB . ARG A 1 205 ? -13.752 16.336 10.105 1.00 86.07 ? 206 ARG B CB 1 ATOM 1474 C CG . ARG A 1 205 ? -12.519 17.104 9.643 1.00 88.89 ? 206 ARG B CG 1 ATOM 1475 C CD . ARG A 1 205 ? -11.570 17.521 10.756 1.00 89.44 ? 206 ARG B CD 1 ATOM 1476 N NE . ARG A 1 205 ? -11.021 16.404 11.515 1.00 88.23 ? 206 ARG B NE 1 ATOM 1477 C CZ . ARG A 1 205 ? -10.618 16.478 12.780 1.00 85.09 ? 206 ARG B CZ 1 ATOM 1478 N NH1 . ARG A 1 205 ? -10.005 15.452 13.346 1.00 79.58 ? 206 ARG B NH1 1 ATOM 1479 N NH2 . ARG A 1 205 ? -10.824 17.581 13.476 1.00 80.12 ? 206 ARG B NH2 1 ATOM 1480 N N . LEU A 1 206 ? -14.452 19.468 11.335 1.00 69.36 ? 207 LEU B N 1 ATOM 1481 C CA . LEU A 1 206 ? -14.733 20.887 11.039 1.00 63.49 ? 207 LEU B CA 1 ATOM 1482 C C . LEU A 1 206 ? -13.493 21.564 10.433 1.00 58.77 ? 207 LEU B C 1 ATOM 1483 O O . LEU A 1 206 ? -12.423 21.583 11.059 1.00 56.45 ? 207 LEU B O 1 ATOM 1484 C CB . LEU A 1 206 ? -15.151 21.568 12.346 1.00 59.74 ? 207 LEU B CB 1 ATOM 1485 C CG . LEU A 1 206 ? -16.149 22.718 12.221 1.00 58.50 ? 207 LEU B CG 1 ATOM 1486 C CD1 . LEU A 1 206 ? -17.321 22.362 11.305 1.00 56.04 ? 207 LEU B CD1 1 ATOM 1487 C CD2 . LEU A 1 206 ? -16.653 23.117 13.602 1.00 59.98 ? 207 LEU B CD2 1 ATOM 1488 N N . THR A 1 207 ? -13.643 22.132 9.226 1.00 53.45 ? 208 THR B N 1 ATOM 1489 C CA . THR A 1 207 ? -12.522 22.807 8.539 1.00 53.50 ? 208 THR B CA 1 ATOM 1490 C C . THR A 1 207 ? -12.931 24.172 7.960 1.00 45.29 ? 208 THR B C 1 ATOM 1491 O O . THR A 1 207 ? -14.028 24.338 7.443 1.00 41.88 ? 208 THR B O 1 ATOM 1492 C CB . THR A 1 207 ? -11.946 21.934 7.420 1.00 54.87 ? 208 THR B CB 1 ATOM 1493 O OG1 . THR A 1 207 ? -12.936 21.880 6.390 1.00 61.54 ? 208 THR B OG1 1 ATOM 1494 C CG2 . THR A 1 207 ? -11.559 20.555 7.900 1.00 53.99 ? 208 THR B CG2 1 ATOM 1495 N N . LEU A 1 208 ? -11.992 25.125 8.010 1.00 42.63 ? 209 LEU B N 1 ATOM 1496 C CA . LEU A 1 208 ? -12.176 26.492 7.486 1.00 43.49 ? 209 LEU B CA 1 ATOM 1497 C C . LEU A 1 208 ? -11.962 26.485 5.974 1.00 40.11 ? 209 LEU B C 1 ATOM 1498 O O . LEU A 1 208 ? -10.832 26.517 5.513 1.00 40.36 ? 209 LEU B O 1 ATOM 1499 C CB . LEU A 1 208 ? -11.174 27.446 8.152 1.00 44.33 ? 209 LEU B CB 1 ATOM 1500 C CG . LEU A 1 208 ? -11.243 28.903 7.690 1.00 45.27 ? 209 LEU B CG 1 ATOM 1501 C CD1 . LEU A 1 208 ? -12.565 29.545 8.105 1.00 46.68 ? 209 LEU B CD1 1 ATOM 1502 C CD2 . LEU A 1 208 ? -10.074 29.715 8.236 1.00 45.59 ? 209 LEU B CD2 1 ATOM 1503 N N . GLN A 1 209 ? -13.060 26.454 5.221 1.00 39.15 ? 210 GLN B N 1 ATOM 1504 C CA . GLN A 1 209 ? -12.992 26.324 3.776 1.00 40.30 ? 210 GLN B CA 1 ATOM 1505 C C . GLN A 1 209 ? -12.778 27.711 3.171 1.00 38.15 ? 210 GLN B C 1 ATOM 1506 O O . GLN A 1 209 ? -12.085 27.824 2.155 1.00 39.52 ? 210 GLN B O 1 ATOM 1507 C CB . GLN A 1 209 ? -14.261 25.674 3.199 1.00 43.08 ? 210 GLN B CB 1 ATOM 1508 C CG . GLN A 1 209 ? -14.393 24.174 3.456 1.00 45.48 ? 210 GLN B CG 1 ATOM 1509 C CD . GLN A 1 209 ? -13.242 23.374 2.895 1.00 50.90 ? 210 GLN B CD 1 ATOM 1510 O OE1 . GLN A 1 209 ? -12.584 22.606 3.598 1.00 51.72 ? 210 GLN B OE1 1 ATOM 1511 N NE2 . GLN A 1 209 ? -13.000 23.538 1.604 1.00 53.93 ? 210 GLN B NE2 1 ATOM 1512 N N . GLY A 1 210 ? -13.364 28.741 3.808 1.00 36.09 ? 211 GLY B N 1 ATOM 1513 C CA . GLY A 1 210 ? -13.453 30.104 3.236 1.00 34.84 ? 211 GLY B CA 1 ATOM 1514 C C . GLY A 1 210 ? -13.280 31.229 4.250 1.00 32.25 ? 211 GLY B C 1 ATOM 1515 O O . GLY A 1 210 ? -13.563 31.073 5.437 1.00 27.75 ? 211 GLY B O 1 ATOM 1516 N N . ILE A 1 211 ? -12.797 32.378 3.746 1.00 34.95 ? 212 ILE B N 1 ATOM 1517 C CA . ILE A 1 211 ? -12.767 33.672 4.469 1.00 33.64 ? 212 ILE B CA 1 ATOM 1518 C C . ILE A 1 211 ? -13.760 34.621 3.798 1.00 32.76 ? 212 ILE B C 1 ATOM 1519 O O . ILE A 1 211 ? -13.683 34.837 2.594 1.00 33.55 ? 212 ILE B O 1 ATOM 1520 C CB . ILE A 1 211 ? -11.360 34.293 4.486 1.00 34.14 ? 212 ILE B CB 1 ATOM 1521 C CG1 . ILE A 1 211 ? -10.343 33.381 5.179 1.00 36.98 ? 212 ILE B CG1 1 ATOM 1522 C CG2 . ILE A 1 211 ? -11.396 35.671 5.129 1.00 34.42 ? 212 ILE B CG2 1 ATOM 1523 C CD1 . ILE A 1 211 ? -8.901 33.664 4.794 1.00 38.72 ? 212 ILE B CD1 1 ATOM 1524 N N . ILE A 1 212 ? -14.675 35.185 4.594 1.00 32.48 ? 213 ILE B N 1 ATOM 1525 C CA . ILE A 1 212 ? -15.686 36.105 4.087 1.00 31.15 ? 213 ILE B CA 1 ATOM 1526 C C . ILE A 1 212 ? -14.938 37.298 3.488 1.00 30.52 ? 213 ILE B C 1 ATOM 1527 O O . ILE A 1 212 ? -14.113 37.926 4.168 1.00 29.57 ? 213 ILE B O 1 ATOM 1528 C CB . ILE A 1 212 ? -16.667 36.522 5.203 1.00 31.24 ? 213 ILE B CB 1 ATOM 1529 C CG1 . ILE A 1 212 ? -17.403 35.314 5.794 1.00 32.12 ? 213 ILE B CG1 1 ATOM 1530 C CG2 . ILE A 1 212 ? -17.647 37.589 4.720 1.00 29.47 ? 213 ILE B CG2 1 ATOM 1531 C CD1 . ILE A 1 212 ? -17.909 35.532 7.209 1.00 33.02 ? 213 ILE B CD1 1 ATOM 1532 N N . SER A 1 213 ? -15.215 37.571 2.215 1.00 29.67 ? 214 SER B N 1 ATOM 1533 C CA . SER A 1 213 ? -14.407 38.459 1.416 1.00 30.85 ? 214 SER B CA 1 ATOM 1534 C C . SER A 1 213 ? -15.274 39.563 0.803 1.00 31.93 ? 214 SER B C 1 ATOM 1535 O O . SER A 1 213 ? -15.298 40.674 1.302 1.00 31.79 ? 214 SER B O 1 ATOM 1536 C CB . SER A 1 213 ? -13.656 37.690 0.376 1.00 31.39 ? 214 SER B CB 1 ATOM 1537 O OG . SER A 1 213 ? -12.901 38.570 -0.440 1.00 33.59 ? 214 SER B OG 1 ATOM 1538 N N . TRP A 1 214 ? -16.003 39.264 -0.272 1.00 34.13 ? 215 TRP B N 1 ATOM 1539 C CA . TRP A 1 214 ? -16.752 40.310 -0.912 1.00 36.82 ? 215 TRP B CA 1 ATOM 1540 C C . TRP A 1 214 ? -18.089 39.803 -1.450 1.00 40.26 ? 215 TRP B C 1 ATOM 1541 O O . TRP A 1 214 ? -18.450 38.645 -1.266 1.00 44.90 ? 215 TRP B O 1 ATOM 1542 C CB . TRP A 1 214 ? -15.900 40.951 -2.001 1.00 35.91 ? 215 TRP B CB 1 ATOM 1543 C CG . TRP A 1 214 ? -15.533 40.042 -3.123 1.00 36.00 ? 215 TRP B CG 1 ATOM 1544 C CD1 . TRP A 1 214 ? -14.477 39.183 -3.180 1.00 37.40 ? 215 TRP B CD1 1 ATOM 1545 C CD2 . TRP A 1 214 ? -16.182 39.964 -4.400 1.00 37.68 ? 215 TRP B CD2 1 ATOM 1546 N NE1 . TRP A 1 214 ? -14.423 38.575 -4.407 1.00 38.87 ? 215 TRP B NE1 1 ATOM 1547 C CE2 . TRP A 1 214 ? -15.458 39.032 -5.175 1.00 38.93 ? 215 TRP B CE2 1 ATOM 1548 C CE3 . TRP A 1 214 ? -17.300 40.585 -4.961 1.00 38.74 ? 215 TRP B CE3 1 ATOM 1549 C CZ2 . TRP A 1 214 ? -15.830 38.699 -6.474 1.00 40.91 ? 215 TRP B CZ2 1 ATOM 1550 C CZ3 . TRP A 1 214 ? -17.669 40.251 -6.244 1.00 39.05 ? 215 TRP B CZ3 1 ATOM 1551 C CH2 . TRP A 1 214 ? -16.948 39.321 -6.988 1.00 38.71 ? 215 TRP B CH2 1 ATOM 1552 N N . GLY A 1 215 ? -18.832 40.721 -2.072 1.00 44.06 ? 216 GLY B N 1 ATOM 1553 C CA . GLY A 1 215 ? -20.070 40.404 -2.757 1.00 47.06 ? 216 GLY B CA 1 ATOM 1554 C C . GLY A 1 215 ? -20.779 41.640 -3.281 1.00 45.95 ? 216 GLY B C 1 ATOM 1555 O O . GLY A 1 215 ? -20.501 42.752 -2.884 1.00 46.66 ? 216 GLY B O 1 ATOM 1556 N N . SER A 1 216 ? -21.730 41.377 -4.173 1.00 49.28 ? 217 SER B N 1 ATOM 1557 C CA . SER A 1 216 ? -22.632 42.406 -4.739 1.00 49.53 ? 217 SER B CA 1 ATOM 1558 C C . SER A 1 216 ? -23.902 42.332 -3.891 1.00 48.24 ? 217 SER B C 1 ATOM 1559 O O . SER A 1 216 ? -24.552 41.280 -3.890 1.00 50.00 ? 217 SER B O 1 ATOM 1560 C CB . SER A 1 216 ? -22.904 42.124 -6.182 1.00 49.72 ? 217 SER B CB 1 ATOM 1561 O OG . SER A 1 216 ? -23.966 42.926 -6.656 1.00 51.28 ? 217 SER B OG 1 ATOM 1562 N N . GLY A 1 217 ? -24.231 43.421 -3.204 1.00 43.60 ? 219 GLY B N 1 ATOM 1563 C CA . GLY A 1 217 ? -25.325 43.432 -2.255 1.00 40.41 ? 219 GLY B CA 1 ATOM 1564 C C . GLY A 1 217 ? -25.102 42.380 -1.190 1.00 39.61 ? 219 GLY B C 1 ATOM 1565 O O . GLY A 1 217 ? -23.993 41.876 -1.040 1.00 37.38 ? 219 GLY B O 1 ATOM 1566 N N . CYS A 1 218 ? -26.168 42.040 -0.461 1.00 40.85 ? 220 CYS B N 1 ATOM 1567 C CA . CYS A 1 218 ? -26.132 40.942 0.493 1.00 39.75 ? 220 CYS B CA 1 ATOM 1568 C C . CYS A 1 218 ? -27.377 40.064 0.329 1.00 41.67 ? 220 CYS B C 1 ATOM 1569 O O . CYS A 1 218 ? -28.483 40.471 0.679 1.00 38.07 ? 220 CYS B O 1 ATOM 1570 C CB . CYS A 1 218 ? -26.043 41.467 1.915 1.00 38.47 ? 220 CYS B CB 1 ATOM 1571 S SG . CYS A 1 218 ? -24.679 42.626 2.150 1.00 35.66 ? 220 CYS B SG 1 ATOM 1572 N N . GLY A 1 219 ? -27.157 38.853 -0.194 1.00 44.08 ? 221 GLY B N 1 ATOM 1573 C CA . GLY A 1 219 ? -28.199 37.895 -0.480 1.00 46.76 ? 221 GLY B CA 1 ATOM 1574 C C . GLY A 1 219 ? -29.150 38.390 -1.558 1.00 48.82 ? 221 GLY B C 1 ATOM 1575 O O . GLY A 1 219 ? -30.352 38.206 -1.448 1.00 50.73 ? 221 GLY B O 1 ATOM 1576 N N . ASP A 1 220 A -28.606 39.014 -2.606 1.00 49.21 ? 221 ASP B N 1 ATOM 1577 C CA . ASP A 1 220 A -29.372 39.337 -3.803 1.00 50.09 ? 221 ASP B CA 1 ATOM 1578 C C . ASP A 1 220 A -29.412 38.106 -4.722 1.00 52.65 ? 221 ASP B C 1 ATOM 1579 O O . ASP A 1 220 A -28.507 37.275 -4.711 1.00 57.21 ? 221 ASP B O 1 ATOM 1580 C CB . ASP A 1 220 A -28.808 40.582 -4.499 1.00 49.75 ? 221 ASP B CB 1 ATOM 1581 C CG . ASP A 1 220 A -29.104 41.879 -3.759 1.00 49.97 ? 221 ASP B CG 1 ATOM 1582 O OD1 . ASP A 1 220 A -30.093 41.920 -3.007 1.00 51.34 ? 221 ASP B OD1 1 ATOM 1583 O OD2 . ASP A 1 220 A -28.343 42.842 -3.935 1.00 51.39 ? 221 ASP B OD2 1 ATOM 1584 N N . ARG A 1 221 ? -30.487 38.008 -5.510 1.00 56.25 ? 222 ARG B N 1 ATOM 1585 C CA . ARG A 1 221 ? -30.681 36.977 -6.538 1.00 56.08 ? 222 ARG B CA 1 ATOM 1586 C C . ARG A 1 221 ? -29.457 36.944 -7.466 1.00 53.39 ? 222 ARG B C 1 ATOM 1587 O O . ARG A 1 221 ? -29.046 37.967 -7.993 1.00 50.59 ? 222 ARG B O 1 ATOM 1588 C CB . ARG A 1 221 ? -31.964 37.273 -7.328 1.00 61.53 ? 222 ARG B CB 1 ATOM 1589 C CG . ARG A 1 221 ? -32.722 36.043 -7.807 1.00 70.87 ? 222 ARG B CG 1 ATOM 1590 C CD . ARG A 1 221 ? -34.025 36.362 -8.536 1.00 76.85 ? 222 ARG B CD 1 ATOM 1591 N NE . ARG A 1 221 ? -33.893 36.468 -9.995 1.00 84.81 ? 222 ARG B NE 1 ATOM 1592 C CZ . ARG A 1 221 ? -33.933 35.444 -10.858 1.00 85.18 ? 222 ARG B CZ 1 ATOM 1593 N NH1 . ARG A 1 221 ? -33.870 35.673 -12.162 1.00 76.83 ? 222 ARG B NH1 1 ATOM 1594 N NH2 . ARG A 1 221 ? -34.028 34.197 -10.421 1.00 78.76 ? 222 ARG B NH2 1 ATOM 1595 N N . ASN A 1 222 ? -28.873 35.752 -7.622 1.00 56.03 ? 223 ASN B N 1 ATOM 1596 C CA . ASN A 1 222 ? -27.757 35.448 -8.545 1.00 58.64 ? 223 ASN B CA 1 ATOM 1597 C C . ASN A 1 222 ? -26.477 36.164 -8.098 1.00 57.16 ? 223 ASN B C 1 ATOM 1598 O O . ASN A 1 222 ? -25.598 36.423 -8.916 1.00 58.27 ? 223 ASN B O 1 ATOM 1599 C CB . ASN A 1 222 ? -28.101 35.764 -10.007 1.00 62.71 ? 223 ASN B CB 1 ATOM 1600 C CG . ASN A 1 222 ? -29.083 34.790 -10.633 1.00 67.21 ? 223 ASN B CG 1 ATOM 1601 O OD1 . ASN A 1 222 ? -29.230 33.646 -10.191 1.00 66.97 ? 223 ASN B OD1 1 ATOM 1602 N ND2 . ASN A 1 222 ? -29.758 35.239 -11.679 1.00 67.12 ? 223 ASN B ND2 1 ATOM 1603 N N . LYS A 1 223 ? -26.372 36.429 -6.789 1.00 58.19 ? 224 LYS B N 1 ATOM 1604 C CA . LYS A 1 223 ? -25.246 37.140 -6.188 1.00 55.30 ? 224 LYS B CA 1 ATOM 1605 C C . LYS A 1 223 ? -24.856 36.449 -4.886 1.00 52.07 ? 224 LYS B C 1 ATOM 1606 O O . LYS A 1 223 ? -25.043 36.984 -3.795 1.00 53.60 ? 224 LYS B O 1 ATOM 1607 C CB . LYS A 1 223 ? -25.601 38.609 -5.936 1.00 57.83 ? 224 LYS B CB 1 ATOM 1608 C CG . LYS A 1 223 ? -25.980 39.421 -7.169 1.00 58.08 ? 224 LYS B CG 1 ATOM 1609 C CD . LYS A 1 223 ? -24.946 39.431 -8.277 1.00 54.44 ? 224 LYS B CD 1 ATOM 1610 C CE . LYS A 1 223 ? -25.343 40.354 -9.408 1.00 54.68 ? 224 LYS B CE 1 ATOM 1611 N NZ . LYS A 1 223 ? -25.060 39.747 -10.726 1.00 55.97 ? 224 LYS B NZ 1 ATOM 1612 N N . PRO A 1 224 ? -24.269 35.239 -4.957 1.00 46.71 ? 225 PRO B N 1 ATOM 1613 C CA . PRO A 1 224 ? -23.786 34.570 -3.755 1.00 46.47 ? 225 PRO B CA 1 ATOM 1614 C C . PRO A 1 224 ? -22.535 35.276 -3.201 1.00 42.43 ? 225 PRO B C 1 ATOM 1615 O O . PRO A 1 224 ? -21.818 35.946 -3.922 1.00 39.59 ? 225 PRO B O 1 ATOM 1616 C CB . PRO A 1 224 ? -23.512 33.144 -4.264 1.00 46.52 ? 225 PRO B CB 1 ATOM 1617 C CG . PRO A 1 224 ? -23.132 33.331 -5.715 1.00 45.25 ? 225 PRO B CG 1 ATOM 1618 C CD . PRO A 1 224 ? -23.996 34.481 -6.187 1.00 46.91 ? 225 PRO B CD 1 ATOM 1619 N N . GLY A 1 225 ? -22.303 35.137 -1.899 1.00 43.42 ? 226 GLY B N 1 ATOM 1620 C CA . GLY A 1 225 ? -21.125 35.689 -1.278 1.00 43.89 ? 226 GLY B CA 1 ATOM 1621 C C . GLY A 1 225 ? -19.868 35.075 -1.874 1.00 45.84 ? 226 GLY B C 1 ATOM 1622 O O . GLY A 1 225 ? -19.848 33.875 -2.213 1.00 46.58 ? 226 GLY B O 1 ATOM 1623 N N . VAL A 1 226 ? -18.825 35.901 -2.035 1.00 40.43 ? 227 VAL B N 1 ATOM 1624 C CA . VAL A 1 226 ? -17.539 35.401 -2.454 1.00 39.16 ? 227 VAL B CA 1 ATOM 1625 C C . VAL A 1 226 ? -16.635 35.364 -1.218 1.00 39.50 ? 227 VAL B C 1 ATOM 1626 O O . VAL A 1 226 ? -16.798 36.176 -0.305 1.00 36.68 ? 227 VAL B O 1 ATOM 1627 C CB . VAL A 1 226 ? -16.934 36.217 -3.610 1.00 36.99 ? 227 VAL B CB 1 ATOM 1628 C CG1 . VAL A 1 226 ? -15.683 35.552 -4.173 1.00 36.22 ? 227 VAL B CG1 1 ATOM 1629 C CG2 . VAL A 1 226 ? -17.957 36.442 -4.709 1.00 37.22 ? 227 VAL B CG2 1 ATOM 1630 N N . TYR A 1 227 ? -15.724 34.378 -1.222 1.00 38.18 ? 228 TYR B N 1 ATOM 1631 C CA . TYR A 1 227 ? -14.897 33.982 -0.109 1.00 34.97 ? 228 TYR B CA 1 ATOM 1632 C C . TYR A 1 227 ? -13.466 33.733 -0.583 1.00 35.66 ? 228 TYR B C 1 ATOM 1633 O O . TYR A 1 227 ? -13.257 33.224 -1.691 1.00 36.33 ? 228 TYR B O 1 ATOM 1634 C CB . TYR A 1 227 ? -15.437 32.677 0.472 1.00 33.60 ? 228 TYR B CB 1 ATOM 1635 C CG . TYR A 1 227 ? -16.792 32.823 1.105 1.00 32.18 ? 228 TYR B CG 1 ATOM 1636 C CD1 . TYR A 1 227 ? -17.935 32.968 0.333 1.00 32.63 ? 228 TYR B CD1 1 ATOM 1637 C CD2 . TYR A 1 227 ? -16.927 32.839 2.483 1.00 30.17 ? 228 TYR B CD2 1 ATOM 1638 C CE1 . TYR A 1 227 ? -19.185 33.120 0.921 1.00 32.96 ? 228 TYR B CE1 1 ATOM 1639 C CE2 . TYR A 1 227 ? -18.163 32.994 3.084 1.00 30.20 ? 228 TYR B CE2 1 ATOM 1640 C CZ . TYR A 1 227 ? -19.298 33.136 2.303 1.00 31.19 ? 228 TYR B CZ 1 ATOM 1641 O OH . TYR A 1 227 ? -20.513 33.271 2.906 1.00 28.99 ? 228 TYR B OH 1 ATOM 1642 N N . THR A 1 228 ? -12.484 34.042 0.268 1.00 33.86 ? 229 THR B N 1 ATOM 1643 C CA . THR A 1 228 ? -11.142 33.572 0.004 1.00 33.89 ? 229 THR B CA 1 ATOM 1644 C C . THR A 1 228 ? -11.109 32.055 0.232 1.00 34.74 ? 229 THR B C 1 ATOM 1645 O O . THR A 1 228 ? -11.496 31.566 1.286 1.00 34.77 ? 229 THR B O 1 ATOM 1646 C CB . THR A 1 228 ? -10.104 34.336 0.826 1.00 32.99 ? 229 THR B CB 1 ATOM 1647 O OG1 . THR A 1 228 ? -10.337 35.716 0.548 1.00 32.31 ? 229 THR B OG1 1 ATOM 1648 C CG2 . THR A 1 228 ? -8.681 33.951 0.478 1.00 32.63 ? 229 THR B CG2 1 ATOM 1649 N N . ASP A 1 229 ? -10.665 31.340 -0.805 1.00 35.08 ? 230 ASP B N 1 ATOM 1650 C CA . ASP A 1 229 ? -10.517 29.896 -0.841 1.00 34.72 ? 230 ASP B CA 1 ATOM 1651 C C . ASP A 1 229 ? -9.299 29.491 -0.010 1.00 30.61 ? 230 ASP B C 1 ATOM 1652 O O . ASP A 1 229 ? -8.199 29.470 -0.500 1.00 29.53 ? 230 ASP B O 1 ATOM 1653 C CB . ASP A 1 229 ? -10.357 29.442 -2.296 1.00 37.96 ? 230 ASP B CB 1 ATOM 1654 C CG . ASP A 1 229 ? -10.159 27.949 -2.501 1.00 39.75 ? 230 ASP B CG 1 ATOM 1655 O OD1 . ASP A 1 229 ? -9.877 27.224 -1.503 1.00 38.34 ? 230 ASP B OD1 1 ATOM 1656 O OD2 . ASP A 1 229 ? -10.278 27.525 -3.666 1.00 40.44 ? 230 ASP B OD2 1 ATOM 1657 N N . VAL A 1 230 ? -9.523 29.130 1.247 1.00 31.11 ? 231 VAL B N 1 ATOM 1658 C CA . VAL A 1 230 ? -8.433 28.931 2.207 1.00 32.84 ? 231 VAL B CA 1 ATOM 1659 C C . VAL A 1 230 ? -7.453 27.883 1.674 1.00 35.06 ? 231 VAL B C 1 ATOM 1660 O O . VAL A 1 230 ? -6.253 28.058 1.763 1.00 39.72 ? 231 VAL B O 1 ATOM 1661 C CB . VAL A 1 230 ? -8.972 28.524 3.591 1.00 31.92 ? 231 VAL B CB 1 ATOM 1662 C CG1 . VAL A 1 230 ? -7.854 28.132 4.546 1.00 31.93 ? 231 VAL B CG1 1 ATOM 1663 C CG2 . VAL A 1 230 ? -9.830 29.622 4.196 1.00 32.22 ? 231 VAL B CG2 1 ATOM 1664 N N . ALA A 1 231 ? -7.994 26.784 1.141 1.00 39.55 ? 232 ALA B N 1 ATOM 1665 C CA . ALA A 1 231 ? -7.215 25.621 0.700 1.00 39.16 ? 232 ALA B CA 1 ATOM 1666 C C . ALA A 1 231 ? -6.158 26.040 -0.325 1.00 36.93 ? 232 ALA B C 1 ATOM 1667 O O . ALA A 1 231 ? -5.061 25.497 -0.336 1.00 36.44 ? 232 ALA B O 1 ATOM 1668 C CB . ALA A 1 231 ? -8.146 24.589 0.121 1.00 40.46 ? 232 ALA B CB 1 ATOM 1669 N N . TYR A 1 232 ? -6.517 27.019 -1.163 1.00 35.34 ? 233 TYR B N 1 ATOM 1670 C CA . TYR A 1 232 ? -5.652 27.587 -2.198 1.00 35.16 ? 233 TYR B CA 1 ATOM 1671 C C . TYR A 1 232 ? -4.372 28.197 -1.608 1.00 35.59 ? 233 TYR B C 1 ATOM 1672 O O . TYR A 1 232 ? -3.440 28.426 -2.342 1.00 37.35 ? 233 TYR B O 1 ATOM 1673 C CB . TYR A 1 232 ? -6.405 28.676 -2.964 1.00 35.70 ? 233 TYR B CB 1 ATOM 1674 C CG . TYR A 1 232 ? -5.750 29.114 -4.243 1.00 36.47 ? 233 TYR B CG 1 ATOM 1675 C CD1 . TYR A 1 232 ? -5.981 28.420 -5.412 1.00 39.16 ? 233 TYR B CD1 1 ATOM 1676 C CD2 . TYR A 1 232 ? -4.930 30.227 -4.303 1.00 38.45 ? 233 TYR B CD2 1 ATOM 1677 C CE1 . TYR A 1 232 ? -5.387 28.787 -6.604 1.00 37.88 ? 233 TYR B CE1 1 ATOM 1678 C CE2 . TYR A 1 232 ? -4.332 30.618 -5.490 1.00 37.87 ? 233 TYR B CE2 1 ATOM 1679 C CZ . TYR A 1 232 ? -4.559 29.883 -6.638 1.00 38.18 ? 233 TYR B CZ 1 ATOM 1680 O OH . TYR A 1 232 ? -4.019 30.213 -7.833 1.00 42.09 ? 233 TYR B OH 1 ATOM 1681 N N . TYR A 1 233 ? -4.344 28.503 -0.306 1.00 33.32 ? 234 TYR B N 1 ATOM 1682 C CA . TYR A 1 233 ? -3.324 29.366 0.242 1.00 32.34 ? 234 TYR B CA 1 ATOM 1683 C C . TYR A 1 233 ? -2.557 28.642 1.343 1.00 33.76 ? 234 TYR B C 1 ATOM 1684 O O . TYR A 1 233 ? -1.767 29.264 2.058 1.00 35.83 ? 234 TYR B O 1 ATOM 1685 C CB . TYR A 1 233 ? -3.962 30.665 0.742 1.00 33.04 ? 234 TYR B CB 1 ATOM 1686 C CG . TYR A 1 233 ? -4.487 31.552 -0.358 1.00 31.19 ? 234 TYR B CG 1 ATOM 1687 C CD1 . TYR A 1 233 ? -3.636 32.359 -1.084 1.00 30.54 ? 234 TYR B CD1 1 ATOM 1688 C CD2 . TYR A 1 233 ? -5.827 31.564 -0.698 1.00 31.19 ? 234 TYR B CD2 1 ATOM 1689 C CE1 . TYR A 1 233 ? -4.099 33.168 -2.107 1.00 30.71 ? 234 TYR B CE1 1 ATOM 1690 C CE2 . TYR A 1 233 ? -6.311 32.363 -1.723 1.00 30.53 ? 234 TYR B CE2 1 ATOM 1691 C CZ . TYR A 1 233 ? -5.443 33.172 -2.430 1.00 30.91 ? 234 TYR B CZ 1 ATOM 1692 O OH . TYR A 1 233 ? -5.887 33.981 -3.439 1.00 31.67 ? 234 TYR B OH 1 ATOM 1693 N N . LEU A 1 234 ? -2.731 27.319 1.422 1.00 35.90 ? 235 LEU B N 1 ATOM 1694 C CA . LEU A 1 234 ? -2.089 26.501 2.467 1.00 36.00 ? 235 LEU B CA 1 ATOM 1695 C C . LEU A 1 234 ? -0.568 26.699 2.473 1.00 34.22 ? 235 LEU B C 1 ATOM 1696 O O . LEU A 1 234 ? 0.023 26.831 3.548 1.00 33.94 ? 235 LEU B O 1 ATOM 1697 C CB . LEU A 1 234 ? -2.466 25.031 2.267 1.00 36.88 ? 235 LEU B CB 1 ATOM 1698 C CG . LEU A 1 234 ? -3.921 24.700 2.597 1.00 41.01 ? 235 LEU B CG 1 ATOM 1699 C CD1 . LEU A 1 234 ? -4.301 23.347 2.027 1.00 43.09 ? 235 LEU B CD1 1 ATOM 1700 C CD2 . LEU A 1 234 ? -4.173 24.738 4.099 1.00 41.81 ? 235 LEU B CD2 1 ATOM 1701 N N . ALA A 1 235 ? 0.051 26.715 1.284 1.00 33.16 ? 236 ALA B N 1 ATOM 1702 C CA . ALA A 1 235 ? 1.499 26.927 1.165 1.00 35.78 ? 236 ALA B CA 1 ATOM 1703 C C . ALA A 1 235 ? 1.857 28.346 1.638 1.00 37.27 ? 236 ALA B C 1 ATOM 1704 O O . ALA A 1 235 ? 2.794 28.531 2.438 1.00 36.91 ? 236 ALA B O 1 ATOM 1705 C CB . ALA A 1 235 ? 1.965 26.677 -0.257 1.00 34.25 ? 236 ALA B CB 1 ATOM 1706 N N . TRP A 1 236 ? 1.106 29.342 1.146 1.00 35.32 ? 237 TRP B N 1 ATOM 1707 C CA . TRP A 1 236 ? 1.328 30.706 1.540 1.00 35.16 ? 237 TRP B CA 1 ATOM 1708 C C . TRP A 1 236 ? 1.300 30.790 3.069 1.00 34.42 ? 237 TRP B C 1 ATOM 1709 O O . TRP A 1 236 ? 2.158 31.386 3.676 1.00 32.94 ? 237 TRP B O 1 ATOM 1710 C CB . TRP A 1 236 ? 0.312 31.653 0.897 1.00 36.44 ? 237 TRP B CB 1 ATOM 1711 C CG . TRP A 1 236 ? 0.631 33.088 1.179 1.00 36.29 ? 237 TRP B CG 1 ATOM 1712 C CD1 . TRP A 1 236 ? 1.458 33.903 0.468 1.00 35.51 ? 237 TRP B CD1 1 ATOM 1713 C CD2 . TRP A 1 236 ? 0.157 33.865 2.296 1.00 38.95 ? 237 TRP B CD2 1 ATOM 1714 N NE1 . TRP A 1 236 ? 1.518 35.139 1.050 1.00 35.85 ? 237 TRP B NE1 1 ATOM 1715 C CE2 . TRP A 1 236 ? 0.738 35.145 2.178 1.00 38.64 ? 237 TRP B CE2 1 ATOM 1716 C CE3 . TRP A 1 236 ? -0.701 33.609 3.379 1.00 39.98 ? 237 TRP B CE3 1 ATOM 1717 C CZ2 . TRP A 1 236 ? 0.482 36.157 3.107 1.00 39.96 ? 237 TRP B CZ2 1 ATOM 1718 C CZ3 . TRP A 1 236 ? -0.956 34.611 4.290 1.00 38.99 ? 237 TRP B CZ3 1 ATOM 1719 C CH2 . TRP A 1 236 ? -0.372 35.870 4.151 1.00 39.51 ? 237 TRP B CH2 1 ATOM 1720 N N . ILE A 1 237 ? 0.314 30.140 3.678 1.00 36.41 ? 238 ILE B N 1 ATOM 1721 C CA . ILE A 1 237 ? 0.140 30.183 5.116 1.00 38.87 ? 238 ILE B CA 1 ATOM 1722 C C . ILE A 1 237 ? 1.347 29.544 5.829 1.00 42.82 ? 238 ILE B C 1 ATOM 1723 O O . ILE A 1 237 ? 1.850 30.126 6.791 1.00 41.32 ? 238 ILE B O 1 ATOM 1724 C CB . ILE A 1 237 ? -1.197 29.529 5.513 1.00 36.58 ? 238 ILE B CB 1 ATOM 1725 C CG1 . ILE A 1 237 ? -2.378 30.304 4.933 1.00 35.63 ? 238 ILE B CG1 1 ATOM 1726 C CG2 . ILE A 1 237 ? -1.310 29.404 7.028 1.00 37.87 ? 238 ILE B CG2 1 ATOM 1727 C CD1 . ILE A 1 237 ? -3.694 29.593 5.059 1.00 36.96 ? 238 ILE B CD1 1 ATOM 1728 N N . ARG A 1 238 ? 1.786 28.358 5.373 1.00 47.58 ? 239 ARG B N 1 ATOM 1729 C CA . ARG A 1 238 ? 2.946 27.648 5.950 1.00 51.20 ? 239 ARG B CA 1 ATOM 1730 C C . ARG A 1 238 ? 4.192 28.550 5.925 1.00 49.49 ? 239 ARG B C 1 ATOM 1731 O O . ARG A 1 238 ? 4.869 28.728 6.935 1.00 43.18 ? 239 ARG B O 1 ATOM 1732 C CB . ARG A 1 238 ? 3.252 26.351 5.190 1.00 58.06 ? 239 ARG B CB 1 ATOM 1733 C CG . ARG A 1 238 ? 2.406 25.152 5.592 1.00 67.45 ? 239 ARG B CG 1 ATOM 1734 C CD . ARG A 1 238 ? 3.030 23.832 5.163 1.00 74.03 ? 239 ARG B CD 1 ATOM 1735 N NE . ARG A 1 238 ? 2.345 22.686 5.763 1.00 83.03 ? 239 ARG B NE 1 ATOM 1736 C CZ . ARG A 1 238 ? 2.876 21.471 5.915 1.00 83.79 ? 239 ARG B CZ 1 ATOM 1737 N NH1 . ARG A 1 238 ? 2.211 20.532 6.569 1.00 75.99 ? 239 ARG B NH1 1 ATOM 1738 N NH2 . ARG A 1 238 ? 4.070 21.197 5.416 1.00 81.74 ? 239 ARG B NH2 1 ATOM 1739 N N . GLU A 1 239 ? 4.491 29.125 4.757 1.00 51.58 ? 240 GLU B N 1 ATOM 1740 C CA . GLU A 1 239 ? 5.756 29.812 4.545 1.00 53.93 ? 240 GLU B CA 1 ATOM 1741 C C . GLU A 1 239 ? 5.744 31.200 5.219 1.00 51.03 ? 240 GLU B C 1 ATOM 1742 O O . GLU A 1 239 ? 6.787 31.840 5.318 1.00 52.21 ? 240 GLU B O 1 ATOM 1743 C CB . GLU A 1 239 ? 6.078 29.853 3.049 1.00 58.57 ? 240 GLU B CB 1 ATOM 1744 C CG . GLU A 1 239 ? 5.409 30.986 2.304 1.00 66.84 ? 240 GLU B CG 1 ATOM 1745 C CD . GLU A 1 239 ? 5.539 30.921 0.792 1.00 77.41 ? 240 GLU B CD 1 ATOM 1746 O OE1 . GLU A 1 239 ? 5.294 29.828 0.229 1.00 84.73 ? 240 GLU B OE1 1 ATOM 1747 O OE2 . GLU A 1 239 ? 5.873 31.969 0.178 1.00 78.25 ? 240 GLU B OE2 1 ATOM 1748 N N . HIS A 1 240 ? 4.583 31.650 5.713 1.00 48.67 ? 241 HIS B N 1 ATOM 1749 C CA . HIS A 1 240 ? 4.465 32.935 6.418 1.00 44.77 ? 241 HIS B CA 1 ATOM 1750 C C . HIS A 1 240 ? 4.234 32.736 7.920 1.00 41.57 ? 241 HIS B C 1 ATOM 1751 O O . HIS A 1 240 ? 3.624 33.569 8.551 1.00 37.61 ? 241 HIS B O 1 ATOM 1752 C CB . HIS A 1 240 ? 3.355 33.785 5.790 1.00 44.58 ? 241 HIS B CB 1 ATOM 1753 C CG . HIS A 1 240 ? 3.774 34.411 4.507 1.00 44.51 ? 241 HIS B CG 1 ATOM 1754 N ND1 . HIS A 1 240 ? 3.946 33.670 3.357 1.00 44.13 ? 241 HIS B ND1 1 ATOM 1755 C CD2 . HIS A 1 240 ? 4.069 35.691 4.193 1.00 45.82 ? 241 HIS B CD2 1 ATOM 1756 C CE1 . HIS A 1 240 ? 4.337 34.468 2.383 1.00 47.29 ? 241 HIS B CE1 1 ATOM 1757 N NE2 . HIS A 1 240 ? 4.424 35.715 2.873 1.00 46.66 ? 241 HIS B NE2 1 ATOM 1758 N N . THR A 1 241 ? 4.773 31.661 8.498 1.00 43.64 ? 242 THR B N 1 ATOM 1759 C CA . THR A 1 241 ? 4.669 31.444 9.943 1.00 46.43 ? 242 THR B CA 1 ATOM 1760 C C . THR A 1 241 ? 5.990 31.828 10.630 1.00 48.82 ? 242 THR B C 1 ATOM 1761 O O . THR A 1 241 ? 6.423 31.176 11.591 1.00 51.47 ? 242 THR B O 1 ATOM 1762 C CB . THR A 1 241 ? 4.237 30.006 10.263 1.00 43.33 ? 242 THR B CB 1 ATOM 1763 O OG1 . THR A 1 241 ? 5.322 29.142 9.942 1.00 43.00 ? 242 THR B OG1 1 ATOM 1764 C CG2 . THR A 1 241 ? 3.004 29.569 9.506 1.00 42.95 ? 242 THR B CG2 1 ATOM 1765 N N . VAL A 1 242 ? 6.622 32.904 10.148 1.00 51.84 ? 243 VAL B N 1 ATOM 1766 C CA . VAL A 1 242 ? 7.801 33.465 10.800 1.00 52.33 ? 243 VAL B CA 1 ATOM 1767 C C . VAL A 1 242 ? 7.280 34.443 11.855 1.00 51.66 ? 243 VAL B C 1 ATOM 1768 O O . VAL A 1 242 ? 6.194 34.999 11.704 1.00 50.65 ? 243 VAL B O 1 ATOM 1769 C CB . VAL A 1 242 ? 8.772 34.142 9.812 1.00 52.39 ? 243 VAL B CB 1 ATOM 1770 C CG1 . VAL A 1 242 ? 8.895 33.371 8.504 1.00 54.70 ? 243 VAL B CG1 1 ATOM 1771 C CG2 . VAL A 1 242 ? 8.387 35.584 9.534 1.00 54.99 ? 243 VAL B CG2 1 ATOM 1772 N N . SER A 1 243 ? 8.045 34.623 12.932 1.00 49.32 ? 244 SER B N 1 ATOM 1773 C CA . SER A 1 243 ? 7.595 35.439 14.016 1.00 46.11 ? 244 SER B CA 1 ATOM 1774 C C . SER A 1 243 ? 8.767 35.957 14.841 1.00 40.77 ? 244 SER B C 1 ATOM 1775 O O . SER A 1 243 ? 9.786 35.335 14.979 1.00 44.60 ? 244 SER B O 1 ATOM 1776 C CB . SER A 1 243 ? 6.633 34.691 14.898 1.00 50.81 ? 244 SER B CB 1 ATOM 1777 O OG . SER A 1 243 ? 6.064 35.571 15.860 1.00 56.63 ? 244 SER B OG 1 ATOM 1778 N N . THR A 1 244 ? 8.450 37.075 15.493 1.00 38.80 ? 245 THR B N 1 ATOM 1779 C CA . THR A 1 244 ? 9.328 37.694 16.508 1.00 34.51 ? 245 THR B CA 1 ATOM 1780 C C . THR A 1 244 ? 9.317 36.753 17.717 1.00 33.30 ? 245 THR B C 1 ATOM 1781 O O . THR A 1 244 ? 8.507 35.828 17.783 1.00 31.10 ? 245 THR B O 1 ATOM 1782 C CB . THR A 1 244 ? 8.956 39.138 16.858 1.00 34.87 ? 245 THR B CB 1 ATOM 1783 O OG1 . THR A 1 244 ? 7.626 39.187 17.365 1.00 29.68 ? 245 THR B OG1 1 ATOM 1784 C CG2 . THR A 1 244 ? 9.120 40.104 15.713 1.00 36.49 ? 245 THR B CG2 1 ATOM 1785 N N . ARG A 1 245 ? 10.212 36.989 18.650 1.00 33.78 ? 246 ARG B N 1 ATOM 1786 C CA . ARG A 1 245 ? 10.460 35.995 19.748 1.00 34.64 ? 246 ARG B CA 1 ATOM 1787 C C . ARG A 1 245 ? 10.280 36.608 21.145 1.00 33.24 ? 246 ARG B C 1 ATOM 1788 O O . ARG A 1 245 ? 10.790 35.990 22.109 1.00 28.12 ? 246 ARG B O 1 ATOM 1789 C CB . ARG A 1 245 ? 11.867 35.390 19.639 1.00 35.74 ? 246 ARG B CB 1 ATOM 1790 C CG . ARG A 1 245 ? 12.041 34.464 18.448 1.00 36.15 ? 246 ARG B CG 1 ATOM 1791 C CD . ARG A 1 245 ? 13.363 33.739 18.419 1.00 36.51 ? 246 ARG B CD 1 ATOM 1792 N NE . ARG A 1 245 ? 13.342 32.718 17.382 1.00 38.68 ? 246 ARG B NE 1 ATOM 1793 C CZ . ARG A 1 245 ? 14.333 31.876 17.131 1.00 37.78 ? 246 ARG B CZ 1 ATOM 1794 N NH1 . ARG A 1 245 ? 14.177 30.925 16.226 1.00 37.62 ? 246 ARG B NH1 1 ATOM 1795 N NH2 . ARG A 1 245 ? 15.470 31.984 17.794 1.00 38.50 ? 246 ARG B NH2 1 HETATM 1796 C C1 . NAG B 2 . ? -14.323 47.341 22.045 1.00 41.33 ? 1 NAG A C1 1 HETATM 1797 C C2 . NAG B 2 . ? -13.292 46.350 22.591 1.00 40.35 ? 1 NAG A C2 1 HETATM 1798 C C3 . NAG B 2 . ? -12.104 47.080 23.192 1.00 43.86 ? 1 NAG A C3 1 HETATM 1799 C C4 . NAG B 2 . ? -11.464 48.147 22.277 1.00 45.62 ? 1 NAG A C4 1 HETATM 1800 C C5 . NAG B 2 . ? -12.581 48.974 21.590 1.00 44.67 ? 1 NAG A C5 1 HETATM 1801 C C6 . NAG B 2 . ? -12.056 49.864 20.453 1.00 44.76 ? 1 NAG A C6 1 HETATM 1802 C C7 . NAG B 2 . ? -14.353 44.357 23.543 1.00 37.34 ? 1 NAG A C7 1 HETATM 1803 C C8 . NAG B 2 . ? -14.840 43.702 24.816 1.00 37.07 ? 1 NAG A C8 1 HETATM 1804 N N2 . NAG B 2 . ? -13.799 45.552 23.680 1.00 38.64 ? 1 NAG A N2 1 HETATM 1805 O O3 . NAG B 2 . ? -11.175 46.059 23.575 1.00 44.39 ? 1 NAG A O3 1 HETATM 1806 O O4 . NAG B 2 . ? -10.580 49.011 23.064 1.00 45.07 ? 1 NAG A O4 1 HETATM 1807 O O5 . NAG B 2 . ? -13.640 48.140 21.072 1.00 43.00 ? 1 NAG A O5 1 HETATM 1808 O O6 . NAG B 2 . ? -12.919 51.004 20.258 1.00 43.19 ? 1 NAG A O6 1 HETATM 1809 O O7 . NAG B 2 . ? -14.454 43.832 22.458 1.00 37.65 ? 1 NAG A O7 1 HETATM 1810 C C1 . NAG B 2 . ? -9.239 48.501 23.363 1.00 51.86 ? 2 NAG A C1 1 HETATM 1811 C C2 . NAG B 2 . ? -8.236 49.674 23.310 1.00 56.94 ? 2 NAG A C2 1 HETATM 1812 C C3 . NAG B 2 . ? -6.825 49.307 23.804 1.00 57.20 ? 2 NAG A C3 1 HETATM 1813 C C4 . NAG B 2 . ? -6.817 48.629 25.169 1.00 56.10 ? 2 NAG A C4 1 HETATM 1814 C C5 . NAG B 2 . ? -7.874 47.508 25.204 1.00 53.04 ? 2 NAG A C5 1 HETATM 1815 C C6 . NAG B 2 . ? -8.176 47.167 26.658 1.00 52.21 ? 2 NAG A C6 1 HETATM 1816 C C7 . NAG B 2 . ? -8.721 51.345 21.527 1.00 58.56 ? 2 NAG A C7 1 HETATM 1817 C C8 . NAG B 2 . ? -8.662 51.628 20.046 1.00 58.40 ? 2 NAG A C8 1 HETATM 1818 N N2 . NAG B 2 . ? -8.167 50.191 21.937 1.00 59.09 ? 2 NAG A N2 1 HETATM 1819 O O3 . NAG B 2 . ? -6.037 50.498 23.900 1.00 56.65 ? 2 NAG A O3 1 HETATM 1820 O O4 . NAG B 2 . ? -5.522 48.036 25.411 1.00 61.29 ? 2 NAG A O4 1 HETATM 1821 O O5 . NAG B 2 . ? -9.158 47.779 24.604 1.00 49.02 ? 2 NAG A O5 1 HETATM 1822 O O6 . NAG B 2 . ? -8.558 45.795 26.701 1.00 50.60 ? 2 NAG A O6 1 HETATM 1823 O O7 . NAG B 2 . ? -9.270 52.117 22.292 1.00 55.75 ? 2 NAG A O7 1 HETATM 1824 C C1 . MAN B 2 . ? -4.461 48.592 26.256 1.00 64.82 ? 3 MAN A C1 1 HETATM 1825 C C2 . MAN B 2 . ? -3.768 47.351 26.875 1.00 66.04 ? 3 MAN A C2 1 HETATM 1826 C C3 . MAN B 2 . ? -3.738 47.305 28.417 1.00 64.70 ? 3 MAN A C3 1 HETATM 1827 C C4 . MAN B 2 . ? -3.155 48.614 28.982 1.00 64.63 ? 3 MAN A C4 1 HETATM 1828 C C5 . MAN B 2 . ? -3.765 49.860 28.297 1.00 66.00 ? 3 MAN A C5 1 HETATM 1829 C C6 . MAN B 2 . ? -2.630 50.735 27.757 1.00 65.21 ? 3 MAN A C6 1 HETATM 1830 O O2 . MAN B 2 . ? -2.425 47.287 26.361 1.00 67.44 ? 3 MAN A O2 1 HETATM 1831 O O3 . MAN B 2 . ? -2.986 46.154 28.874 1.00 57.30 ? 3 MAN A O3 1 HETATM 1832 O O4 . MAN B 2 . ? -3.311 48.691 30.420 1.00 60.94 ? 3 MAN A O4 1 HETATM 1833 O O5 . MAN B 2 . ? -4.772 49.572 27.264 1.00 67.12 ? 3 MAN A O5 1 HETATM 1834 O O6 . MAN B 2 . ? -3.103 52.051 27.451 1.00 64.95 ? 3 MAN A O6 1 HETATM 1835 C C1 . GOL C 3 . ? -9.106 51.197 -7.959 1.00 57.75 ? 304 GOL B C1 1 HETATM 1836 O O1 . GOL C 3 . ? -8.590 51.481 -9.285 1.00 55.23 ? 304 GOL B O1 1 HETATM 1837 C C2 . GOL C 3 . ? -8.029 50.766 -6.932 1.00 61.16 ? 304 GOL B C2 1 HETATM 1838 O O2 . GOL C 3 . ? -6.794 51.521 -7.024 1.00 63.48 ? 304 GOL B O2 1 HETATM 1839 C C3 . GOL C 3 . ? -8.476 50.870 -5.464 1.00 61.52 ? 304 GOL B C3 1 HETATM 1840 O O3 . GOL C 3 . ? -9.847 50.534 -5.209 1.00 59.53 ? 304 GOL B O3 1 HETATM 1841 S S . SO4 D 4 . ? -28.840 41.906 17.349 1.00 74.05 ? 305 SO4 B S 1 HETATM 1842 O O1 . SO4 D 4 . ? -29.840 40.815 17.246 1.00 83.35 ? 305 SO4 B O1 1 HETATM 1843 O O2 . SO4 D 4 . ? -28.913 42.838 16.179 1.00 65.26 ? 305 SO4 B O2 1 HETATM 1844 O O3 . SO4 D 4 . ? -29.043 42.644 18.620 1.00 72.90 ? 305 SO4 B O3 1 HETATM 1845 O O4 . SO4 D 4 . ? -27.535 41.221 17.405 1.00 83.59 ? 305 SO4 B O4 1 HETATM 1846 N N . CYS E 5 . ? -5.046 23.309 15.267 1.00 101.56 ? 306 CYS B N 1 HETATM 1847 C CA . CYS E 5 . ? -5.116 21.873 14.887 1.00 101.73 ? 306 CYS B CA 1 HETATM 1848 C C . CYS E 5 . ? -3.702 21.285 14.854 1.00 105.23 ? 306 CYS B C 1 HETATM 1849 O O . CYS E 5 . ? -3.382 20.620 13.849 1.00 92.26 ? 306 CYS B O 1 HETATM 1850 C CB . CYS E 5 . ? -5.767 21.691 13.523 1.00 30.00 ? 306 CYS B CB 1 HETATM 1851 S SG . CYS E 5 . ? -7.566 21.864 13.544 1.00 30.00 ? 306 CYS B SG 1 HETATM 1852 O O . HOH F 6 . ? -13.109 52.950 18.975 1.00 40.63 ? 401 HOH B O 1 HETATM 1853 O O . HOH F 6 . ? -26.264 25.857 -10.140 1.00 52.04 ? 402 HOH B O 1 HETATM 1854 O O . HOH F 6 . ? -13.815 32.523 19.346 1.00 29.38 ? 403 HOH B O 1 HETATM 1855 O O . HOH F 6 . ? -22.591 33.501 1.611 1.00 42.02 ? 404 HOH B O 1 HETATM 1856 O O . HOH F 6 . ? -32.238 32.559 -9.952 1.00 50.29 ? 405 HOH B O 1 HETATM 1857 O O . HOH F 6 . ? 3.543 36.403 -2.169 1.00 36.82 ? 406 HOH B O 1 HETATM 1858 O O . HOH F 6 . ? -1.865 44.451 19.778 1.00 14.83 ? 407 HOH B O 1 HETATM 1859 O O . HOH F 6 . ? -25.847 39.413 -2.801 1.00 45.78 ? 408 HOH B O 1 HETATM 1860 O O . HOH F 6 . ? -11.327 33.510 8.463 1.00 35.06 ? 409 HOH B O 1 HETATM 1861 O O . HOH F 6 . ? -28.932 37.193 10.609 1.00 31.90 ? 410 HOH B O 1 HETATM 1862 O O . HOH F 6 . ? -11.469 37.843 -2.925 1.00 24.93 ? 411 HOH B O 1 HETATM 1863 O O . HOH F 6 . ? -11.095 22.819 0.054 1.00 38.03 ? 412 HOH B O 1 HETATM 1864 O O . HOH F 6 . ? -4.469 50.890 -6.100 1.00 37.45 ? 413 HOH B O 1 HETATM 1865 O O . HOH F 6 . ? -19.900 25.735 13.994 1.00 40.80 ? 414 HOH B O 1 HETATM 1866 O O . HOH F 6 . ? -26.860 33.549 22.382 1.00 29.11 ? 415 HOH B O 1 HETATM 1867 O O . HOH F 6 . ? -22.143 22.661 0.578 1.00 52.59 ? 416 HOH B O 1 HETATM 1868 O O . HOH F 6 . ? -1.610 38.970 24.322 1.00 24.40 ? 417 HOH B O 1 HETATM 1869 O O . HOH F 6 . ? -9.942 53.646 12.740 1.00 47.62 ? 418 HOH B O 1 HETATM 1870 O O . HOH F 6 . ? -7.480 48.272 20.232 1.00 25.16 ? 419 HOH B O 1 HETATM 1871 O O . HOH F 6 . ? 5.158 47.799 15.848 1.00 29.53 ? 420 HOH B O 1 HETATM 1872 O O . HOH F 6 . ? -27.764 44.529 11.252 1.00 36.79 ? 421 HOH B O 1 HETATM 1873 O O . HOH F 6 . ? -24.252 46.637 3.948 1.00 30.96 ? 422 HOH B O 1 HETATM 1874 O O . HOH F 6 . ? -23.010 45.180 20.428 1.00 31.87 ? 423 HOH B O 1 HETATM 1875 O O . HOH F 6 . ? -22.538 38.503 -3.552 1.00 41.54 ? 424 HOH B O 1 HETATM 1876 O O . HOH F 6 . ? -19.331 31.352 18.984 1.00 36.80 ? 425 HOH B O 1 HETATM 1877 O O . HOH F 6 . ? -10.718 25.850 0.678 1.00 27.20 ? 426 HOH B O 1 HETATM 1878 O O . HOH F 6 . ? -17.445 46.529 28.449 1.00 45.03 ? 427 HOH B O 1 HETATM 1879 O O . HOH F 6 . ? -5.981 34.563 27.159 1.00 30.69 ? 428 HOH B O 1 HETATM 1880 O O . HOH F 6 . ? -12.762 50.020 17.280 1.00 37.18 ? 429 HOH B O 1 HETATM 1881 O O . HOH F 6 . ? -24.324 39.577 11.424 1.00 32.90 ? 430 HOH B O 1 HETATM 1882 O O . HOH F 6 . ? -17.502 37.274 10.635 1.00 19.95 ? 431 HOH B O 1 HETATM 1883 O O . HOH F 6 . ? 6.336 41.549 18.105 1.00 20.51 ? 432 HOH B O 1 HETATM 1884 O O . HOH F 6 . ? -18.871 36.683 1.500 1.00 22.66 ? 433 HOH B O 1 HETATM 1885 O O . HOH F 6 . ? -18.225 39.496 12.059 1.00 20.40 ? 434 HOH B O 1 HETATM 1886 O O . HOH F 6 . ? -9.861 28.846 -6.128 1.00 39.25 ? 435 HOH B O 1 HETATM 1887 O O . HOH F 6 . ? -8.260 35.091 -4.501 1.00 44.53 ? 436 HOH B O 1 HETATM 1888 O O . HOH F 6 . ? 4.800 30.807 16.155 1.00 28.89 ? 437 HOH B O 1 HETATM 1889 O O . HOH F 6 . ? -26.311 28.317 17.619 1.00 31.18 ? 438 HOH B O 1 HETATM 1890 O O . HOH F 6 . ? -24.697 35.297 19.458 1.00 32.71 ? 439 HOH B O 1 HETATM 1891 O O . HOH F 6 . ? -20.468 40.579 -9.536 1.00 38.89 ? 440 HOH B O 1 HETATM 1892 O O . HOH F 6 . ? -16.812 47.190 26.000 1.00 39.88 ? 441 HOH B O 1 HETATM 1893 O O . HOH F 6 . ? -16.353 28.133 -6.151 1.00 52.84 ? 442 HOH B O 1 HETATM 1894 O O . HOH F 6 . ? -5.374 53.856 27.221 1.00 50.30 ? 443 HOH B O 1 HETATM 1895 O O . HOH F 6 . ? -29.484 29.447 7.045 1.00 29.18 ? 444 HOH B O 1 HETATM 1896 O O . HOH F 6 . ? -9.496 36.064 -2.243 1.00 30.61 ? 445 HOH B O 1 HETATM 1897 O O . HOH F 6 . ? 2.372 45.551 3.990 1.00 36.92 ? 446 HOH B O 1 HETATM 1898 O O . HOH F 6 . ? -0.157 29.087 23.472 1.00 32.22 ? 447 HOH B O 1 HETATM 1899 O O . HOH F 6 . ? 5.445 50.887 15.526 1.00 33.32 ? 448 HOH B O 1 HETATM 1900 O O . HOH F 6 . ? -31.496 38.932 8.970 1.00 37.17 ? 449 HOH B O 1 HETATM 1901 O O . HOH F 6 . ? -15.539 19.158 4.083 1.00 35.87 ? 450 HOH B O 1 HETATM 1902 O O . HOH F 6 . ? -25.321 22.835 12.316 1.00 43.16 ? 451 HOH B O 1 HETATM 1903 O O . HOH F 6 . ? -20.948 36.616 30.916 1.00 27.10 ? 452 HOH B O 1 HETATM 1904 O O . HOH F 6 . ? -14.312 44.169 -8.361 1.00 35.50 ? 453 HOH B O 1 HETATM 1905 O O . HOH F 6 . ? 7.413 31.113 14.505 1.00 39.15 ? 454 HOH B O 1 HETATM 1906 O O . HOH F 6 . ? -22.909 33.627 20.411 1.00 31.88 ? 455 HOH B O 1 HETATM 1907 O O . HOH F 6 . ? 3.350 28.214 15.955 1.00 29.81 ? 456 HOH B O 1 HETATM 1908 O O . HOH F 6 . ? 0.104 28.388 17.870 1.00 31.58 ? 457 HOH B O 1 HETATM 1909 O O . HOH F 6 . ? -23.747 47.311 21.713 1.00 41.07 ? 458 HOH B O 1 HETATM 1910 O O . HOH F 6 . ? -18.196 16.204 -5.086 1.00 37.15 ? 459 HOH B O 1 #