Acta Crystallographica Section D
Acta Crystallographica
Section D
STRUCTURAL BIOLOGY
IUCr
IT
WDC
search IUCr Journals
home
archive
editors
for authors
for readers
submit
subscribe
open access
journal menu
home
archive
editors
for authors
for readers
submit
subscribe
open access
3D view
STRUCTURAL
BIOLOGY
Volume 80
|
Part 9
|
September 2024
|
Pages 661–674
https://doi.org/10.1107/S2059798324007939
Open
access
ISSN: 2059-7983
My images
view article
STRUCTURAL
BIOLOGY
Volume 80
|
Part 9
|
September 2024
|
Pages 661–674
https://doi.org/10.1107/S2059798324007939
Open
access
ISSN: 2059-7983
Visualization options
Jmol (JAVA applet)
JSmol (HTML5 version of Jmol)
CIFmol (light-weight HTML5 CIF viewer)
Follow Acta Cryst. D
E-alerts
twitter.com
Facebook
RSS
Please wait...
...
Generating image - please wait
3D viewers
Jmol (JAVA applet)
JSmol (HTML5 version of Jmol)
CIFmol (light-weight CIF viewer)
remember my choice
data_9ESA # _entry.id 9ESA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.396 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ESA pdb_00009esa 10.2210/pdb9esa/pdb WWPDB D_1292137559 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-11 2 'Structure model' 1 1 2024-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9ESA _pdbx_database_status.recvd_initial_deposition_date 2024-03-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email roman.hillig@nuvisan.com _pdbx_contact_author.name_first Roman _pdbx_contact_author.name_last Hillig _pdbx_contact_author.name_mi C. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6267-7250 # _audit_author.name 'Hillig, R.C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0001-6267-7250 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 80 _citation.language ? _citation.page_first 661 _citation.page_last 674 _citation.title 'Surface-mutagenesis strategies to enable structural biology crystallization platforms.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798324007939 _citation.pdbx_database_id_PubMed 39207897 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schaefer, M.' 1 ? primary 'Putter, V.' 2 ? primary 'Hilpmann, A.' 3 ? primary 'Egner, U.' 4 ? primary 'Holton, S.J.' 5 ? primary 'Hillig, R.C.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase C' 34988.336 2 2.7.11.1 'R195A, R196A, K197A' ? 'TRIPPLE SURFACE ENTROPY REDUCTION (SER) MUTATION R195A/R196A/K197A INTRODUCED TO FACILITATE CRYSTALLIZATION.' 2 polymer man 'Inner centromere protein' 6857.935 2 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 3,Aurora/IPL1-related kinase 3,ARK-3,Aurora-related kinase 3,Aurora/IPL1/Eg2 protein 2,Serine/threonine-protein kinase 13,Serine/threonine-protein kinase aurora-C ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;HHHHHHAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEH QLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRD IKPENLLLGFRGEVKIADFGWSVHTPSLAAATMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSE TYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS ; ;HHHHHHAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEH QLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRD IKPENLLLGFRGEVKIADFGWSVHTPSLAAATMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSE TYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS ; AAA,BBB ? 2 'polypeptide(L)' no no DEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKR DEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKR CCC,DDD ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 ALA n 1 8 GLN n 1 9 PRO n 1 10 ALA n 1 11 GLY n 1 12 GLU n 1 13 GLU n 1 14 LEU n 1 15 ALA n 1 16 THR n 1 17 ALA n 1 18 ASN n 1 19 GLN n 1 20 THR n 1 21 ALA n 1 22 GLN n 1 23 GLN n 1 24 PRO n 1 25 SER n 1 26 SER n 1 27 PRO n 1 28 ALA n 1 29 MET n 1 30 ARG n 1 31 ARG n 1 32 LEU n 1 33 THR n 1 34 VAL n 1 35 ASP n 1 36 ASP n 1 37 PHE n 1 38 GLU n 1 39 ILE n 1 40 GLY n 1 41 ARG n 1 42 PRO n 1 43 LEU n 1 44 GLY n 1 45 LYS n 1 46 GLY n 1 47 LYS n 1 48 PHE n 1 49 GLY n 1 50 ASN n 1 51 VAL n 1 52 TYR n 1 53 LEU n 1 54 ALA n 1 55 ARG n 1 56 LEU n 1 57 LYS n 1 58 GLU n 1 59 SER n 1 60 HIS n 1 61 PHE n 1 62 ILE n 1 63 VAL n 1 64 ALA n 1 65 LEU n 1 66 LYS n 1 67 VAL n 1 68 LEU n 1 69 PHE n 1 70 LYS n 1 71 SER n 1 72 GLN n 1 73 ILE n 1 74 GLU n 1 75 LYS n 1 76 GLU n 1 77 GLY n 1 78 LEU n 1 79 GLU n 1 80 HIS n 1 81 GLN n 1 82 LEU n 1 83 ARG n 1 84 ARG n 1 85 GLU n 1 86 ILE n 1 87 GLU n 1 88 ILE n 1 89 GLN n 1 90 ALA n 1 91 HIS n 1 92 LEU n 1 93 GLN n 1 94 HIS n 1 95 PRO n 1 96 ASN n 1 97 ILE n 1 98 LEU n 1 99 ARG n 1 100 LEU n 1 101 TYR n 1 102 ASN n 1 103 TYR n 1 104 PHE n 1 105 HIS n 1 106 ASP n 1 107 ALA n 1 108 ARG n 1 109 ARG n 1 110 VAL n 1 111 TYR n 1 112 LEU n 1 113 ILE n 1 114 LEU n 1 115 GLU n 1 116 TYR n 1 117 ALA n 1 118 PRO n 1 119 ARG n 1 120 GLY n 1 121 GLU n 1 122 LEU n 1 123 TYR n 1 124 LYS n 1 125 GLU n 1 126 LEU n 1 127 GLN n 1 128 LYS n 1 129 SER n 1 130 GLU n 1 131 LYS n 1 132 LEU n 1 133 ASP n 1 134 GLU n 1 135 GLN n 1 136 ARG n 1 137 THR n 1 138 ALA n 1 139 THR n 1 140 ILE n 1 141 ILE n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 ALA n 1 146 ASP n 1 147 ALA n 1 148 LEU n 1 149 THR n 1 150 TYR n 1 151 CYS n 1 152 HIS n 1 153 ASP n 1 154 LYS n 1 155 LYS n 1 156 VAL n 1 157 ILE n 1 158 HIS n 1 159 ARG n 1 160 ASP n 1 161 ILE n 1 162 LYS n 1 163 PRO n 1 164 GLU n 1 165 ASN n 1 166 LEU n 1 167 LEU n 1 168 LEU n 1 169 GLY n 1 170 PHE n 1 171 ARG n 1 172 GLY n 1 173 GLU n 1 174 VAL n 1 175 LYS n 1 176 ILE n 1 177 ALA n 1 178 ASP n 1 179 PHE n 1 180 GLY n 1 181 TRP n 1 182 SER n 1 183 VAL n 1 184 HIS n 1 185 THR n 1 186 PRO n 1 187 SER n 1 188 LEU n 1 189 ALA n 1 190 ALA n 1 191 ALA n 1 192 THR n 1 193 MET n 1 194 CYS n 1 195 GLY n 1 196 THR n 1 197 LEU n 1 198 ASP n 1 199 TYR n 1 200 LEU n 1 201 PRO n 1 202 PRO n 1 203 GLU n 1 204 MET n 1 205 ILE n 1 206 GLU n 1 207 GLY n 1 208 ARG n 1 209 THR n 1 210 TYR n 1 211 ASP n 1 212 GLU n 1 213 LYS n 1 214 VAL n 1 215 ASP n 1 216 LEU n 1 217 TRP n 1 218 CYS n 1 219 ILE n 1 220 GLY n 1 221 VAL n 1 222 LEU n 1 223 CYS n 1 224 TYR n 1 225 GLU n 1 226 LEU n 1 227 LEU n 1 228 VAL n 1 229 GLY n 1 230 TYR n 1 231 PRO n 1 232 PRO n 1 233 PHE n 1 234 GLU n 1 235 SER n 1 236 ALA n 1 237 SER n 1 238 HIS n 1 239 SER n 1 240 GLU n 1 241 THR n 1 242 TYR n 1 243 ARG n 1 244 ARG n 1 245 ILE n 1 246 LEU n 1 247 LYS n 1 248 VAL n 1 249 ASP n 1 250 VAL n 1 251 ARG n 1 252 PHE n 1 253 PRO n 1 254 LEU n 1 255 SER n 1 256 MET n 1 257 PRO n 1 258 LEU n 1 259 GLY n 1 260 ALA n 1 261 ARG n 1 262 ASP n 1 263 LEU n 1 264 ILE n 1 265 SER n 1 266 ARG n 1 267 LEU n 1 268 LEU n 1 269 ARG n 1 270 TYR n 1 271 GLN n 1 272 PRO n 1 273 LEU n 1 274 GLU n 1 275 ARG n 1 276 LEU n 1 277 PRO n 1 278 LEU n 1 279 ALA n 1 280 GLN n 1 281 ILE n 1 282 LEU n 1 283 LYS n 1 284 HIS n 1 285 PRO n 1 286 TRP n 1 287 VAL n 1 288 GLN n 1 289 ALA n 1 290 HIS n 1 291 SER n 1 292 ARG n 1 293 ARG n 1 294 VAL n 1 295 LEU n 1 296 PRO n 1 297 PRO n 1 298 CYS n 1 299 ALA n 1 300 GLN n 1 301 MET n 1 302 ALA n 1 303 SER n 2 1 ASP n 2 2 GLU n 2 3 ALA n 2 4 HIS n 2 5 PRO n 2 6 ARG n 2 7 LYS n 2 8 PRO n 2 9 ILE n 2 10 PRO n 2 11 THR n 2 12 TRP n 2 13 ALA n 2 14 ARG n 2 15 GLY n 2 16 THR n 2 17 PRO n 2 18 LEU n 2 19 SER n 2 20 GLN n 2 21 ALA n 2 22 ILE n 2 23 ILE n 2 24 HIS n 2 25 GLN n 2 26 TYR n 2 27 TYR n 2 28 HIS n 2 29 PRO n 2 30 PRO n 2 31 ASN n 2 32 LEU n 2 33 LEU n 2 34 GLU n 2 35 LEU n 2 36 PHE n 2 37 GLY n 2 38 THR n 2 39 ILE n 2 40 LEU n 2 41 PRO n 2 42 LEU n 2 43 ASP n 2 44 LEU n 2 45 GLU n 2 46 ASP n 2 47 ILE n 2 48 PHE n 2 49 LYS n 2 50 LYS n 2 51 SER n 2 52 LYS n 2 53 PRO n 2 54 ARG n 2 55 TYR n 2 56 HIS n 2 57 LYS n 2 58 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 303 human ? 'AURKC, AIE2, AIK3, AIRK3, ARK3, STK13' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 58 human ? INCENP ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 7 ? ? ? AAA . n A 1 2 HIS 2 8 ? ? ? AAA . n A 1 3 HIS 3 9 ? ? ? AAA . n A 1 4 HIS 4 10 ? ? ? AAA . n A 1 5 HIS 5 11 ? ? ? AAA . n A 1 6 HIS 6 12 ? ? ? AAA . n A 1 7 ALA 7 13 ? ? ? AAA . n A 1 8 GLN 8 14 ? ? ? AAA . n A 1 9 PRO 9 15 ? ? ? AAA . n A 1 10 ALA 10 16 ? ? ? AAA . n A 1 11 GLY 11 17 ? ? ? AAA . n A 1 12 GLU 12 18 ? ? ? AAA . n A 1 13 GLU 13 19 ? ? ? AAA . n A 1 14 LEU 14 20 ? ? ? AAA . n A 1 15 ALA 15 21 ? ? ? AAA . n A 1 16 THR 16 22 ? ? ? AAA . n A 1 17 ALA 17 23 ? ? ? AAA . n A 1 18 ASN 18 24 ? ? ? AAA . n A 1 19 GLN 19 25 ? ? ? AAA . n A 1 20 THR 20 26 ? ? ? AAA . n A 1 21 ALA 21 27 ? ? ? AAA . n A 1 22 GLN 22 28 ? ? ? AAA . n A 1 23 GLN 23 29 ? ? ? AAA . n A 1 24 PRO 24 30 ? ? ? AAA . n A 1 25 SER 25 31 ? ? ? AAA . n A 1 26 SER 26 32 32 SER SER AAA . n A 1 27 PRO 27 33 33 PRO PRO AAA . n A 1 28 ALA 28 34 34 ALA ALA AAA . n A 1 29 MET 29 35 35 MET MET AAA . n A 1 30 ARG 30 36 36 ARG ARG AAA . n A 1 31 ARG 31 37 37 ARG ARG AAA . n A 1 32 LEU 32 38 38 LEU LEU AAA . n A 1 33 THR 33 39 39 THR THR AAA . n A 1 34 VAL 34 40 40 VAL VAL AAA . n A 1 35 ASP 35 41 41 ASP ASP AAA . n A 1 36 ASP 36 42 42 ASP ASP AAA . n A 1 37 PHE 37 43 43 PHE PHE AAA . n A 1 38 GLU 38 44 44 GLU GLU AAA . n A 1 39 ILE 39 45 45 ILE ILE AAA . n A 1 40 GLY 40 46 46 GLY GLY AAA . n A 1 41 ARG 41 47 47 ARG ARG AAA . n A 1 42 PRO 42 48 48 PRO PRO AAA . n A 1 43 LEU 43 49 49 LEU LEU AAA . n A 1 44 GLY 44 50 50 GLY GLY AAA . n A 1 45 LYS 45 51 51 LYS LYS AAA . n A 1 46 GLY 46 52 52 GLY GLY AAA . n A 1 47 LYS 47 53 53 LYS LYS AAA . n A 1 48 PHE 48 54 54 PHE PHE AAA . n A 1 49 GLY 49 55 55 GLY GLY AAA . n A 1 50 ASN 50 56 56 ASN ASN AAA . n A 1 51 VAL 51 57 57 VAL VAL AAA . n A 1 52 TYR 52 58 58 TYR TYR AAA . n A 1 53 LEU 53 59 59 LEU LEU AAA . n A 1 54 ALA 54 60 60 ALA ALA AAA . n A 1 55 ARG 55 61 61 ARG ARG AAA . n A 1 56 LEU 56 62 62 LEU LEU AAA . n A 1 57 LYS 57 63 63 LYS LYS AAA . n A 1 58 GLU 58 64 64 GLU GLU AAA . n A 1 59 SER 59 65 65 SER SER AAA . n A 1 60 HIS 60 66 66 HIS HIS AAA . n A 1 61 PHE 61 67 67 PHE PHE AAA . n A 1 62 ILE 62 68 68 ILE ILE AAA . n A 1 63 VAL 63 69 69 VAL VAL AAA . n A 1 64 ALA 64 70 70 ALA ALA AAA . n A 1 65 LEU 65 71 71 LEU LEU AAA . n A 1 66 LYS 66 72 72 LYS LYS AAA . n A 1 67 VAL 67 73 73 VAL VAL AAA . n A 1 68 LEU 68 74 74 LEU LEU AAA . n A 1 69 PHE 69 75 75 PHE PHE AAA . n A 1 70 LYS 70 76 76 LYS LYS AAA . n A 1 71 SER 71 77 77 SER SER AAA . n A 1 72 GLN 72 78 78 GLN GLN AAA . n A 1 73 ILE 73 79 79 ILE ILE AAA . n A 1 74 GLU 74 80 80 GLU GLU AAA . n A 1 75 LYS 75 81 81 LYS LYS AAA . n A 1 76 GLU 76 82 82 GLU GLU AAA . n A 1 77 GLY 77 83 83 GLY GLY AAA . n A 1 78 LEU 78 84 84 LEU LEU AAA . n A 1 79 GLU 79 85 85 GLU GLU AAA . n A 1 80 HIS 80 86 86 HIS HIS AAA . n A 1 81 GLN 81 87 87 GLN GLN AAA . n A 1 82 LEU 82 88 88 LEU LEU AAA . n A 1 83 ARG 83 89 89 ARG ARG AAA . n A 1 84 ARG 84 90 90 ARG ARG AAA . n A 1 85 GLU 85 91 91 GLU GLU AAA . n A 1 86 ILE 86 92 92 ILE ILE AAA . n A 1 87 GLU 87 93 93 GLU GLU AAA . n A 1 88 ILE 88 94 94 ILE ILE AAA . n A 1 89 GLN 89 95 95 GLN GLN AAA . n A 1 90 ALA 90 96 96 ALA ALA AAA . n A 1 91 HIS 91 97 97 HIS HIS AAA . n A 1 92 LEU 92 98 98 LEU LEU AAA . n A 1 93 GLN 93 99 99 GLN GLN AAA . n A 1 94 HIS 94 100 100 HIS HIS AAA . n A 1 95 PRO 95 101 101 PRO PRO AAA . n A 1 96 ASN 96 102 102 ASN ASN AAA . n A 1 97 ILE 97 103 103 ILE ILE AAA . n A 1 98 LEU 98 104 104 LEU LEU AAA . n A 1 99 ARG 99 105 105 ARG ARG AAA . n A 1 100 LEU 100 106 106 LEU LEU AAA . n A 1 101 TYR 101 107 107 TYR TYR AAA . n A 1 102 ASN 102 108 108 ASN ASN AAA . n A 1 103 TYR 103 109 109 TYR TYR AAA . n A 1 104 PHE 104 110 110 PHE PHE AAA . n A 1 105 HIS 105 111 111 HIS HIS AAA . n A 1 106 ASP 106 112 112 ASP ASP AAA . n A 1 107 ALA 107 113 113 ALA ALA AAA . n A 1 108 ARG 108 114 114 ARG ARG AAA . n A 1 109 ARG 109 115 115 ARG ARG AAA . n A 1 110 VAL 110 116 116 VAL VAL AAA . n A 1 111 TYR 111 117 117 TYR TYR AAA . n A 1 112 LEU 112 118 118 LEU LEU AAA . n A 1 113 ILE 113 119 119 ILE ILE AAA . n A 1 114 LEU 114 120 120 LEU LEU AAA . n A 1 115 GLU 115 121 121 GLU GLU AAA . n A 1 116 TYR 116 122 122 TYR TYR AAA . n A 1 117 ALA 117 123 123 ALA ALA AAA . n A 1 118 PRO 118 124 124 PRO PRO AAA . n A 1 119 ARG 119 125 125 ARG ARG AAA . n A 1 120 GLY 120 126 126 GLY GLY AAA . n A 1 121 GLU 121 127 127 GLU GLU AAA . n A 1 122 LEU 122 128 128 LEU LEU AAA . n A 1 123 TYR 123 129 129 TYR TYR AAA . n A 1 124 LYS 124 130 130 LYS LYS AAA . n A 1 125 GLU 125 131 131 GLU GLU AAA . n A 1 126 LEU 126 132 132 LEU LEU AAA . n A 1 127 GLN 127 133 133 GLN GLN AAA . n A 1 128 LYS 128 134 134 LYS LYS AAA . n A 1 129 SER 129 135 135 SER SER AAA . n A 1 130 GLU 130 136 136 GLU GLU AAA . n A 1 131 LYS 131 137 137 LYS LYS AAA . n A 1 132 LEU 132 138 138 LEU LEU AAA . n A 1 133 ASP 133 139 139 ASP ASP AAA . n A 1 134 GLU 134 140 140 GLU GLU AAA . n A 1 135 GLN 135 141 141 GLN GLN AAA . n A 1 136 ARG 136 142 142 ARG ARG AAA . n A 1 137 THR 137 143 143 THR THR AAA . n A 1 138 ALA 138 144 144 ALA ALA AAA . n A 1 139 THR 139 145 145 THR THR AAA . n A 1 140 ILE 140 146 146 ILE ILE AAA . n A 1 141 ILE 141 147 147 ILE ILE AAA . n A 1 142 GLU 142 148 148 GLU GLU AAA . n A 1 143 GLU 143 149 149 GLU GLU AAA . n A 1 144 LEU 144 150 150 LEU LEU AAA . n A 1 145 ALA 145 151 151 ALA ALA AAA . n A 1 146 ASP 146 152 152 ASP ASP AAA . n A 1 147 ALA 147 153 153 ALA ALA AAA . n A 1 148 LEU 148 154 154 LEU LEU AAA . n A 1 149 THR 149 155 155 THR THR AAA . n A 1 150 TYR 150 156 156 TYR TYR AAA . n A 1 151 CYS 151 157 157 CYS CYS AAA . n A 1 152 HIS 152 158 158 HIS HIS AAA . n A 1 153 ASP 153 159 159 ASP ASP AAA . n A 1 154 LYS 154 160 160 LYS LYS AAA . n A 1 155 LYS 155 161 161 LYS LYS AAA . n A 1 156 VAL 156 162 162 VAL VAL AAA . n A 1 157 ILE 157 163 163 ILE ILE AAA . n A 1 158 HIS 158 164 164 HIS HIS AAA . n A 1 159 ARG 159 165 165 ARG ARG AAA . n A 1 160 ASP 160 166 166 ASP ASP AAA . n A 1 161 ILE 161 167 167 ILE ILE AAA . n A 1 162 LYS 162 168 168 LYS LYS AAA . n A 1 163 PRO 163 169 169 PRO PRO AAA . n A 1 164 GLU 164 170 170 GLU GLU AAA . n A 1 165 ASN 165 171 171 ASN ASN AAA . n A 1 166 LEU 166 172 172 LEU LEU AAA . n A 1 167 LEU 167 173 173 LEU LEU AAA . n A 1 168 LEU 168 174 174 LEU LEU AAA . n A 1 169 GLY 169 175 175 GLY GLY AAA . n A 1 170 PHE 170 176 176 PHE PHE AAA . n A 1 171 ARG 171 177 177 ARG ARG AAA . n A 1 172 GLY 172 178 178 GLY GLY AAA . n A 1 173 GLU 173 179 179 GLU GLU AAA . n A 1 174 VAL 174 180 180 VAL VAL AAA . n A 1 175 LYS 175 181 181 LYS LYS AAA . n A 1 176 ILE 176 182 182 ILE ILE AAA . n A 1 177 ALA 177 183 183 ALA ALA AAA . n A 1 178 ASP 178 184 184 ASP ASP AAA . n A 1 179 PHE 179 185 185 PHE PHE AAA . n A 1 180 GLY 180 186 186 GLY GLY AAA . n A 1 181 TRP 181 187 187 TRP TRP AAA . n A 1 182 SER 182 188 188 SER SER AAA . n A 1 183 VAL 183 189 189 VAL VAL AAA . n A 1 184 HIS 184 190 190 HIS HIS AAA . n A 1 185 THR 185 191 191 THR THR AAA . n A 1 186 PRO 186 192 192 PRO PRO AAA . n A 1 187 SER 187 193 193 SER SER AAA . n A 1 188 LEU 188 194 194 LEU LEU AAA . n A 1 189 ALA 189 195 195 ALA ALA AAA . n A 1 190 ALA 190 196 196 ALA ALA AAA . n A 1 191 ALA 191 197 197 ALA ALA AAA . n A 1 192 THR 192 198 198 THR THR AAA . n A 1 193 MET 193 199 199 MET MET AAA . n A 1 194 CYS 194 200 200 CYS CYS AAA . n A 1 195 GLY 195 201 201 GLY GLY AAA . n A 1 196 THR 196 202 202 THR THR AAA . n A 1 197 LEU 197 203 203 LEU LEU AAA . n A 1 198 ASP 198 204 204 ASP ASP AAA . n A 1 199 TYR 199 205 205 TYR TYR AAA . n A 1 200 LEU 200 206 206 LEU LEU AAA . n A 1 201 PRO 201 207 207 PRO PRO AAA . n A 1 202 PRO 202 208 208 PRO PRO AAA . n A 1 203 GLU 203 209 209 GLU GLU AAA . n A 1 204 MET 204 210 210 MET MET AAA . n A 1 205 ILE 205 211 211 ILE ILE AAA . n A 1 206 GLU 206 212 212 GLU GLU AAA . n A 1 207 GLY 207 213 213 GLY GLY AAA . n A 1 208 ARG 208 214 214 ARG ARG AAA . n A 1 209 THR 209 215 215 THR THR AAA . n A 1 210 TYR 210 216 216 TYR TYR AAA . n A 1 211 ASP 211 217 217 ASP ASP AAA . n A 1 212 GLU 212 218 218 GLU GLU AAA . n A 1 213 LYS 213 219 219 LYS LYS AAA . n A 1 214 VAL 214 220 220 VAL VAL AAA . n A 1 215 ASP 215 221 221 ASP ASP AAA . n A 1 216 LEU 216 222 222 LEU LEU AAA . n A 1 217 TRP 217 223 223 TRP TRP AAA . n A 1 218 CYS 218 224 224 CYS CYS AAA . n A 1 219 ILE 219 225 225 ILE ILE AAA . n A 1 220 GLY 220 226 226 GLY GLY AAA . n A 1 221 VAL 221 227 227 VAL VAL AAA . n A 1 222 LEU 222 228 228 LEU LEU AAA . n A 1 223 CYS 223 229 229 CYS CYS AAA . n A 1 224 TYR 224 230 230 TYR TYR AAA . n A 1 225 GLU 225 231 231 GLU GLU AAA . n A 1 226 LEU 226 232 232 LEU LEU AAA . n A 1 227 LEU 227 233 233 LEU LEU AAA . n A 1 228 VAL 228 234 234 VAL VAL AAA . n A 1 229 GLY 229 235 235 GLY GLY AAA . n A 1 230 TYR 230 236 236 TYR TYR AAA . n A 1 231 PRO 231 237 237 PRO PRO AAA . n A 1 232 PRO 232 238 238 PRO PRO AAA . n A 1 233 PHE 233 239 239 PHE PHE AAA . n A 1 234 GLU 234 240 240 GLU GLU AAA . n A 1 235 SER 235 241 241 SER SER AAA . n A 1 236 ALA 236 242 242 ALA ALA AAA . n A 1 237 SER 237 243 243 SER SER AAA . n A 1 238 HIS 238 244 244 HIS HIS AAA . n A 1 239 SER 239 245 245 SER SER AAA . n A 1 240 GLU 240 246 246 GLU GLU AAA . n A 1 241 THR 241 247 247 THR THR AAA . n A 1 242 TYR 242 248 248 TYR TYR AAA . n A 1 243 ARG 243 249 249 ARG ARG AAA . n A 1 244 ARG 244 250 250 ARG ARG AAA . n A 1 245 ILE 245 251 251 ILE ILE AAA . n A 1 246 LEU 246 252 252 LEU LEU AAA . n A 1 247 LYS 247 253 253 LYS LYS AAA . n A 1 248 VAL 248 254 254 VAL VAL AAA . n A 1 249 ASP 249 255 255 ASP ASP AAA . n A 1 250 VAL 250 256 256 VAL VAL AAA . n A 1 251 ARG 251 257 257 ARG ARG AAA . n A 1 252 PHE 252 258 258 PHE PHE AAA . n A 1 253 PRO 253 259 259 PRO PRO AAA . n A 1 254 LEU 254 260 260 LEU LEU AAA . n A 1 255 SER 255 261 261 SER SER AAA . n A 1 256 MET 256 262 262 MET MET AAA . n A 1 257 PRO 257 263 263 PRO PRO AAA . n A 1 258 LEU 258 264 264 LEU LEU AAA . n A 1 259 GLY 259 265 265 GLY GLY AAA . n A 1 260 ALA 260 266 266 ALA ALA AAA . n A 1 261 ARG 261 267 267 ARG ARG AAA . n A 1 262 ASP 262 268 268 ASP ASP AAA . n A 1 263 LEU 263 269 269 LEU LEU AAA . n A 1 264 ILE 264 270 270 ILE ILE AAA . n A 1 265 SER 265 271 271 SER SER AAA . n A 1 266 ARG 266 272 272 ARG ARG AAA . n A 1 267 LEU 267 273 273 LEU LEU AAA . n A 1 268 LEU 268 274 274 LEU LEU AAA . n A 1 269 ARG 269 275 275 ARG ARG AAA . n A 1 270 TYR 270 276 276 TYR TYR AAA . n A 1 271 GLN 271 277 277 GLN GLN AAA . n A 1 272 PRO 272 278 278 PRO PRO AAA . n A 1 273 LEU 273 279 279 LEU LEU AAA . n A 1 274 GLU 274 280 280 GLU GLU AAA . n A 1 275 ARG 275 281 281 ARG ARG AAA . n A 1 276 LEU 276 282 282 LEU LEU AAA . n A 1 277 PRO 277 283 283 PRO PRO AAA . n A 1 278 LEU 278 284 284 LEU LEU AAA . n A 1 279 ALA 279 285 285 ALA ALA AAA . n A 1 280 GLN 280 286 286 GLN GLN AAA . n A 1 281 ILE 281 287 287 ILE ILE AAA . n A 1 282 LEU 282 288 288 LEU LEU AAA . n A 1 283 LYS 283 289 289 LYS LYS AAA . n A 1 284 HIS 284 290 290 HIS HIS AAA . n A 1 285 PRO 285 291 291 PRO PRO AAA . n A 1 286 TRP 286 292 292 TRP TRP AAA . n A 1 287 VAL 287 293 293 VAL VAL AAA . n A 1 288 GLN 288 294 294 GLN GLN AAA . n A 1 289 ALA 289 295 295 ALA ALA AAA . n A 1 290 HIS 290 296 296 HIS HIS AAA . n A 1 291 SER 291 297 297 SER SER AAA . n A 1 292 ARG 292 298 298 ARG ARG AAA . n A 1 293 ARG 293 299 299 ARG ARG AAA . n A 1 294 VAL 294 300 300 VAL VAL AAA . n A 1 295 LEU 295 301 301 LEU LEU AAA . n A 1 296 PRO 296 302 302 PRO PRO AAA . n A 1 297 PRO 297 303 303 PRO PRO AAA . n A 1 298 CYS 298 304 304 CYS CYS AAA . n A 1 299 ALA 299 305 305 ALA ALA AAA . n A 1 300 GLN 300 306 306 GLN GLN AAA . n A 1 301 MET 301 307 ? ? ? AAA . n A 1 302 ALA 302 308 ? ? ? AAA . n A 1 303 SER 303 309 ? ? ? AAA . n B 1 1 HIS 1 7 ? ? ? BBB . n B 1 2 HIS 2 8 ? ? ? BBB . n B 1 3 HIS 3 9 ? ? ? BBB . n B 1 4 HIS 4 10 ? ? ? BBB . n B 1 5 HIS 5 11 ? ? ? BBB . n B 1 6 HIS 6 12 ? ? ? BBB . n B 1 7 ALA 7 13 ? ? ? BBB . n B 1 8 GLN 8 14 ? ? ? BBB . n B 1 9 PRO 9 15 ? ? ? BBB . n B 1 10 ALA 10 16 ? ? ? BBB . n B 1 11 GLY 11 17 ? ? ? BBB . n B 1 12 GLU 12 18 ? ? ? BBB . n B 1 13 GLU 13 19 ? ? ? BBB . n B 1 14 LEU 14 20 ? ? ? BBB . n B 1 15 ALA 15 21 ? ? ? BBB . n B 1 16 THR 16 22 ? ? ? BBB . n B 1 17 ALA 17 23 ? ? ? BBB . n B 1 18 ASN 18 24 ? ? ? BBB . n B 1 19 GLN 19 25 ? ? ? BBB . n B 1 20 THR 20 26 ? ? ? BBB . n B 1 21 ALA 21 27 ? ? ? BBB . n B 1 22 GLN 22 28 ? ? ? BBB . n B 1 23 GLN 23 29 ? ? ? BBB . n B 1 24 PRO 24 30 ? ? ? BBB . n B 1 25 SER 25 31 ? ? ? BBB . n B 1 26 SER 26 32 32 SER SER BBB . n B 1 27 PRO 27 33 33 PRO PRO BBB . n B 1 28 ALA 28 34 34 ALA ALA BBB . n B 1 29 MET 29 35 35 MET MET BBB . n B 1 30 ARG 30 36 36 ARG ARG BBB . n B 1 31 ARG 31 37 37 ARG ARG BBB . n B 1 32 LEU 32 38 38 LEU LEU BBB . n B 1 33 THR 33 39 39 THR THR BBB . n B 1 34 VAL 34 40 40 VAL VAL BBB . n B 1 35 ASP 35 41 41 ASP ASP BBB . n B 1 36 ASP 36 42 42 ASP ASP BBB . n B 1 37 PHE 37 43 43 PHE PHE BBB . n B 1 38 GLU 38 44 44 GLU GLU BBB . n B 1 39 ILE 39 45 45 ILE ILE BBB . n B 1 40 GLY 40 46 46 GLY GLY BBB . n B 1 41 ARG 41 47 47 ARG ARG BBB . n B 1 42 PRO 42 48 48 PRO PRO BBB . n B 1 43 LEU 43 49 49 LEU LEU BBB . n B 1 44 GLY 44 50 50 GLY GLY BBB . n B 1 45 LYS 45 51 51 LYS LYS BBB . n B 1 46 GLY 46 52 52 GLY GLY BBB . n B 1 47 LYS 47 53 53 LYS LYS BBB . n B 1 48 PHE 48 54 54 PHE PHE BBB . n B 1 49 GLY 49 55 55 GLY GLY BBB . n B 1 50 ASN 50 56 56 ASN ASN BBB . n B 1 51 VAL 51 57 57 VAL VAL BBB . n B 1 52 TYR 52 58 58 TYR TYR BBB . n B 1 53 LEU 53 59 59 LEU LEU BBB . n B 1 54 ALA 54 60 60 ALA ALA BBB . n B 1 55 ARG 55 61 61 ARG ARG BBB . n B 1 56 LEU 56 62 62 LEU LEU BBB . n B 1 57 LYS 57 63 63 LYS LYS BBB . n B 1 58 GLU 58 64 64 GLU GLU BBB . n B 1 59 SER 59 65 65 SER SER BBB . n B 1 60 HIS 60 66 66 HIS HIS BBB . n B 1 61 PHE 61 67 67 PHE PHE BBB . n B 1 62 ILE 62 68 68 ILE ILE BBB . n B 1 63 VAL 63 69 69 VAL VAL BBB . n B 1 64 ALA 64 70 70 ALA ALA BBB . n B 1 65 LEU 65 71 71 LEU LEU BBB . n B 1 66 LYS 66 72 72 LYS LYS BBB . n B 1 67 VAL 67 73 73 VAL VAL BBB . n B 1 68 LEU 68 74 74 LEU LEU BBB . n B 1 69 PHE 69 75 75 PHE PHE BBB . n B 1 70 LYS 70 76 76 LYS LYS BBB . n B 1 71 SER 71 77 77 SER SER BBB . n B 1 72 GLN 72 78 78 GLN GLN BBB . n B 1 73 ILE 73 79 79 ILE ILE BBB . n B 1 74 GLU 74 80 80 GLU GLU BBB . n B 1 75 LYS 75 81 81 LYS LYS BBB . n B 1 76 GLU 76 82 82 GLU GLU BBB . n B 1 77 GLY 77 83 83 GLY GLY BBB . n B 1 78 LEU 78 84 84 LEU LEU BBB . n B 1 79 GLU 79 85 85 GLU GLU BBB . n B 1 80 HIS 80 86 86 HIS HIS BBB . n B 1 81 GLN 81 87 87 GLN GLN BBB . n B 1 82 LEU 82 88 88 LEU LEU BBB . n B 1 83 ARG 83 89 89 ARG ARG BBB . n B 1 84 ARG 84 90 90 ARG ARG BBB . n B 1 85 GLU 85 91 91 GLU GLU BBB . n B 1 86 ILE 86 92 92 ILE ILE BBB . n B 1 87 GLU 87 93 93 GLU GLU BBB . n B 1 88 ILE 88 94 94 ILE ILE BBB . n B 1 89 GLN 89 95 95 GLN GLN BBB . n B 1 90 ALA 90 96 96 ALA ALA BBB . n B 1 91 HIS 91 97 97 HIS HIS BBB . n B 1 92 LEU 92 98 98 LEU LEU BBB . n B 1 93 GLN 93 99 99 GLN GLN BBB . n B 1 94 HIS 94 100 100 HIS HIS BBB . n B 1 95 PRO 95 101 101 PRO PRO BBB . n B 1 96 ASN 96 102 102 ASN ASN BBB . n B 1 97 ILE 97 103 103 ILE ILE BBB . n B 1 98 LEU 98 104 104 LEU LEU BBB . n B 1 99 ARG 99 105 105 ARG ARG BBB . n B 1 100 LEU 100 106 106 LEU LEU BBB . n B 1 101 TYR 101 107 107 TYR TYR BBB . n B 1 102 ASN 102 108 108 ASN ASN BBB . n B 1 103 TYR 103 109 109 TYR TYR BBB . n B 1 104 PHE 104 110 110 PHE PHE BBB . n B 1 105 HIS 105 111 111 HIS HIS BBB . n B 1 106 ASP 106 112 112 ASP ASP BBB . n B 1 107 ALA 107 113 113 ALA ALA BBB . n B 1 108 ARG 108 114 114 ARG ARG BBB . n B 1 109 ARG 109 115 115 ARG ARG BBB . n B 1 110 VAL 110 116 116 VAL VAL BBB . n B 1 111 TYR 111 117 117 TYR TYR BBB . n B 1 112 LEU 112 118 118 LEU LEU BBB . n B 1 113 ILE 113 119 119 ILE ILE BBB . n B 1 114 LEU 114 120 120 LEU LEU BBB . n B 1 115 GLU 115 121 121 GLU GLU BBB . n B 1 116 TYR 116 122 122 TYR TYR BBB . n B 1 117 ALA 117 123 123 ALA ALA BBB . n B 1 118 PRO 118 124 124 PRO PRO BBB . n B 1 119 ARG 119 125 125 ARG ARG BBB . n B 1 120 GLY 120 126 126 GLY GLY BBB . n B 1 121 GLU 121 127 127 GLU GLU BBB . n B 1 122 LEU 122 128 128 LEU LEU BBB . n B 1 123 TYR 123 129 129 TYR TYR BBB . n B 1 124 LYS 124 130 130 LYS LYS BBB . n B 1 125 GLU 125 131 131 GLU GLU BBB . n B 1 126 LEU 126 132 132 LEU LEU BBB . n B 1 127 GLN 127 133 133 GLN GLN BBB . n B 1 128 LYS 128 134 134 LYS LYS BBB . n B 1 129 SER 129 135 135 SER SER BBB . n B 1 130 GLU 130 136 136 GLU GLU BBB . n B 1 131 LYS 131 137 137 LYS LYS BBB . n B 1 132 LEU 132 138 138 LEU LEU BBB . n B 1 133 ASP 133 139 139 ASP ASP BBB . n B 1 134 GLU 134 140 140 GLU GLU BBB . n B 1 135 GLN 135 141 141 GLN GLN BBB . n B 1 136 ARG 136 142 142 ARG ARG BBB . n B 1 137 THR 137 143 143 THR THR BBB . n B 1 138 ALA 138 144 144 ALA ALA BBB . n B 1 139 THR 139 145 145 THR THR BBB . n B 1 140 ILE 140 146 146 ILE ILE BBB . n B 1 141 ILE 141 147 147 ILE ILE BBB . n B 1 142 GLU 142 148 148 GLU GLU BBB . n B 1 143 GLU 143 149 149 GLU GLU BBB . n B 1 144 LEU 144 150 150 LEU LEU BBB . n B 1 145 ALA 145 151 151 ALA ALA BBB . n B 1 146 ASP 146 152 152 ASP ASP BBB . n B 1 147 ALA 147 153 153 ALA ALA BBB . n B 1 148 LEU 148 154 154 LEU LEU BBB . n B 1 149 THR 149 155 155 THR THR BBB . n B 1 150 TYR 150 156 156 TYR TYR BBB . n B 1 151 CYS 151 157 157 CYS CYS BBB . n B 1 152 HIS 152 158 158 HIS HIS BBB . n B 1 153 ASP 153 159 159 ASP ASP BBB . n B 1 154 LYS 154 160 160 LYS LYS BBB . n B 1 155 LYS 155 161 161 LYS LYS BBB . n B 1 156 VAL 156 162 162 VAL VAL BBB . n B 1 157 ILE 157 163 163 ILE ILE BBB . n B 1 158 HIS 158 164 164 HIS HIS BBB . n B 1 159 ARG 159 165 165 ARG ARG BBB . n B 1 160 ASP 160 166 166 ASP ASP BBB . n B 1 161 ILE 161 167 167 ILE ILE BBB . n B 1 162 LYS 162 168 168 LYS LYS BBB . n B 1 163 PRO 163 169 169 PRO PRO BBB . n B 1 164 GLU 164 170 170 GLU GLU BBB . n B 1 165 ASN 165 171 171 ASN ASN BBB . n B 1 166 LEU 166 172 172 LEU LEU BBB . n B 1 167 LEU 167 173 173 LEU LEU BBB . n B 1 168 LEU 168 174 174 LEU LEU BBB . n B 1 169 GLY 169 175 175 GLY GLY BBB . n B 1 170 PHE 170 176 176 PHE PHE BBB . n B 1 171 ARG 171 177 177 ARG ARG BBB . n B 1 172 GLY 172 178 178 GLY GLY BBB . n B 1 173 GLU 173 179 179 GLU GLU BBB . n B 1 174 VAL 174 180 180 VAL VAL BBB . n B 1 175 LYS 175 181 181 LYS LYS BBB . n B 1 176 ILE 176 182 182 ILE ILE BBB . n B 1 177 ALA 177 183 183 ALA ALA BBB . n B 1 178 ASP 178 184 184 ASP ASP BBB . n B 1 179 PHE 179 185 185 PHE PHE BBB . n B 1 180 GLY 180 186 186 GLY GLY BBB . n B 1 181 TRP 181 187 187 TRP TRP BBB . n B 1 182 SER 182 188 188 SER SER BBB . n B 1 183 VAL 183 189 189 VAL VAL BBB . n B 1 184 HIS 184 190 190 HIS HIS BBB . n B 1 185 THR 185 191 191 THR THR BBB . n B 1 186 PRO 186 192 192 PRO PRO BBB . n B 1 187 SER 187 193 193 SER SER BBB . n B 1 188 LEU 188 194 194 LEU LEU BBB . n B 1 189 ALA 189 195 195 ALA ALA BBB . n B 1 190 ALA 190 196 196 ALA ALA BBB . n B 1 191 ALA 191 197 197 ALA ALA BBB . n B 1 192 THR 192 198 198 THR THR BBB . n B 1 193 MET 193 199 199 MET MET BBB . n B 1 194 CYS 194 200 200 CYS CYS BBB . n B 1 195 GLY 195 201 201 GLY GLY BBB . n B 1 196 THR 196 202 202 THR THR BBB . n B 1 197 LEU 197 203 203 LEU LEU BBB . n B 1 198 ASP 198 204 204 ASP ASP BBB . n B 1 199 TYR 199 205 205 TYR TYR BBB . n B 1 200 LEU 200 206 206 LEU LEU BBB . n B 1 201 PRO 201 207 207 PRO PRO BBB . n B 1 202 PRO 202 208 208 PRO PRO BBB . n B 1 203 GLU 203 209 209 GLU GLU BBB . n B 1 204 MET 204 210 210 MET MET BBB . n B 1 205 ILE 205 211 211 ILE ILE BBB . n B 1 206 GLU 206 212 212 GLU GLU BBB . n B 1 207 GLY 207 213 213 GLY GLY BBB . n B 1 208 ARG 208 214 214 ARG ARG BBB . n B 1 209 THR 209 215 215 THR THR BBB . n B 1 210 TYR 210 216 216 TYR TYR BBB . n B 1 211 ASP 211 217 217 ASP ASP BBB . n B 1 212 GLU 212 218 218 GLU GLU BBB . n B 1 213 LYS 213 219 219 LYS LYS BBB . n B 1 214 VAL 214 220 220 VAL VAL BBB . n B 1 215 ASP 215 221 221 ASP ASP BBB . n B 1 216 LEU 216 222 222 LEU LEU BBB . n B 1 217 TRP 217 223 223 TRP TRP BBB . n B 1 218 CYS 218 224 224 CYS CYS BBB . n B 1 219 ILE 219 225 225 ILE ILE BBB . n B 1 220 GLY 220 226 226 GLY GLY BBB . n B 1 221 VAL 221 227 227 VAL VAL BBB . n B 1 222 LEU 222 228 228 LEU LEU BBB . n B 1 223 CYS 223 229 229 CYS CYS BBB . n B 1 224 TYR 224 230 230 TYR TYR BBB . n B 1 225 GLU 225 231 231 GLU GLU BBB . n B 1 226 LEU 226 232 232 LEU LEU BBB . n B 1 227 LEU 227 233 233 LEU LEU BBB . n B 1 228 VAL 228 234 234 VAL VAL BBB . n B 1 229 GLY 229 235 235 GLY GLY BBB . n B 1 230 TYR 230 236 236 TYR TYR BBB . n B 1 231 PRO 231 237 237 PRO PRO BBB . n B 1 232 PRO 232 238 238 PRO PRO BBB . n B 1 233 PHE 233 239 239 PHE PHE BBB . n B 1 234 GLU 234 240 240 GLU GLU BBB . n B 1 235 SER 235 241 241 SER SER BBB . n B 1 236 ALA 236 242 242 ALA ALA BBB . n B 1 237 SER 237 243 243 SER SER BBB . n B 1 238 HIS 238 244 244 HIS HIS BBB . n B 1 239 SER 239 245 245 SER SER BBB . n B 1 240 GLU 240 246 246 GLU GLU BBB . n B 1 241 THR 241 247 247 THR THR BBB . n B 1 242 TYR 242 248 248 TYR TYR BBB . n B 1 243 ARG 243 249 249 ARG ARG BBB . n B 1 244 ARG 244 250 250 ARG ARG BBB . n B 1 245 ILE 245 251 251 ILE ILE BBB . n B 1 246 LEU 246 252 252 LEU LEU BBB . n B 1 247 LYS 247 253 253 LYS LYS BBB . n B 1 248 VAL 248 254 254 VAL VAL BBB . n B 1 249 ASP 249 255 255 ASP ASP BBB . n B 1 250 VAL 250 256 256 VAL VAL BBB . n B 1 251 ARG 251 257 257 ARG ARG BBB . n B 1 252 PHE 252 258 258 PHE PHE BBB . n B 1 253 PRO 253 259 259 PRO PRO BBB . n B 1 254 LEU 254 260 260 LEU LEU BBB . n B 1 255 SER 255 261 261 SER SER BBB . n B 1 256 MET 256 262 262 MET MET BBB . n B 1 257 PRO 257 263 263 PRO PRO BBB . n B 1 258 LEU 258 264 264 LEU LEU BBB . n B 1 259 GLY 259 265 265 GLY GLY BBB . n B 1 260 ALA 260 266 266 ALA ALA BBB . n B 1 261 ARG 261 267 267 ARG ARG BBB . n B 1 262 ASP 262 268 268 ASP ASP BBB . n B 1 263 LEU 263 269 269 LEU LEU BBB . n B 1 264 ILE 264 270 270 ILE ILE BBB . n B 1 265 SER 265 271 271 SER SER BBB . n B 1 266 ARG 266 272 272 ARG ARG BBB . n B 1 267 LEU 267 273 273 LEU LEU BBB . n B 1 268 LEU 268 274 274 LEU LEU BBB . n B 1 269 ARG 269 275 275 ARG ARG BBB . n B 1 270 TYR 270 276 276 TYR TYR BBB . n B 1 271 GLN 271 277 277 GLN GLN BBB . n B 1 272 PRO 272 278 278 PRO PRO BBB . n B 1 273 LEU 273 279 279 LEU LEU BBB . n B 1 274 GLU 274 280 280 GLU GLU BBB . n B 1 275 ARG 275 281 281 ARG ARG BBB . n B 1 276 LEU 276 282 282 LEU LEU BBB . n B 1 277 PRO 277 283 283 PRO PRO BBB . n B 1 278 LEU 278 284 284 LEU LEU BBB . n B 1 279 ALA 279 285 285 ALA ALA BBB . n B 1 280 GLN 280 286 286 GLN GLN BBB . n B 1 281 ILE 281 287 287 ILE ILE BBB . n B 1 282 LEU 282 288 288 LEU LEU BBB . n B 1 283 LYS 283 289 289 LYS LYS BBB . n B 1 284 HIS 284 290 290 HIS HIS BBB . n B 1 285 PRO 285 291 291 PRO PRO BBB . n B 1 286 TRP 286 292 292 TRP TRP BBB . n B 1 287 VAL 287 293 293 VAL VAL BBB . n B 1 288 GLN 288 294 294 GLN GLN BBB . n B 1 289 ALA 289 295 295 ALA ALA BBB . n B 1 290 HIS 290 296 296 HIS HIS BBB . n B 1 291 SER 291 297 297 SER SER BBB . n B 1 292 ARG 292 298 298 ARG ARG BBB . n B 1 293 ARG 293 299 299 ARG ARG BBB . n B 1 294 VAL 294 300 300 VAL VAL BBB . n B 1 295 LEU 295 301 301 LEU LEU BBB . n B 1 296 PRO 296 302 302 PRO PRO BBB . n B 1 297 PRO 297 303 303 PRO PRO BBB . n B 1 298 CYS 298 304 304 CYS CYS BBB . n B 1 299 ALA 299 305 305 ALA ALA BBB . n B 1 300 GLN 300 306 306 GLN GLN BBB . n B 1 301 MET 301 307 ? ? ? BBB . n B 1 302 ALA 302 308 ? ? ? BBB . n B 1 303 SER 303 309 ? ? ? BBB . n C 2 1 ASP 1 834 ? ? ? CCC . n C 2 2 GLU 2 835 ? ? ? CCC . n C 2 3 ALA 3 836 ? ? ? CCC . n C 2 4 HIS 4 837 ? ? ? CCC . n C 2 5 PRO 5 838 ? ? ? CCC . n C 2 6 ARG 6 839 ? ? ? CCC . n C 2 7 LYS 7 840 ? ? ? CCC . n C 2 8 PRO 8 841 841 PRO PRO CCC . n C 2 9 ILE 9 842 842 ILE ILE CCC . n C 2 10 PRO 10 843 843 PRO PRO CCC . n C 2 11 THR 11 844 844 THR THR CCC . n C 2 12 TRP 12 845 845 TRP TRP CCC . n C 2 13 ALA 13 846 846 ALA ALA CCC . n C 2 14 ARG 14 847 847 ARG ARG CCC . n C 2 15 GLY 15 848 848 GLY GLY CCC . n C 2 16 THR 16 849 849 THR THR CCC . n C 2 17 PRO 17 850 850 PRO PRO CCC . n C 2 18 LEU 18 851 851 LEU LEU CCC . n C 2 19 SER 19 852 852 SER SER CCC . n C 2 20 GLN 20 853 853 GLN GLN CCC . n C 2 21 ALA 21 854 854 ALA ALA CCC . n C 2 22 ILE 22 855 855 ILE ILE CCC . n C 2 23 ILE 23 856 856 ILE ILE CCC . n C 2 24 HIS 24 857 857 HIS HIS CCC . n C 2 25 GLN 25 858 858 GLN GLN CCC . n C 2 26 TYR 26 859 859 TYR TYR CCC . n C 2 27 TYR 27 860 860 TYR TYR CCC . n C 2 28 HIS 28 861 861 HIS HIS CCC . n C 2 29 PRO 29 862 862 PRO PRO CCC . n C 2 30 PRO 30 863 863 PRO PRO CCC . n C 2 31 ASN 31 864 864 ASN ASN CCC . n C 2 32 LEU 32 865 865 LEU LEU CCC . n C 2 33 LEU 33 866 866 LEU LEU CCC . n C 2 34 GLU 34 867 867 GLU GLU CCC . n C 2 35 LEU 35 868 868 LEU LEU CCC . n C 2 36 PHE 36 869 869 PHE PHE CCC . n C 2 37 GLY 37 870 870 GLY GLY CCC . n C 2 38 THR 38 871 871 THR THR CCC . n C 2 39 ILE 39 872 872 ILE ILE CCC . n C 2 40 LEU 40 873 873 LEU LEU CCC . n C 2 41 PRO 41 874 874 PRO PRO CCC . n C 2 42 LEU 42 875 875 LEU LEU CCC . n C 2 43 ASP 43 876 876 ASP ASP CCC . n C 2 44 LEU 44 877 877 LEU LEU CCC . n C 2 45 GLU 45 878 878 GLU GLU CCC . n C 2 46 ASP 46 879 879 ASP ASP CCC . n C 2 47 ILE 47 880 880 ILE ILE CCC . n C 2 48 PHE 48 881 881 PHE PHE CCC . n C 2 49 LYS 49 882 882 LYS LYS CCC . n C 2 50 LYS 50 883 883 LYS LYS CCC . n C 2 51 SER 51 884 ? ? ? CCC . n C 2 52 LYS 52 885 ? ? ? CCC . n C 2 53 PRO 53 886 ? ? ? CCC . n C 2 54 ARG 54 887 ? ? ? CCC . n C 2 55 TYR 55 888 ? ? ? CCC . n C 2 56 HIS 56 889 ? ? ? CCC . n C 2 57 LYS 57 890 ? ? ? CCC . n C 2 58 ARG 58 891 ? ? ? CCC . n D 2 1 ASP 1 834 ? ? ? DDD . n D 2 2 GLU 2 835 ? ? ? DDD . n D 2 3 ALA 3 836 ? ? ? DDD . n D 2 4 HIS 4 837 ? ? ? DDD . n D 2 5 PRO 5 838 ? ? ? DDD . n D 2 6 ARG 6 839 ? ? ? DDD . n D 2 7 LYS 7 840 ? ? ? DDD . n D 2 8 PRO 8 841 841 PRO PRO DDD . n D 2 9 ILE 9 842 842 ILE ILE DDD . n D 2 10 PRO 10 843 843 PRO PRO DDD . n D 2 11 THR 11 844 844 THR THR DDD . n D 2 12 TRP 12 845 845 TRP TRP DDD . n D 2 13 ALA 13 846 846 ALA ALA DDD . n D 2 14 ARG 14 847 847 ARG ARG DDD . n D 2 15 GLY 15 848 848 GLY GLY DDD . n D 2 16 THR 16 849 849 THR THR DDD . n D 2 17 PRO 17 850 850 PRO PRO DDD . n D 2 18 LEU 18 851 851 LEU LEU DDD . n D 2 19 SER 19 852 852 SER SER DDD . n D 2 20 GLN 20 853 853 GLN GLN DDD . n D 2 21 ALA 21 854 854 ALA ALA DDD . n D 2 22 ILE 22 855 855 ILE ILE DDD . n D 2 23 ILE 23 856 856 ILE ILE DDD . n D 2 24 HIS 24 857 857 HIS HIS DDD . n D 2 25 GLN 25 858 858 GLN GLN DDD . n D 2 26 TYR 26 859 859 TYR TYR DDD . n D 2 27 TYR 27 860 860 TYR TYR DDD . n D 2 28 HIS 28 861 861 HIS HIS DDD . n D 2 29 PRO 29 862 862 PRO PRO DDD . n D 2 30 PRO 30 863 863 PRO PRO DDD . n D 2 31 ASN 31 864 864 ASN ASN DDD . n D 2 32 LEU 32 865 865 LEU LEU DDD . n D 2 33 LEU 33 866 866 LEU LEU DDD . n D 2 34 GLU 34 867 867 GLU GLU DDD . n D 2 35 LEU 35 868 868 LEU LEU DDD . n D 2 36 PHE 36 869 869 PHE PHE DDD . n D 2 37 GLY 37 870 870 GLY GLY DDD . n D 2 38 THR 38 871 871 THR THR DDD . n D 2 39 ILE 39 872 872 ILE ILE DDD . n D 2 40 LEU 40 873 873 LEU LEU DDD . n D 2 41 PRO 41 874 874 PRO PRO DDD . n D 2 42 LEU 42 875 875 LEU LEU DDD . n D 2 43 ASP 43 876 876 ASP ASP DDD . n D 2 44 LEU 44 877 877 LEU LEU DDD . n D 2 45 GLU 45 878 878 GLU GLU DDD . n D 2 46 ASP 46 879 879 ASP ASP DDD . n D 2 47 ILE 47 880 880 ILE ILE DDD . n D 2 48 PHE 48 881 881 PHE PHE DDD . n D 2 49 LYS 49 882 882 LYS LYS DDD . n D 2 50 LYS 50 883 883 LYS LYS DDD . n D 2 51 SER 51 884 884 SER SER DDD . n D 2 52 LYS 52 885 ? ? ? DDD . n D 2 53 PRO 53 886 ? ? ? DDD . n D 2 54 ARG 54 887 ? ? ? DDD . n D 2 55 TYR 55 888 ? ? ? DDD . n D 2 56 HIS 56 889 ? ? ? DDD . n D 2 57 LYS 57 890 ? ? ? DDD . n D 2 58 ARG 58 891 ? ? ? DDD . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 EDO 1 400 400 EDO EDO BBB . F 4 HOH 1 401 54 HOH HOH AAA . F 4 HOH 2 402 48 HOH HOH AAA . F 4 HOH 3 403 24 HOH HOH AAA . F 4 HOH 4 404 41 HOH HOH AAA . F 4 HOH 5 405 27 HOH HOH AAA . F 4 HOH 6 406 5 HOH HOH AAA . F 4 HOH 7 407 52 HOH HOH AAA . F 4 HOH 8 408 22 HOH HOH AAA . F 4 HOH 9 409 12 HOH HOH AAA . F 4 HOH 10 410 9 HOH HOH AAA . F 4 HOH 11 411 43 HOH HOH AAA . F 4 HOH 12 412 15 HOH HOH AAA . F 4 HOH 13 413 23 HOH HOH AAA . F 4 HOH 14 414 56 HOH HOH AAA . F 4 HOH 15 415 28 HOH HOH AAA . F 4 HOH 16 416 6 HOH HOH AAA . F 4 HOH 17 417 1 HOH HOH AAA . F 4 HOH 18 418 25 HOH HOH AAA . F 4 HOH 19 419 53 HOH HOH AAA . F 4 HOH 20 420 40 HOH HOH AAA . F 4 HOH 21 421 8 HOH HOH AAA . F 4 HOH 22 422 13 HOH HOH AAA . F 4 HOH 23 423 17 HOH HOH AAA . F 4 HOH 24 424 51 HOH HOH AAA . F 4 HOH 25 425 26 HOH HOH AAA . F 4 HOH 26 426 39 HOH HOH AAA . F 4 HOH 27 427 4 HOH HOH AAA . F 4 HOH 28 428 3 HOH HOH AAA . G 4 HOH 1 501 10 HOH HOH BBB . G 4 HOH 2 502 7 HOH HOH BBB . G 4 HOH 3 503 11 HOH HOH BBB . G 4 HOH 4 504 20 HOH HOH BBB . G 4 HOH 5 505 35 HOH HOH BBB . G 4 HOH 6 506 47 HOH HOH BBB . G 4 HOH 7 507 45 HOH HOH BBB . G 4 HOH 8 508 38 HOH HOH BBB . G 4 HOH 9 509 18 HOH HOH BBB . G 4 HOH 10 510 37 HOH HOH BBB . G 4 HOH 11 511 49 HOH HOH BBB . G 4 HOH 12 512 21 HOH HOH BBB . G 4 HOH 13 513 46 HOH HOH BBB . G 4 HOH 14 514 32 HOH HOH BBB . G 4 HOH 15 515 34 HOH HOH BBB . G 4 HOH 16 516 44 HOH HOH BBB . G 4 HOH 17 517 14 HOH HOH BBB . G 4 HOH 18 518 31 HOH HOH BBB . G 4 HOH 19 519 16 HOH HOH BBB . G 4 HOH 20 520 2 HOH HOH BBB . G 4 HOH 21 521 30 HOH HOH BBB . G 4 HOH 22 522 36 HOH HOH BBB . G 4 HOH 23 523 33 HOH HOH BBB . G 4 HOH 24 524 29 HOH HOH BBB . G 4 HOH 25 525 55 HOH HOH BBB . H 4 HOH 1 901 50 HOH HOH CCC . I 4 HOH 1 901 19 HOH HOH DDD . I 4 HOH 2 902 42 HOH HOH DDD . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? 1.3.6sp3 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? 1.3.6sp3 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9ESA _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.280 _cell.length_a_esd ? _cell.length_b 79.490 _cell.length_b_esd ? _cell.length_c 265.240 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9ESA _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ESA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris pH5.5, 0.025-0.05 M ammonium sulphate, 9-12% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2006-04-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5405 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5405 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9ESA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.80 _reflns.d_resolution_low 19.87 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21012 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.126 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2057 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.350 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.348 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -4.312 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 4.659 _refine.B_iso_max ? _refine.B_iso_mean 69.968 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.886 _refine.details 'Hydrogens have been added in their riding positions.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9ESA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.800 _refine.ls_d_res_low 19.87 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20966 _refine.ls_number_reflns_R_free 1075 _refine.ls_number_reflns_R_work 19891 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.252 _refine.ls_percent_reflns_R_free 5.127 _refine.ls_R_factor_all 0.231 _refine.ls_R_factor_obs 0.2313 _refine.ls_R_factor_R_free 0.2940 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2279 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.433 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 43.446 _refine.overall_SU_ML 0.390 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 5214 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 5274 _refine_hist.d_res_high 2.800 _refine_hist.d_res_low 19.87 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.013 5379 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 5222 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.279 1.650 7293 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.052 1.575 12041 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.453 5.000 639 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.310 20.600 300 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.002 15.000 956 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.167 15.000 49 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.048 0.200 676 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 5912 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1238 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 1065 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.172 0.200 4664 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.156 0.200 2476 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 2606 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.134 0.200 93 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.276 0.200 15 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.210 0.200 60 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.055 0.200 1 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.087 3.604 2553 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.081 3.604 2552 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.054 8.095 3187 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.055 8.097 3188 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.202 3.927 2826 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.201 3.927 2826 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.297 8.619 4104 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.297 8.620 4105 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.902 43.238 5774 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.897 43.222 5772 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 0.099 0.050 8489 ? r_ncsr_local_group_1 ? ? 'X-RAY DIFFRACTION' ? 0.097 0.050 1139 ? r_ncsr_local_group_2 ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? 0.09864 ? 0.05009 1 'Local ncs' ? AAA ? ? ? 1 'X-RAY DIFFRACTION' 2 ? ? 0.09864 ? 0.05009 2 'Local ncs' ? BBB ? ? ? 1 'X-RAY DIFFRACTION' 3 ? ? 0.09734 ? 0.05007 3 'Local ncs' ? CCC ? ? ? 2 'X-RAY DIFFRACTION' 4 ? ? 0.09734 ? 0.05007 4 'Local ncs' ? DDD ? ? ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.800 2.871 . . 63 1415 99.8649 . . . . 0.364 . . . . . . . . . . . 0.395 'X-RAY DIFFRACTION' 2.871 2.948 . . 79 1435 100.0000 . . . . 0.318 . . . . . . . . . . . 0.402 'X-RAY DIFFRACTION' 2.948 3.032 . . 69 1314 100.0000 . . . . 0.294 . . . . . . . . . . . 0.332 'X-RAY DIFFRACTION' 3.032 3.123 . . 80 1374 100.0000 . . . . 0.289 . . . . . . . . . . . 0.331 'X-RAY DIFFRACTION' 3.123 3.223 . . 64 1254 99.9242 . . . . 0.238 . . . . . . . . . . . 0.221 'X-RAY DIFFRACTION' 3.223 3.333 . . 70 1245 99.9240 . . . . 0.241 . . . . . . . . . . . 0.313 'X-RAY DIFFRACTION' 3.333 3.455 . . 70 1195 100.0000 . . . . 0.250 . . . . . . . . . . . 0.324 'X-RAY DIFFRACTION' 3.455 3.591 . . 60 1162 99.8366 . . . . 0.228 . . . . . . . . . . . 0.255 'X-RAY DIFFRACTION' 3.591 3.745 . . 59 1126 99.4962 . . . . 0.244 . . . . . . . . . . . 0.315 'X-RAY DIFFRACTION' 3.745 3.921 . . 63 1050 99.9102 . . . . 0.216 . . . . . . . . . . . 0.318 'X-RAY DIFFRACTION' 3.921 4.124 . . 51 1020 99.6279 . . . . 0.221 . . . . . . . . . . . 0.334 'X-RAY DIFFRACTION' 4.124 4.363 . . 55 970 99.7082 . . . . 0.204 . . . . . . . . . . . 0.220 'X-RAY DIFFRACTION' 4.363 4.648 . . 43 944 99.6970 . . . . 0.182 . . . . . . . . . . . 0.231 'X-RAY DIFFRACTION' 4.648 4.998 . . 48 847 99.8884 . . . . 0.209 . . . . . . . . . . . 0.302 'X-RAY DIFFRACTION' 4.998 5.441 . . 49 788 99.4062 . . . . 0.238 . . . . . . . . . . . 0.392 'X-RAY DIFFRACTION' 5.441 6.027 . . 46 723 99.3540 . . . . 0.232 . . . . . . . . . . . 0.266 'X-RAY DIFFRACTION' 6.027 6.855 . . 41 651 98.8571 . . . . 0.216 . . . . . . . . . . . 0.315 'X-RAY DIFFRACTION' 6.855 8.156 . . 32 579 98.3897 . . . . 0.190 . . . . . . . . . . . 0.240 'X-RAY DIFFRACTION' 8.156 10.671 . . 16 466 96.7871 . . . . 0.175 . . . . . . . . . . . 0.199 'X-RAY DIFFRACTION' 10.671 19.87 . . 17 333 94.8510 . . . . 0.209 . . . . . . . . . . . 0.239 # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 AAA 2 1 BBB 3 2 CCC 4 2 DDD # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 26 . A GLN 300 . AAA SER 32 AAA GLN 306 ? ? 1 2 2 B SER 26 . B GLN 300 . BBB SER 32 BBB GLN 306 ? ? 2 3 3 C PRO 8 . C LYS 49 . CCC PRO 841 CCC LYS 882 ? ? 2 4 4 D PRO 8 . D LYS 49 . DDD PRO 841 DDD LYS 882 ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 'Local NCS retraints between domains: 1 2' 2 'Local NCS retraints between domains: 3 4' # _struct.entry_id 9ESA _struct.title 'Aurora-C with SER mutation in complex with INCENP peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ESA _struct_keywords.text 'surface entropy reduction, SER, KINASE, TRANSFERASE, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP AURKC_HUMAN Q9UQB9 ? 1 ;AQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREI EIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENL LLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRIL KVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS ; 13 2 UNP INCE_HUMAN Q9NQS7 ? 2 DEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKR 834 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9ESA AAA 7 ? 303 ? Q9UQB9 13 ? 309 ? 13 309 2 1 9ESA BBB 7 ? 303 ? Q9UQB9 13 ? 309 ? 13 309 3 2 9ESA CCC 1 ? 58 ? Q9NQS7 834 ? 891 ? 834 891 4 2 9ESA DDD 1 ? 58 ? Q9NQS7 834 ? 891 ? 834 891 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ESA HIS AAA 1 ? UNP Q9UQB9 ? ? 'expression tag' 7 1 1 9ESA HIS AAA 2 ? UNP Q9UQB9 ? ? 'expression tag' 8 2 1 9ESA HIS AAA 3 ? UNP Q9UQB9 ? ? 'expression tag' 9 3 1 9ESA HIS AAA 4 ? UNP Q9UQB9 ? ? 'expression tag' 10 4 1 9ESA HIS AAA 5 ? UNP Q9UQB9 ? ? 'expression tag' 11 5 1 9ESA HIS AAA 6 ? UNP Q9UQB9 ? ? 'expression tag' 12 6 1 9ESA ALA AAA 189 ? UNP Q9UQB9 ARG 195 'engineered mutation' 195 7 1 9ESA ALA AAA 190 ? UNP Q9UQB9 ARG 196 'engineered mutation' 196 8 1 9ESA ALA AAA 191 ? UNP Q9UQB9 LYS 197 'engineered mutation' 197 9 2 9ESA HIS BBB 1 ? UNP Q9UQB9 ? ? 'expression tag' 7 10 2 9ESA HIS BBB 2 ? UNP Q9UQB9 ? ? 'expression tag' 8 11 2 9ESA HIS BBB 3 ? UNP Q9UQB9 ? ? 'expression tag' 9 12 2 9ESA HIS BBB 4 ? UNP Q9UQB9 ? ? 'expression tag' 10 13 2 9ESA HIS BBB 5 ? UNP Q9UQB9 ? ? 'expression tag' 11 14 2 9ESA HIS BBB 6 ? UNP Q9UQB9 ? ? 'expression tag' 12 15 2 9ESA ALA BBB 189 ? UNP Q9UQB9 ARG 195 'engineered mutation' 195 16 2 9ESA ALA BBB 190 ? UNP Q9UQB9 ARG 196 'engineered mutation' 196 17 2 9ESA ALA BBB 191 ? UNP Q9UQB9 LYS 197 'engineered mutation' 197 18 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3340 ? 1 MORE -27 ? 1 'SSA (A^2)' 17010 ? 2 'ABSA (A^2)' 3560 ? 2 MORE -26 ? 2 'SSA (A^2)' 16860 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,F,H 2 1 B,D,E,G,I # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 33 ? ASP A 35 ? THR AAA 39 ASP AAA 41 5 ? 3 HELX_P HELX_P2 AA2 LYS A 70 ? GLU A 76 ? LYS AAA 76 GLU AAA 82 1 ? 7 HELX_P HELX_P3 AA3 LEU A 78 ? LEU A 92 ? LEU AAA 84 LEU AAA 98 1 ? 15 HELX_P HELX_P4 AA4 GLU A 121 ? GLU A 130 ? GLU AAA 127 GLU AAA 136 1 ? 10 HELX_P HELX_P5 AA5 ASP A 133 ? LYS A 154 ? ASP AAA 139 LYS AAA 160 1 ? 22 HELX_P HELX_P6 AA6 LYS A 162 ? GLU A 164 ? LYS AAA 168 GLU AAA 170 5 ? 3 HELX_P HELX_P7 AA7 SER A 187 ? GLY A 195 ? SER AAA 193 GLY AAA 201 1 ? 9 HELX_P HELX_P8 AA8 THR A 196 ? LEU A 200 ? THR AAA 202 LEU AAA 206 5 ? 5 HELX_P HELX_P9 AA9 PRO A 201 ? GLU A 206 ? PRO AAA 207 GLU AAA 212 1 ? 6 HELX_P HELX_P10 AB1 LYS A 213 ? GLY A 229 ? LYS AAA 219 GLY AAA 235 1 ? 17 HELX_P HELX_P11 AB2 SER A 237 ? LYS A 247 ? SER AAA 243 LYS AAA 253 1 ? 11 HELX_P HELX_P12 AB3 PRO A 257 ? LEU A 268 ? PRO AAA 263 LEU AAA 274 1 ? 12 HELX_P HELX_P13 AB4 GLN A 271 ? ARG A 275 ? GLN AAA 277 ARG AAA 281 5 ? 5 HELX_P HELX_P14 AB5 PRO A 277 ? LYS A 283 ? PRO AAA 283 LYS AAA 289 1 ? 7 HELX_P HELX_P15 AB6 HIS A 284 ? SER A 291 ? HIS AAA 290 SER AAA 297 1 ? 8 HELX_P HELX_P16 AB7 THR B 33 ? ASP B 35 ? THR BBB 39 ASP BBB 41 5 ? 3 HELX_P HELX_P17 AB8 LYS B 70 ? GLU B 76 ? LYS BBB 76 GLU BBB 82 1 ? 7 HELX_P HELX_P18 AB9 LEU B 78 ? LEU B 92 ? LEU BBB 84 LEU BBB 98 1 ? 15 HELX_P HELX_P19 AC1 GLU B 121 ? GLU B 130 ? GLU BBB 127 GLU BBB 136 1 ? 10 HELX_P HELX_P20 AC2 ASP B 133 ? LYS B 154 ? ASP BBB 139 LYS BBB 160 1 ? 22 HELX_P HELX_P21 AC3 LYS B 162 ? GLU B 164 ? LYS BBB 168 GLU BBB 170 5 ? 3 HELX_P HELX_P22 AC4 SER B 187 ? GLY B 195 ? SER BBB 193 GLY BBB 201 1 ? 9 HELX_P HELX_P23 AC5 THR B 196 ? LEU B 200 ? THR BBB 202 LEU BBB 206 5 ? 5 HELX_P HELX_P24 AC6 PRO B 201 ? GLU B 206 ? PRO BBB 207 GLU BBB 212 1 ? 6 HELX_P HELX_P25 AC7 LYS B 213 ? GLY B 229 ? LYS BBB 219 GLY BBB 235 1 ? 17 HELX_P HELX_P26 AC8 SER B 237 ? LYS B 247 ? SER BBB 243 LYS BBB 253 1 ? 11 HELX_P HELX_P27 AC9 PRO B 257 ? LEU B 268 ? PRO BBB 263 LEU BBB 274 1 ? 12 HELX_P HELX_P28 AD1 GLN B 271 ? ARG B 275 ? GLN BBB 277 ARG BBB 281 5 ? 5 HELX_P HELX_P29 AD2 PRO B 277 ? LYS B 283 ? PRO BBB 283 LYS BBB 289 1 ? 7 HELX_P HELX_P30 AD3 HIS B 284 ? SER B 291 ? HIS BBB 290 SER BBB 297 1 ? 8 HELX_P HELX_P31 AD4 PRO C 10 ? ALA C 13 ? PRO CCC 843 ALA CCC 846 5 ? 4 HELX_P HELX_P32 AD5 ARG C 14 ? HIS C 28 ? ARG CCC 847 HIS CCC 861 1 ? 15 HELX_P HELX_P33 AD6 ASN C 31 ? GLY C 37 ? ASN CCC 864 GLY CCC 870 1 ? 7 HELX_P HELX_P34 AD7 ASP C 43 ? PHE C 48 ? ASP CCC 876 PHE CCC 881 1 ? 6 HELX_P HELX_P35 AD8 PRO D 10 ? ALA D 13 ? PRO DDD 843 ALA DDD 846 5 ? 4 HELX_P HELX_P36 AD9 ARG D 14 ? HIS D 28 ? ARG DDD 847 HIS DDD 861 1 ? 15 HELX_P HELX_P37 AE1 ASN D 31 ? GLY D 37 ? ASN DDD 864 GLY DDD 870 1 ? 7 HELX_P HELX_P38 AE2 ASP D 43 ? PHE D 48 ? ASP DDD 876 PHE DDD 881 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 37 ? LYS A 45 ? PHE AAA 43 LYS AAA 51 AA1 2 ASN A 50 ? LEU A 56 ? ASN AAA 56 LEU AAA 62 AA1 3 ILE A 62 ? PHE A 69 ? ILE AAA 68 PHE AAA 75 AA1 4 ARG A 109 ? LEU A 114 ? ARG AAA 115 LEU AAA 120 AA1 5 LEU A 100 ? HIS A 105 ? LEU AAA 106 HIS AAA 111 AA2 1 LEU A 166 ? LEU A 168 ? LEU AAA 172 LEU AAA 174 AA2 2 VAL A 174 ? ILE A 176 ? VAL AAA 180 ILE AAA 182 AA3 1 PHE B 37 ? LYS B 45 ? PHE BBB 43 LYS BBB 51 AA3 2 ASN B 50 ? LEU B 56 ? ASN BBB 56 LEU BBB 62 AA3 3 ILE B 62 ? PHE B 69 ? ILE BBB 68 PHE BBB 75 AA3 4 ARG B 109 ? LEU B 114 ? ARG BBB 115 LEU BBB 120 AA3 5 LEU B 100 ? HIS B 105 ? LEU BBB 106 HIS BBB 111 AA4 1 LEU B 166 ? LEU B 168 ? LEU BBB 172 LEU BBB 174 AA4 2 VAL B 174 ? ILE B 176 ? VAL BBB 180 ILE BBB 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 43 ? N LEU AAA 49 O VAL A 51 ? O VAL AAA 57 AA1 2 3 N TYR A 52 ? N TYR AAA 58 O LEU A 65 ? O LEU AAA 71 AA1 3 4 N LEU A 68 ? N LEU AAA 74 O VAL A 110 ? O VAL AAA 116 AA1 4 5 O TYR A 111 ? O TYR AAA 117 N PHE A 104 ? N PHE AAA 110 AA2 1 2 N LEU A 167 ? N LEU AAA 173 O LYS A 175 ? O LYS AAA 181 AA3 1 2 N LEU B 43 ? N LEU BBB 49 O VAL B 51 ? O VAL BBB 57 AA3 2 3 N TYR B 52 ? N TYR BBB 58 O LEU B 65 ? O LEU BBB 71 AA3 3 4 N LEU B 68 ? N LEU BBB 74 O VAL B 110 ? O VAL BBB 116 AA3 4 5 O TYR B 111 ? O TYR BBB 117 N PHE B 104 ? N PHE BBB 110 AA4 1 2 N LEU B 167 ? N LEU BBB 173 O LYS B 175 ? O LYS BBB 181 # _pdbx_entry_details.entry_id 9ESA _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO AAA 33 ? ? -69.81 -87.79 2 1 ALA AAA 34 ? ? -150.30 45.76 3 1 MET AAA 35 ? ? -116.22 -71.20 4 1 GLU AAA 136 ? ? 67.46 -58.75 5 1 ASP AAA 184 ? ? 179.07 -174.45 6 1 THR AAA 191 ? ? -44.30 103.10 7 1 ASP AAA 217 ? ? -124.85 -166.59 8 1 SER AAA 241 ? ? -151.10 -154.60 9 1 LEU AAA 282 ? ? -46.87 109.91 10 1 PRO BBB 33 ? ? -70.99 -92.96 11 1 ALA BBB 34 ? ? -152.31 36.22 12 1 GLU BBB 136 ? ? 67.22 -59.18 13 1 LYS BBB 168 ? ? -171.19 149.43 14 1 ASP BBB 184 ? ? 178.73 -174.57 15 1 THR BBB 191 ? ? -43.19 102.18 16 1 ASP BBB 217 ? ? -126.34 -166.43 17 1 SER BBB 241 ? ? -151.14 -154.32 18 1 LEU BBB 282 ? ? -47.77 109.89 19 1 ALA CCC 846 ? ? -97.16 32.61 20 1 ALA DDD 846 ? ? -96.59 31.27 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 AAA _pdbx_validate_peptide_omega.auth_seq_id_1 213 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ARG _pdbx_validate_peptide_omega.auth_asym_id_2 AAA _pdbx_validate_peptide_omega.auth_seq_id_2 214 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -147.41 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -0.7450 -18.6350 -39.8700 0.2244 ? 0.0957 ? -0.0438 ? 0.3820 ? -0.0467 ? 0.0482 ? 4.4097 ? 1.2033 ? -0.2203 ? 3.8749 ? 1.0157 ? 6.9037 ? -0.0415 ? -0.2747 ? 0.3991 ? 0.5175 ? 0.0861 ? -0.0891 ? -0.1369 ? -0.0793 ? -0.0447 ? 2 'X-RAY DIFFRACTION' ? refined 20.2480 -27.6270 -53.5980 0.2807 ? 0.0308 ? -0.0192 ? 0.6014 ? 0.0049 ? 0.0591 ? 3.9912 ? -0.2158 ? 1.0078 ? 1.8599 ? 0.2110 ? 3.6092 ? 0.0838 ? 0.1595 ? 0.2166 ? 0.1379 ? -0.0089 ? -0.2995 ? 0.0759 ? 0.5806 ? -0.0749 ? 3 'X-RAY DIFFRACTION' ? refined -21.0960 0.7280 -26.4500 0.2219 ? 0.0870 ? -0.0493 ? 0.4968 ? -0.0499 ? 0.0537 ? 3.9198 ? 0.9346 ? 0.7264 ? 4.7184 ? -0.4094 ? 5.8812 ? 0.0507 ? 0.5819 ? -0.0620 ? -0.2934 ? -0.0206 ? 0.4619 ? -0.1663 ? -0.1971 ? -0.0301 ? 4 'X-RAY DIFFRACTION' ? refined -12.0300 -20.3960 -12.6160 0.4098 ? 0.0312 ? 0.0206 ? 0.5392 ? 0.0027 ? 0.0591 ? 1.3962 ? -0.3475 ? 0.5342 ? 4.4769 ? 0.9596 ? 3.5035 ? 0.0058 ? 0.0427 ? -0.2734 ? 0.2187 ? 0.0415 ? 0.2146 ? 0.6394 ? 0.1032 ? -0.0473 ? 5 'X-RAY DIFFRACTION' ? refined -6.1910 -20.8910 -45.2550 0.1724 ? 0.0610 ? -0.0006 ? 0.5407 ? -0.0251 ? 0.1033 ? 3.2704 ? 0.6544 ? 1.8035 ? 1.1870 ? 1.2427 ? 6.9676 ? -0.2187 ? -0.0414 ? 0.4486 ? 0.2174 ? 0.0818 ? 0.2520 ? 0.0587 ? -0.2482 ? 0.1369 ? 6 'X-RAY DIFFRACTION' ? refined -19.0540 6.0360 -21.2770 0.2412 ? 0.1247 ? -0.0162 ? 0.4390 ? -0.0242 ? 0.0322 ? 2.3197 ? 1.2351 ? 2.1927 ? 4.9430 ? 0.9365 ? 6.0555 ? -0.0708 ? 0.2452 ? 0.0650 ? -0.0734 ? -0.1054 ? 0.3650 ? -0.5992 ? 0.0113 ? 0.1762 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? AAA 32 ? ? ? AAA 123 ? ALL ? 2 'X-RAY DIFFRACTION' 2 ? ? AAA 124 ? ? ? AAA 306 ? ALL ? 3 'X-RAY DIFFRACTION' 3 ? ? BBB 32 ? ? ? BBB 123 ? ALL ? 4 'X-RAY DIFFRACTION' 4 ? ? BBB 124 ? ? ? BBB 306 ? ALL ? 5 'X-RAY DIFFRACTION' 5 ? ? CCC 841 ? ? ? CCC 883 ? ALL ? 6 'X-RAY DIFFRACTION' 6 ? ? DDD 841 ? ? ? DDD 884 ? ALL ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA HIS 7 ? A HIS 1 2 1 Y 1 AAA HIS 8 ? A HIS 2 3 1 Y 1 AAA HIS 9 ? A HIS 3 4 1 Y 1 AAA HIS 10 ? A HIS 4 5 1 Y 1 AAA HIS 11 ? A HIS 5 6 1 Y 1 AAA HIS 12 ? A HIS 6 7 1 Y 1 AAA ALA 13 ? A ALA 7 8 1 Y 1 AAA GLN 14 ? A GLN 8 9 1 Y 1 AAA PRO 15 ? A PRO 9 10 1 Y 1 AAA ALA 16 ? A ALA 10 11 1 Y 1 AAA GLY 17 ? A GLY 11 12 1 Y 1 AAA GLU 18 ? A GLU 12 13 1 Y 1 AAA GLU 19 ? A GLU 13 14 1 Y 1 AAA LEU 20 ? A LEU 14 15 1 Y 1 AAA ALA 21 ? A ALA 15 16 1 Y 1 AAA THR 22 ? A THR 16 17 1 Y 1 AAA ALA 23 ? A ALA 17 18 1 Y 1 AAA ASN 24 ? A ASN 18 19 1 Y 1 AAA GLN 25 ? A GLN 19 20 1 Y 1 AAA THR 26 ? A THR 20 21 1 Y 1 AAA ALA 27 ? A ALA 21 22 1 Y 1 AAA GLN 28 ? A GLN 22 23 1 Y 1 AAA GLN 29 ? A GLN 23 24 1 Y 1 AAA PRO 30 ? A PRO 24 25 1 Y 1 AAA SER 31 ? A SER 25 26 1 Y 1 AAA MET 307 ? A MET 301 27 1 Y 1 AAA ALA 308 ? A ALA 302 28 1 Y 1 AAA SER 309 ? A SER 303 29 1 Y 1 BBB HIS 7 ? B HIS 1 30 1 Y 1 BBB HIS 8 ? B HIS 2 31 1 Y 1 BBB HIS 9 ? B HIS 3 32 1 Y 1 BBB HIS 10 ? B HIS 4 33 1 Y 1 BBB HIS 11 ? B HIS 5 34 1 Y 1 BBB HIS 12 ? B HIS 6 35 1 Y 1 BBB ALA 13 ? B ALA 7 36 1 Y 1 BBB GLN 14 ? B GLN 8 37 1 Y 1 BBB PRO 15 ? B PRO 9 38 1 Y 1 BBB ALA 16 ? B ALA 10 39 1 Y 1 BBB GLY 17 ? B GLY 11 40 1 Y 1 BBB GLU 18 ? B GLU 12 41 1 Y 1 BBB GLU 19 ? B GLU 13 42 1 Y 1 BBB LEU 20 ? B LEU 14 43 1 Y 1 BBB ALA 21 ? B ALA 15 44 1 Y 1 BBB THR 22 ? B THR 16 45 1 Y 1 BBB ALA 23 ? B ALA 17 46 1 Y 1 BBB ASN 24 ? B ASN 18 47 1 Y 1 BBB GLN 25 ? B GLN 19 48 1 Y 1 BBB THR 26 ? B THR 20 49 1 Y 1 BBB ALA 27 ? B ALA 21 50 1 Y 1 BBB GLN 28 ? B GLN 22 51 1 Y 1 BBB GLN 29 ? B GLN 23 52 1 Y 1 BBB PRO 30 ? B PRO 24 53 1 Y 1 BBB SER 31 ? B SER 25 54 1 Y 1 BBB MET 307 ? B MET 301 55 1 Y 1 BBB ALA 308 ? B ALA 302 56 1 Y 1 BBB SER 309 ? B SER 303 57 1 Y 1 CCC ASP 834 ? C ASP 1 58 1 Y 1 CCC GLU 835 ? C GLU 2 59 1 Y 1 CCC ALA 836 ? C ALA 3 60 1 Y 1 CCC HIS 837 ? C HIS 4 61 1 Y 1 CCC PRO 838 ? C PRO 5 62 1 Y 1 CCC ARG 839 ? C ARG 6 63 1 Y 1 CCC LYS 840 ? C LYS 7 64 1 Y 1 CCC SER 884 ? C SER 51 65 1 Y 1 CCC LYS 885 ? C LYS 52 66 1 Y 1 CCC PRO 886 ? C PRO 53 67 1 Y 1 CCC ARG 887 ? C ARG 54 68 1 Y 1 CCC TYR 888 ? C TYR 55 69 1 Y 1 CCC HIS 889 ? C HIS 56 70 1 Y 1 CCC LYS 890 ? C LYS 57 71 1 Y 1 CCC ARG 891 ? C ARG 58 72 1 Y 1 DDD ASP 834 ? D ASP 1 73 1 Y 1 DDD GLU 835 ? D GLU 2 74 1 Y 1 DDD ALA 836 ? D ALA 3 75 1 Y 1 DDD HIS 837 ? D HIS 4 76 1 Y 1 DDD PRO 838 ? D PRO 5 77 1 Y 1 DDD ARG 839 ? D ARG 6 78 1 Y 1 DDD LYS 840 ? D LYS 7 79 1 Y 1 DDD LYS 885 ? D LYS 52 80 1 Y 1 DDD PRO 886 ? D PRO 53 81 1 Y 1 DDD ARG 887 ? D ARG 54 82 1 Y 1 DDD TYR 888 ? D TYR 55 83 1 Y 1 DDD HIS 889 ? D HIS 56 84 1 Y 1 DDD LYS 890 ? D LYS 57 85 1 Y 1 DDD ARG 891 ? D ARG 58 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2BFY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9ESA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012614 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012580 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003770 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_asym_id _atom_site.label_entity_id _atom_site.label_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.B_iso_or_equiv _atom_site.pdbx_formal_charge _atom_site.auth_seq_id _atom_site.auth_comp_id _atom_site.auth_asym_id _atom_site.auth_atom_id _atom_site.pdbx_PDB_model_num _atom_site.calc_flag _atom_site.pdbx_tls_group_id ATOM 1 N N . SER A 1 26 ? -18.033 -9.504 -48.754 1.000 132.210 0 32 SER AAA N 1 ? 1 ATOM 2 C CA . SER A 1 26 ? -16.727 -9.085 -48.150 1.000 128.821 0 32 SER AAA CA 1 ? 1 ATOM 3 C C . SER A 1 26 ? -16.313 -7.719 -48.700 1.000 134.972 0 32 SER AAA C 1 ? 1 ATOM 4 O O . SER A 1 26 ? -15.709 -7.646 -49.766 1.000 135.744 0 32 SER AAA O 1 ? 1 ATOM 5 C CB . SER A 1 26 ? -15.655 -10.128 -48.374 1.000 125.401 0 32 SER AAA CB 1 ? 1 ATOM 6 O OG . SER A 1 26 ? -15.682 -11.118 -47.357 1.000 127.096 0 32 SER AAA OG 1 ? 1 ATOM 7 N N . PRO A 1 27 ? -16.650 -6.598 -48.015 1.000 146.414 0 33 PRO AAA N 1 ? 1 ATOM 8 C CA . PRO A 1 27 ? -16.301 -5.255 -48.488 1.000 152.124 0 33 PRO AAA CA 1 ? 1 ATOM 9 C C . PRO A 1 27 ? -14.790 -4.967 -48.404 1.000 147.816 0 33 PRO AAA C 1 ? 1 ATOM 10 O O . PRO A 1 27 ? -14.118 -5.216 -49.386 1.000 151.665 0 33 PRO AAA O 1 ? 1 ATOM 11 C CB . PRO A 1 27 ? -17.147 -4.306 -47.610 1.000 158.275 0 33 PRO AAA CB 1 ? 1 ATOM 12 C CG . PRO A 1 27 ? -18.121 -5.203 -46.867 1.000 156.549 0 33 PRO AAA CG 1 ? 1 ATOM 13 C CD . PRO A 1 27 ? -17.445 -6.553 -46.779 1.000 151.970 0 33 PRO AAA CD 1 ? 1 ATOM 14 N N . ALA A 1 28 ? -14.281 -4.469 -47.271 1.000 140.428 0 34 ALA AAA N 1 ? 1 ATOM 15 C CA . ALA A 1 28 ? -12.834 -4.245 -47.027 1.000 131.500 0 34 ALA AAA CA 1 ? 1 ATOM 16 C C . ALA A 1 28 ? -12.544 -4.395 -45.528 1.000 127.718 0 34 ALA AAA C 1 ? 1 ATOM 17 O O . ALA A 1 28 ? -11.823 -3.550 -44.960 1.000 126.734 0 34 ALA AAA O 1 ? 1 ATOM 18 C CB . ALA A 1 28 ? -12.420 -2.895 -47.559 1.000 133.893 0 34 ALA AAA CB 1 ? 1 ATOM 19 N N . MET A 1 29 ? -13.093 -5.455 -44.923 1.000 124.718 0 35 MET AAA N 1 ? 1 ATOM 20 C CA . MET A 1 29 ? -12.985 -5.768 -43.470 1.000 123.926 0 35 MET AAA CA 1 ? 1 ATOM 21 C C . MET A 1 29 ? -12.223 -7.090 -43.309 1.000 121.703 0 35 MET AAA C 1 ? 1 ATOM 22 O O . MET A 1 29 ? -11.075 -7.038 -42.830 1.000 129.926 0 35 MET AAA O 1 ? 1 ATOM 23 C CB . MET A 1 29 ? -14.355 -5.839 -42.778 1.000 126.416 0 35 MET AAA CB 1 ? 1 ATOM 24 C CG . MET A 1 29 ? -15.531 -6.113 -43.718 1.000 130.098 0 35 MET AAA CG 1 ? 1 ATOM 25 S SD . MET A 1 29 ? -17.188 -5.896 -42.998 1.000 136.254 0 35 MET AAA SD 1 ? 1 ATOM 26 C CE . MET A 1 29 ? -16.965 -4.393 -42.046 1.000 138.337 0 35 MET AAA CE 1 ? 1 ATOM 27 N N . ARG A 1 30 ? -12.836 -8.225 -43.669 1.000 115.356 0 36 ARG AAA N 1 ? 1 ATOM 28 C CA . ARG A 1 30 ? -12.189 -9.563 -43.787 1.000 105.758 0 36 ARG AAA CA 1 ? 1 ATOM 29 C C . ARG A 1 30 ? -11.217 -9.845 -42.627 1.000 102.626 0 36 ARG AAA C 1 ? 1 ATOM 30 O O . ARG A 1 30 ? -10.168 -10.470 -42.883 1.000 102.934 0 36 ARG AAA O 1 ? 1 ATOM 31 C CB . ARG A 1 30 ? -11.444 -9.635 -45.123 1.000 100.064 0 36 ARG AAA CB 1 ? 1 ATOM 32 C CG . ARG A 1 30 ? -12.331 -9.448 -46.342 1.000 105.639 0 36 ARG AAA CG 1 ? 1 ATOM 33 C CD . ARG A 1 30 ? -11.725 -8.472 -47.329 1.000 112.350 0 36 ARG AAA CD 1 ? 1 ATOM 34 N NE . ARG A 1 30 ? -12.333 -8.581 -48.645 1.000 119.099 0 36 ARG AAA NE 1 ? 1 ATOM 35 C CZ . ARG A 1 30 ? -12.190 -7.698 -49.631 1.000 122.809 0 36 ARG AAA CZ 1 ? 1 ATOM 36 N NH1 . ARG A 1 30 ? -12.807 -7.899 -50.784 1.000 123.055 0 36 ARG AAA NH1 1 ? 1 ATOM 37 N NH2 . ARG A 1 30 ? -11.453 -6.610 -49.471 1.000 127.068 0 36 ARG AAA NH2 1 ? 1 ATOM 38 N N . ARG A 1 31 ? -11.550 -9.435 -41.399 1.000 96.615 0 37 ARG AAA N 1 ? 1 ATOM 39 C CA . ARG A 1 31 ? -10.754 -9.765 -40.183 1.000 90.523 0 37 ARG AAA CA 1 ? 1 ATOM 40 C C . ARG A 1 31 ? -11.191 -11.162 -39.745 1.000 82.289 0 37 ARG AAA C 1 ? 1 ATOM 41 O O . ARG A 1 31 ? -12.388 -11.333 -39.479 1.000 87.616 0 37 ARG AAA O 1 ? 1 ATOM 42 C CB . ARG A 1 31 ? -10.980 -8.769 -39.039 1.000 103.005 0 37 ARG AAA CB 1 ? 1 ATOM 43 C CG . ARG A 1 31 ? -11.181 -7.320 -39.460 1.000 122.709 0 37 ARG AAA CG 1 ? 1 ATOM 44 C CD . ARG A 1 31 ? -12.519 -6.749 -38.995 1.000 133.311 0 37 ARG AAA CD 1 ? 1 ATOM 45 N NE . ARG A 1 31 ? -12.721 -6.815 -37.550 1.000 134.706 0 37 ARG AAA NE 1 ? 1 ATOM 46 C CZ . ARG A 1 31 ? -12.445 -5.843 -36.680 1.000 140.356 0 37 ARG AAA CZ 1 ? 1 ATOM 47 N NH1 . ARG A 1 31 ? -12.680 -6.033 -35.392 1.000 142.605 0 37 ARG AAA NH1 1 ? 1 ATOM 48 N NH2 . ARG A 1 31 ? -11.932 -4.695 -37.090 1.000 141.265 0 37 ARG AAA NH2 1 ? 1 ATOM 49 N N . LEU A 1 32 ? -10.280 -12.134 -39.715 1.000 73.602 0 38 LEU AAA N 1 ? 1 ATOM 50 C CA . LEU A 1 32 ? -10.634 -13.556 -39.474 1.000 70.374 0 38 LEU AAA CA 1 ? 1 ATOM 51 C C . LEU A 1 32 ? -10.338 -13.906 -38.016 1.000 70.760 0 38 LEU AAA C 1 ? 1 ATOM 52 O O . LEU A 1 32 ? -9.484 -13.238 -37.389 1.000 75.145 0 38 LEU AAA O 1 ? 1 ATOM 53 C CB . LEU A 1 32 ? -9.858 -14.466 -40.434 1.000 71.643 0 38 LEU AAA CB 1 ? 1 ATOM 54 C CG . LEU A 1 32 ? -10.366 -14.520 -41.878 1.000 74.282 0 38 LEU AAA CG 1 ? 1 ATOM 55 C CD1 . LEU A 1 32 ? -9.524 -15.472 -42.717 1.000 68.018 0 38 LEU AAA CD1 1 ? 1 ATOM 56 C CD2 . LEU A 1 32 ? -11.832 -14.925 -41.943 1.000 78.927 0 38 LEU AAA CD2 1 ? 1 ATOM 57 N N . THR A 1 33 ? -11.059 -14.899 -37.496 1.000 68.758 0 39 THR AAA N 1 ? 1 ATOM 58 C CA . THR A 1 33 ? -10.840 -15.526 -36.168 1.000 64.327 0 39 THR AAA CA 1 ? 1 ATOM 59 C C . THR A 1 33 ? -10.901 -17.043 -36.362 1.000 63.870 0 39 THR AAA C 1 ? 1 ATOM 60 O O . THR A 1 33 ? -11.229 -17.483 -37.489 1.000 63.240 0 39 THR AAA O 1 ? 1 ATOM 61 C CB . THR A 1 33 ? -11.866 -15.057 -35.125 1.000 63.621 0 39 THR AAA CB 1 ? 1 ATOM 62 O OG1 . THR A 1 33 ? -12.982 -15.945 -35.166 1.000 64.933 0 39 THR AAA OG1 1 ? 1 ATOM 63 C CG2 . THR A 1 33 ? -12.337 -13.634 -35.333 1.000 63.517 0 39 THR AAA CG2 1 ? 1 ATOM 64 N N . VAL A 1 34 ? -10.609 -17.803 -35.306 1.000 63.457 0 40 VAL AAA N 1 ? 1 ATOM 65 C CA . VAL A 1 34 ? -10.642 -19.294 -35.320 1.000 60.741 0 40 VAL AAA CA 1 ? 1 ATOM 66 C C . VAL A 1 34 ? -12.088 -19.752 -35.554 1.000 61.969 0 40 VAL AAA C 1 ? 1 ATOM 67 O O . VAL A 1 34 ? -12.267 -20.860 -36.081 1.000 61.387 0 40 VAL AAA O 1 ? 1 ATOM 68 C CB . VAL A 1 34 ? -10.041 -19.887 -34.032 1.000 61.213 0 40 VAL AAA CB 1 ? 1 ATOM 69 C CG1 . VAL A 1 34 ? -10.902 -19.598 -32.812 1.000 68.026 0 40 VAL AAA CG1 1 ? 1 ATOM 70 C CG2 . VAL A 1 34 ? -9.787 -21.379 -34.162 1.000 59.266 0 40 VAL AAA CG2 1 ? 1 ATOM 71 N N . ASP A 1 35 ? -13.081 -18.925 -35.212 1.000 66.012 0 41 ASP AAA N 1 ? 1 ATOM 72 C CA . ASP A 1 35 ? -14.524 -19.253 -35.389 1.000 73.977 0 41 ASP AAA CA 1 ? 1 ATOM 73 C C . ASP A 1 35 ? -14.881 -19.298 -36.885 1.000 76.531 0 41 ASP AAA C 1 ? 1 ATOM 74 O O . ASP A 1 35 ? -15.955 -19.845 -37.214 1.000 77.555 0 41 ASP AAA O 1 ? 1 ATOM 75 C CB . ASP A 1 35 ? -15.416 -18.269 -34.627 1.000 78.381 0 41 ASP AAA CB 1 ? 1 ATOM 76 C CG . ASP A 1 35 ? -15.300 -18.379 -33.113 1.000 84.395 0 41 ASP AAA CG 1 ? 1 ATOM 77 O OD1 . ASP A 1 35 ? -14.392 -19.090 -32.634 1.000 76.604 0 41 ASP AAA OD1 1 ? 1 ATOM 78 O OD2 . ASP A 1 35 ? -16.133 -17.760 -32.419 1.000 97.477 0 41 ASP AAA OD2 1 ? 1 ATOM 79 N N . ASP A 1 36 ? -14.016 -18.760 -37.755 1.000 72.246 0 42 ASP AAA N 1 ? 1 ATOM 80 C CA . ASP A 1 36 ? -14.213 -18.710 -39.228 1.000 66.537 0 42 ASP AAA CA 1 ? 1 ATOM 81 C C . ASP A 1 36 ? -13.659 -19.979 -39.890 1.000 63.668 0 42 ASP AAA C 1 ? 1 ATOM 82 O O . ASP A 1 36 ? -13.886 -20.125 -41.105 1.000 63.110 0 42 ASP AAA O 1 ? 1 ATOM 83 C CB . ASP A 1 36 ? -13.555 -17.466 -39.831 1.000 65.553 0 42 ASP AAA CB 1 ? 1 ATOM 84 C CG . ASP A 1 36 ? -14.262 -16.172 -39.476 1.000 70.249 0 42 ASP AAA CG 1 ? 1 ATOM 85 O OD1 . ASP A 1 36 ? -15.476 -16.079 -39.745 1.000 75.916 0 42 ASP AAA OD1 1 ? 1 ATOM 86 O OD2 . ASP A 1 36 ? -13.595 -15.273 -38.929 1.000 71.176 0 42 ASP AAA OD2 1 ? 1 ATOM 87 N N . PHE A 1 37 ? -12.977 -20.861 -39.144 1.000 62.233 0 43 PHE AAA N 1 ? 1 ATOM 88 C CA . PHE A 1 37 ? -12.352 -22.111 -39.664 1.000 60.732 0 43 PHE AAA CA 1 ? 1 ATOM 89 C C . PHE A 1 37 ? -13.044 -23.350 -39.076 1.000 63.008 0 43 PHE AAA C 1 ? 1 ATOM 90 O O . PHE A 1 37 ? -13.485 -23.299 -37.916 1.000 65.647 0 43 PHE AAA O 1 ? 1 ATOM 91 C CB . PHE A 1 37 ? -10.849 -22.119 -39.368 1.000 57.102 0 43 PHE AAA CB 1 ? 1 ATOM 92 C CG . PHE A 1 37 ? -10.088 -21.035 -40.082 1.000 54.282 0 43 PHE AAA CG 1 ? 1 ATOM 93 C CD1 . PHE A 1 37 ? -9.986 -19.764 -39.539 1.000 56.380 0 43 PHE AAA CD1 1 ? 1 ATOM 94 C CD2 . PHE A 1 37 ? -9.514 -21.269 -41.319 1.000 54.225 0 43 PHE AAA CD2 1 ? 1 ATOM 95 C CE1 . PHE A 1 37 ? -9.311 -18.757 -40.208 1.000 55.485 0 43 PHE AAA CE1 1 ? 1 ATOM 96 C CE2 . PHE A 1 37 ? -8.835 -20.261 -41.986 1.000 53.203 0 43 PHE AAA CE2 1 ? 1 ATOM 97 C CZ . PHE A 1 37 ? -8.735 -19.008 -41.430 1.000 53.722 0 43 PHE AAA CZ 1 ? 1 ATOM 98 N N . GLU A 1 38 ? -13.160 -24.417 -39.879 1.000 62.975 0 44 GLU AAA N 1 ? 1 ATOM 99 C CA . GLU A 1 38 ? -13.417 -25.812 -39.422 1.000 67.673 0 44 GLU AAA CA 1 ? 1 ATOM 100 C C . GLU A 1 38 ? -12.081 -26.555 -39.458 1.000 65.940 0 44 GLU AAA C 1 ? 1 ATOM 101 O O . GLU A 1 38 ? -11.417 -26.507 -40.510 1.000 62.019 0 44 GLU AAA O 1 ? 1 ATOM 102 C CB . GLU A 1 38 ? -14.422 -26.555 -40.308 1.000 71.503 0 44 GLU AAA CB 1 ? 1 ATOM 103 C CG . GLU A 1 38 ? -15.794 -25.908 -40.372 1.000 79.504 0 44 GLU AAA CG 1 ? 1 ATOM 104 C CD . GLU A 1 38 ? -16.739 -26.522 -41.394 1.000 90.461 0 44 GLU AAA CD 1 ? 1 ATOM 105 O OE1 . GLU A 1 38 ? -17.268 -27.615 -41.117 1.000 99.539 0 44 GLU AAA OE1 1 ? 1 ATOM 106 O OE2 . GLU A 1 38 ? -16.933 -25.911 -42.477 1.000 95.843 0 44 GLU AAA OE2 1 ? 1 ATOM 107 N N . ILE A 1 39 ? -11.687 -27.190 -38.349 1.000 67.352 0 45 ILE AAA N 1 ? 1 ATOM 108 C CA . ILE A 1 39 ? -10.371 -27.881 -38.227 1.000 65.541 0 45 ILE AAA CA 1 ? 1 ATOM 109 C C . ILE A 1 39 ? -10.550 -29.358 -38.594 1.000 65.480 0 45 ILE AAA C 1 ? 1 ATOM 110 O O . ILE A 1 39 ? -11.582 -29.962 -38.218 1.000 66.254 0 45 ILE AAA O 1 ? 1 ATOM 111 C CB . ILE A 1 39 ? -9.768 -27.656 -36.831 1.000 66.308 0 45 ILE AAA CB 1 ? 1 ATOM 112 C CG1 . ILE A 1 39 ? -9.651 -26.160 -36.536 1.000 72.442 0 45 ILE AAA CG1 1 ? 1 ATOM 113 C CG2 . ILE A 1 39 ? -8.423 -28.344 -36.673 1.000 62.876 0 45 ILE AAA CG2 1 ? 1 ATOM 114 C CD1 . ILE A 1 39 ? -9.763 -25.836 -35.066 1.000 91.338 0 45 ILE AAA CD1 1 ? 1 ATOM 115 N N . GLY A 1 40 ? -9.569 -29.895 -39.324 1.000 62.818 0 46 GLY AAA N 1 ? 1 ATOM 116 C CA . GLY A 1 40 ? -9.643 -31.209 -39.981 1.000 66.469 0 46 GLY AAA CA 1 ? 1 ATOM 117 C C . GLY A 1 40 ? -8.782 -32.242 -39.287 1.000 67.614 0 46 GLY AAA C 1 ? 1 ATOM 118 O O . GLY A 1 40 ? -9.351 -33.214 -38.759 1.000 71.376 0 46 GLY AAA O 1 ? 1 ATOM 119 N N . ARG A 1 41 ? -7.461 -32.046 -39.303 1.000 68.198 0 47 ARG AAA N 1 ? 1 ATOM 120 C CA . ARG A 1 41 ? -6.467 -33.061 -38.865 1.000 74.263 0 47 ARG AAA CA 1 ? 1 ATOM 121 C C . ARG A 1 41 ? -5.114 -32.395 -38.625 1.000 72.681 0 47 ARG AAA C 1 ? 1 ATOM 122 O O . ARG A 1 41 ? -4.743 -31.462 -39.333 1.000 70.330 0 47 ARG AAA O 1 ? 1 ATOM 123 C CB . ARG A 1 41 ? -6.398 -34.170 -39.918 1.000 81.655 0 47 ARG AAA CB 1 ? 1 ATOM 124 C CG . ARG A 1 41 ? -5.029 -34.809 -40.106 1.000 87.854 0 47 ARG AAA CG 1 ? 1 ATOM 125 C CD . ARG A 1 41 ? -5.095 -36.062 -40.952 1.000 92.054 0 47 ARG AAA CD 1 ? 1 ATOM 126 N NE . ARG A 1 41 ? -5.559 -35.831 -42.314 1.000 87.071 0 47 ARG AAA NE 1 ? 1 ATOM 127 C CZ . ARG A 1 41 ? -5.790 -36.793 -43.204 1.000 93.717 0 47 ARG AAA CZ 1 ? 1 ATOM 128 N NH1 . ARG A 1 41 ? -5.593 -38.063 -42.887 1.000 93.117 0 47 ARG AAA NH1 1 ? 1 ATOM 129 N NH2 . ARG A 1 41 ? -6.216 -36.483 -44.417 1.000 102.737 0 47 ARG AAA NH2 1 ? 1 ATOM 130 N N . PRO A 1 42 ? -4.337 -32.863 -37.621 1.000 75.737 0 48 PRO AAA N 1 ? 1 ATOM 131 C CA . PRO A 1 42 ? -2.952 -32.417 -37.436 1.000 75.279 0 48 PRO AAA CA 1 ? 1 ATOM 132 C C . PRO A 1 42 ? -2.026 -32.771 -38.612 1.000 74.165 0 48 PRO AAA C 1 ? 1 ATOM 133 O O . PRO A 1 42 ? -1.895 -33.946 -38.904 1.000 78.663 0 48 PRO AAA O 1 ? 1 ATOM 134 C CB . PRO A 1 42 ? -2.480 -33.180 -36.188 1.000 75.074 0 48 PRO AAA CB 1 ? 1 ATOM 135 C CG . PRO A 1 42 ? -3.754 -33.603 -35.488 1.000 78.945 0 48 PRO AAA CG 1 ? 1 ATOM 136 C CD . PRO A 1 42 ? -4.768 -33.816 -36.587 1.000 78.268 0 48 PRO AAA CD 1 ? 1 ATOM 137 N N . LEU A 1 43 ? -1.390 -31.770 -39.233 1.000 69.645 0 49 LEU AAA N 1 ? 1 ATOM 138 C CA . LEU A 1 43 ? -0.452 -31.975 -40.375 1.000 72.300 0 49 LEU AAA CA 1 ? 1 ATOM 139 C C . LEU A 1 43 ? 0.985 -32.160 -39.873 1.000 76.796 0 49 LEU AAA C 1 ? 1 ATOM 140 O O . LEU A 1 43 ? 1.805 -32.659 -40.658 1.000 94.124 0 49 LEU AAA O 1 ? 1 ATOM 141 C CB . LEU A 1 43 ? -0.512 -30.795 -41.352 1.000 66.116 0 49 LEU AAA CB 1 ? 1 ATOM 142 C CG . LEU A 1 43 ? -1.664 -30.809 -42.351 1.000 59.023 0 49 LEU AAA CG 1 ? 1 ATOM 143 C CD1 . LEU A 1 43 ? -1.757 -29.470 -43.059 1.000 57.726 0 49 LEU AAA CD1 1 ? 1 ATOM 144 C CD2 . LEU A 1 43 ? -1.507 -31.943 -43.349 1.000 57.779 0 49 LEU AAA CD2 1 ? 1 ATOM 145 N N . GLY A 1 44 ? 1.299 -31.751 -38.644 1.000 75.223 0 50 GLY AAA N 1 ? 1 ATOM 146 C CA . GLY A 1 44 ? 2.650 -31.920 -38.078 1.000 78.367 0 50 GLY AAA CA 1 ? 1 ATOM 147 C C . GLY A 1 44 ? 2.960 -30.897 -37.006 1.000 79.009 0 50 GLY AAA C 1 ? 1 ATOM 148 O O . GLY A 1 44 ? 2.147 -29.978 -36.802 1.000 68.364 0 50 GLY AAA O 1 ? 1 ATOM 149 N N . LYS A 1 45 ? 4.108 -31.066 -36.343 1.000 90.703 0 51 LYS AAA N 1 ? 1 ATOM 150 C CA . LYS A 1 45 ? 4.565 -30.236 -35.196 1.000 102.408 0 51 LYS AAA CA 1 ? 1 ATOM 151 C C . LYS A 1 45 ? 5.820 -29.468 -35.624 1.000 104.057 0 51 LYS AAA C 1 ? 1 ATOM 152 O O . LYS A 1 45 ? 6.799 -30.118 -36.031 1.000 107.019 0 51 LYS AAA O 1 ? 1 ATOM 153 C CB . LYS A 1 45 ? 4.820 -31.120 -33.971 1.000 107.915 0 51 LYS AAA CB 1 ? 1 ATOM 154 C CG . LYS A 1 45 ? 3.787 -32.220 -33.763 1.000 115.443 0 51 LYS AAA CG 1 ? 1 ATOM 155 C CD . LYS A 1 45 ? 3.244 -32.321 -32.352 1.000 121.253 0 51 LYS AAA CD 1 ? 1 ATOM 156 C CE . LYS A 1 45 ? 2.134 -33.348 -32.221 1.000 121.434 0 51 LYS AAA CE 1 ? 1 ATOM 157 N NZ . LYS A 1 45 ? 1.483 -33.311 -30.889 1.000 119.911 0 51 LYS AAA NZ 1 ? 1 ATOM 158 N N . GLY A 1 46 ? 5.757 -28.133 -35.591 1.000 102.833 0 52 GLY AAA N 1 ? 1 ATOM 159 C CA . GLY A 1 46 ? 6.917 -27.239 -35.760 1.000 101.902 0 52 GLY AAA CA 1 ? 1 ATOM 160 C C . GLY A 1 46 ? 7.599 -26.985 -34.427 1.000 101.752 0 52 GLY AAA C 1 ? 1 ATOM 161 O O . GLY A 1 46 ? 7.105 -27.494 -33.393 1.000 92.878 0 52 GLY AAA O 1 ? 1 ATOM 162 N N . LYS A 1 47 ? 8.692 -26.222 -34.442 1.000 104.563 0 53 LYS AAA N 1 ? 1 ATOM 163 C CA . LYS A 1 47 ? 9.439 -25.826 -33.221 1.000 119.022 0 53 LYS AAA CA 1 ? 1 ATOM 164 C C . LYS A 1 47 ? 8.507 -25.027 -32.304 1.000 121.959 0 53 LYS AAA C 1 ? 1 ATOM 165 O O . LYS A 1 47 ? 8.454 -25.337 -31.095 1.000 118.508 0 53 LYS AAA O 1 ? 1 ATOM 166 C CB . LYS A 1 47 ? 10.691 -25.027 -33.602 1.000 126.776 0 53 LYS AAA CB 1 ? 1 ATOM 167 C CG . LYS A 1 47 ? 11.749 -25.835 -34.347 1.000 128.419 0 53 LYS AAA CG 1 ? 1 ATOM 168 C CD . LYS A 1 47 ? 13.104 -25.160 -34.463 1.000 130.708 0 53 LYS AAA CD 1 ? 1 ATOM 169 C CE . LYS A 1 47 ? 14.237 -26.150 -34.648 1.000 134.363 0 53 LYS AAA CE 1 ? 1 ATOM 170 N NZ . LYS A 1 47 ? 15.420 -25.531 -35.294 1.000 134.854 0 53 LYS AAA NZ 1 ? 1 ATOM 171 N N . PHE A 1 48 ? 7.784 -24.056 -32.870 1.000 121.816 0 54 PHE AAA N 1 ? 1 ATOM 172 C CA . PHE A 1 48 ? 7.015 -23.023 -32.122 1.000 127.297 0 54 PHE AAA CA 1 ? 1 ATOM 173 C C . PHE A 1 48 ? 5.577 -23.501 -31.890 1.000 121.523 0 54 PHE AAA C 1 ? 1 ATOM 174 O O . PHE A 1 48 ? 5.005 -23.185 -30.821 1.000 107.654 0 54 PHE AAA O 1 ? 1 ATOM 175 C CB . PHE A 1 48 ? 7.117 -21.682 -32.854 1.000 120.100 0 54 PHE AAA CB 1 ? 1 ATOM 176 C CG . PHE A 1 48 ? 8.528 -21.152 -32.907 1.000 113.786 0 54 PHE AAA CG 1 ? 1 ATOM 177 C CD1 . PHE A 1 48 ? 9.392 -21.542 -33.920 1.000 99.911 0 54 PHE AAA CD1 1 ? 1 ATOM 178 C CD2 . PHE A 1 48 ? 9.012 -20.317 -31.909 1.000 114.831 0 54 PHE AAA CD2 1 ? 1 ATOM 179 C CE1 . PHE A 1 48 ? 10.700 -21.082 -33.951 1.000 101.339 0 54 PHE AAA CE1 1 ? 1 ATOM 180 C CE2 . PHE A 1 48 ? 10.318 -19.853 -31.946 1.000 110.422 0 54 PHE AAA CE2 1 ? 1 ATOM 181 C CZ . PHE A 1 48 ? 11.160 -20.235 -32.967 1.000 105.160 0 54 PHE AAA CZ 1 ? 1 ATOM 182 N N . GLY A 1 49 ? 5.014 -24.251 -32.841 1.000 115.892 0 55 GLY AAA N 1 ? 1 ATOM 183 C CA . GLY A 1 49 ? 3.676 -24.848 -32.691 1.000 102.339 0 55 GLY AAA CA 1 ? 1 ATOM 184 C C . GLY A 1 49 ? 3.255 -25.689 -33.884 1.000 89.866 0 55 GLY AAA C 1 ? 1 ATOM 185 O O . GLY A 1 49 ? 3.962 -25.675 -34.927 1.000 79.969 0 55 GLY AAA O 1 ? 1 ATOM 186 N N . ASN A 1 50 ? 2.109 -26.360 -33.726 1.000 81.721 0 56 ASN AAA N 1 ? 1 ATOM 187 C CA . ASN A 1 50 ? 1.534 -27.370 -34.655 1.000 78.212 0 56 ASN AAA CA 1 ? 1 ATOM 188 C C . ASN A 1 50 ? 0.896 -26.698 -35.876 1.000 66.448 0 56 ASN AAA C 1 ? 1 ATOM 189 O O . ASN A 1 50 ? 0.536 -25.513 -35.776 1.000 60.165 0 56 ASN AAA O 1 ? 1 ATOM 190 C CB . ASN A 1 50 ? 0.499 -28.229 -33.935 1.000 81.043 0 56 ASN AAA CB 1 ? 1 ATOM 191 C CG . ASN A 1 50 ? 1.081 -29.012 -32.777 1.000 89.929 0 56 ASN AAA CG 1 ? 1 ATOM 192 O OD1 . ASN A 1 50 ? 0.393 -29.849 -32.200 1.000 92.167 0 56 ASN AAA OD1 1 ? 1 ATOM 193 N ND2 . ASN A 1 50 ? 2.338 -28.768 -32.436 1.000 92.827 0 56 ASN AAA ND2 1 ? 1 ATOM 194 N N . VAL A 1 51 ? 0.771 -27.449 -36.979 1.000 65.271 0 57 VAL AAA N 1 ? 1 ATOM 195 C CA . VAL A 1 51 ? 0.060 -27.040 -38.235 1.000 63.987 0 57 VAL AAA CA 1 ? 1 ATOM 196 C C . VAL A 1 51 ? -1.122 -27.989 -38.471 1.000 60.901 0 57 VAL AAA C 1 ? 1 ATOM 197 O O . VAL A 1 51 ? -0.917 -29.224 -38.524 1.000 59.238 0 57 VAL AAA O 1 ? 1 ATOM 198 C CB . VAL A 1 51 ? 0.978 -26.991 -39.473 1.000 63.849 0 57 VAL AAA CB 1 ? 1 ATOM 199 C CG1 . VAL A 1 51 ? 1.753 -25.688 -39.521 1.000 65.884 0 57 VAL AAA CG1 1 ? 1 ATOM 200 C CG2 . VAL A 1 51 ? 1.923 -28.180 -39.577 1.000 71.291 0 57 VAL AAA CG2 1 ? 1 ATOM 201 N N . TYR A 1 52 ? -2.324 -27.428 -38.581 1.000 58.919 0 58 TYR AAA N 1 ? 1 ATOM 202 C CA . TYR A 1 52 ? -3.581 -28.188 -38.772 1.000 63.538 0 58 TYR AAA CA 1 ? 1 ATOM 203 C C . TYR A 1 52 ? -4.137 -27.897 -40.168 1.000 64.734 0 58 TYR AAA C 1 ? 1 ATOM 204 O O . TYR A 1 52 ? -4.219 -26.708 -40.570 1.000 66.717 0 58 TYR AAA O 1 ? 1 ATOM 205 C CB . TYR A 1 52 ? -4.601 -27.809 -37.699 1.000 69.302 0 58 TYR AAA CB 1 ? 1 ATOM 206 C CG . TYR A 1 52 ? -4.193 -28.112 -36.276 1.000 75.293 0 58 TYR AAA CG 1 ? 1 ATOM 207 C CD1 . TYR A 1 52 ? -3.334 -27.273 -35.587 1.000 73.786 0 58 TYR AAA CD1 1 ? 1 ATOM 208 C CD2 . TYR A 1 52 ? -4.694 -29.219 -35.604 1.000 77.170 0 58 TYR AAA CD2 1 ? 1 ATOM 209 C CE1 . TYR A 1 52 ? -2.970 -27.531 -34.276 1.000 81.243 0 58 TYR AAA CE1 1 ? 1 ATOM 210 C CE2 . TYR A 1 52 ? -4.342 -29.490 -34.293 1.000 81.338 0 58 TYR AAA CE2 1 ? 1 ATOM 211 C CZ . TYR A 1 52 ? -3.478 -28.641 -33.625 1.000 84.761 0 58 TYR AAA CZ 1 ? 1 ATOM 212 O OH . TYR A 1 52 ? -3.111 -28.889 -32.333 1.000 89.028 0 58 TYR AAA OH 1 ? 1 ATOM 213 N N . LEU A 1 53 ? -4.503 -28.954 -40.892 1.000 56.801 0 59 LEU AAA N 1 ? 1 ATOM 214 C CA . LEU A 1 53 ? -5.399 -28.835 -42.062 1.000 52.740 0 59 LEU AAA CA 1 ? 1 ATOM 215 C C . LEU A 1 53 ? -6.720 -28.248 -41.561 1.000 54.714 0 59 LEU AAA C 1 ? 1 ATOM 216 O O . LEU A 1 53 ? -7.283 -28.803 -40.597 1.000 56.396 0 59 LEU AAA O 1 ? 1 ATOM 217 C CB . LEU A 1 53 ? -5.616 -30.210 -42.691 1.000 53.898 0 59 LEU AAA CB 1 ? 1 ATOM 218 C CG . LEU A 1 53 ? -6.493 -30.207 -43.939 1.000 55.213 0 59 LEU AAA CG 1 ? 1 ATOM 219 C CD1 . LEU A 1 53 ? -5.754 -29.572 -45.102 1.000 54.794 0 59 LEU AAA CD1 1 ? 1 ATOM 220 C CD2 . LEU A 1 53 ? -6.956 -31.612 -44.284 1.000 57.931 0 59 LEU AAA CD2 1 ? 1 ATOM 221 N N . ALA A 1 54 ? -7.164 -27.150 -42.171 1.000 55.651 0 60 ALA AAA N 1 ? 1 ATOM 222 C CA . ALA A 1 54 ? -8.427 -26.451 -41.847 1.000 58.525 0 60 ALA AAA CA 1 ? 1 ATOM 223 C C . ALA A 1 54 ? -9.034 -25.900 -43.138 1.000 58.833 0 60 ALA AAA C 1 ? 1 ATOM 224 O O . ALA A 1 54 ? -8.317 -25.873 -44.155 1.000 62.914 0 60 ALA AAA O 1 ? 1 ATOM 225 C CB . ALA A 1 54 ? -8.163 -25.353 -40.854 1.000 58.202 0 60 ALA AAA CB 1 ? 1 ATOM 226 N N . ARG A 1 55 ? -10.305 -25.500 -43.091 1.000 56.384 0 61 ARG AAA N 1 ? 1 ATOM 227 C CA . ARG A 1 55 ? -11.008 -24.840 -44.218 1.000 56.955 0 61 ARG AAA CA 1 ? 1 ATOM 228 C C . ARG A 1 55 ? -11.922 -23.734 -43.683 1.000 57.578 0 61 ARG AAA C 1 ? 1 ATOM 229 O O . ARG A 1 55 ? -12.490 -23.908 -42.594 1.000 63.532 0 61 ARG AAA O 1 ? 1 ATOM 230 C CB . ARG A 1 55 ? -11.784 -25.874 -45.037 1.000 61.750 0 61 ARG AAA CB 1 ? 1 ATOM 231 C CG . ARG A 1 55 ? -12.972 -26.511 -44.332 1.000 63.368 0 61 ARG AAA CG 1 ? 1 ATOM 232 C CD . ARG A 1 55 ? -13.721 -27.437 -45.277 1.000 65.060 0 61 ARG AAA CD 1 ? 1 ATOM 233 N NE . ARG A 1 55 ? -14.971 -27.915 -44.703 1.000 69.383 0 61 ARG AAA NE 1 ? 1 ATOM 234 C CZ . ARG A 1 55 ? -15.934 -28.532 -45.378 1.000 71.651 0 61 ARG AAA CZ 1 ? 1 ATOM 235 N NH1 . ARG A 1 55 ? -15.811 -28.759 -46.673 1.000 70.981 0 61 ARG AAA NH1 1 ? 1 ATOM 236 N NH2 . ARG A 1 55 ? -17.029 -28.921 -44.752 1.000 75.714 0 61 ARG AAA NH2 1 ? 1 ATOM 237 N N . LEU A 1 56 ? -12.042 -22.632 -44.424 1.000 54.532 0 62 LEU AAA N 1 ? 1 ATOM 238 C CA . LEU A 1 56 ? -12.987 -21.527 -44.117 1.000 56.085 0 62 LEU AAA CA 1 ? 1 ATOM 239 C C . LEU A 1 56 ? -14.419 -22.076 -44.141 1.000 60.684 0 62 LEU AAA C 1 ? 1 ATOM 240 O O . LEU A 1 56 ? -14.740 -22.825 -45.067 1.000 61.663 0 62 LEU AAA O 1 ? 1 ATOM 241 C CB . LEU A 1 56 ? -12.788 -20.405 -45.137 1.000 52.911 0 62 LEU AAA CB 1 ? 1 ATOM 242 C CG . LEU A 1 56 ? -11.520 -19.580 -44.933 1.000 49.851 0 62 LEU AAA CG 1 ? 1 ATOM 243 C CD1 . LEU A 1 56 ? -11.005 -19.022 -46.247 1.000 51.249 0 62 LEU AAA CD1 1 ? 1 ATOM 244 C CD2 . LEU A 1 56 ? -11.758 -18.458 -43.939 1.000 51.236 0 62 LEU AAA CD2 1 ? 1 ATOM 245 N N . LYS A 1 57 ? -15.231 -21.744 -43.136 1.000 64.672 0 63 LYS AAA N 1 ? 1 ATOM 246 C CA . LYS A 1 57 ? -16.629 -22.235 -43.003 1.000 72.291 0 63 LYS AAA CA 1 ? 1 ATOM 247 C C . LYS A 1 57 ? -17.429 -21.809 -44.237 1.000 72.697 0 63 LYS AAA C 1 ? 1 ATOM 248 O O . LYS A 1 57 ? -18.122 -22.661 -44.820 1.000 71.512 0 63 LYS AAA O 1 ? 1 ATOM 249 C CB . LYS A 1 57 ? -17.296 -21.672 -41.743 1.000 78.381 0 63 LYS AAA CB 1 ? 1 ATOM 250 C CG . LYS A 1 57 ? -16.894 -22.340 -40.436 1.000 84.125 0 63 LYS AAA CG 1 ? 1 ATOM 251 C CD . LYS A 1 57 ? -17.618 -21.775 -39.229 1.000 93.064 0 63 LYS AAA CD 1 ? 1 ATOM 252 C CE . LYS A 1 57 ? -17.228 -22.439 -37.925 1.000 94.447 0 63 LYS AAA CE 1 ? 1 ATOM 253 N NZ . LYS A 1 57 ? -17.840 -21.746 -36.767 1.000 100.454 0 63 LYS AAA NZ 1 ? 1 ATOM 254 N N . GLU A 1 58 ? -17.310 -20.528 -44.603 1.000 73.096 0 64 GLU AAA N 1 ? 1 ATOM 255 C CA . GLU A 1 58 ? -18.150 -19.835 -45.613 1.000 78.308 0 64 GLU AAA CA 1 ? 1 ATOM 256 C C . GLU A 1 58 ? -17.799 -20.347 -47.015 1.000 74.557 0 64 GLU AAA C 1 ? 1 ATOM 257 O O . GLU A 1 58 ? -18.716 -20.830 -47.700 1.000 73.798 0 64 GLU AAA O 1 ? 1 ATOM 258 C CB . GLU A 1 58 ? -17.945 -18.322 -45.493 1.000 84.225 0 64 GLU AAA CB 1 ? 1 ATOM 259 C CG . GLU A 1 58 ? -18.962 -17.488 -46.253 1.000 93.327 0 64 GLU AAA CG 1 ? 1 ATOM 260 C CD . GLU A 1 58 ? -19.074 -16.046 -45.778 1.000 99.529 0 64 GLU AAA CD 1 ? 1 ATOM 261 O OE1 . GLU A 1 58 ? -18.140 -15.572 -45.086 1.000 93.931 0 64 GLU AAA OE1 1 ? 1 ATOM 262 O OE2 . GLU A 1 58 ? -20.101 -15.395 -46.093 1.000 105.111 0 64 GLU AAA OE2 1 ? 1 ATOM 263 N N . SER A 1 59 ? -16.523 -20.249 -47.410 1.000 70.174 0 65 SER AAA N 1 ? 1 ATOM 264 C CA . SER A 1 59 ? -16.035 -20.519 -48.788 1.000 65.858 0 65 SER AAA CA 1 ? 1 ATOM 265 C C . SER A 1 59 ? -15.632 -21.988 -48.964 1.000 62.223 0 65 SER AAA C 1 ? 1 ATOM 266 O O . SER A 1 59 ? -15.600 -22.429 -50.113 1.000 64.712 0 65 SER AAA O 1 ? 1 ATOM 267 C CB . SER A 1 59 ? -14.889 -19.614 -49.137 1.000 65.037 0 65 SER AAA CB 1 ? 1 ATOM 268 O OG . SER A 1 59 ? -13.650 -20.196 -48.773 1.000 62.377 0 65 SER AAA OG 1 ? 1 ATOM 269 N N . HIS A 1 60 ? -15.315 -22.699 -47.878 1.000 59.200 0 66 HIS AAA N 1 ? 1 ATOM 270 C CA . HIS A 1 60 ? -14.797 -24.099 -47.869 1.000 57.067 0 66 HIS AAA CA 1 ? 1 ATOM 271 C C . HIS A 1 60 ? -13.396 -24.178 -48.506 1.000 55.150 0 66 HIS AAA C 1 ? 1 ATOM 272 O O . HIS A 1 60 ? -13.025 -25.279 -48.975 1.000 54.621 0 66 HIS AAA O 1 ? 1 ATOM 273 C CB . HIS A 1 60 ? -15.774 -25.066 -48.555 1.000 57.282 0 66 HIS AAA CB 1 ? 1 ATOM 274 C CG . HIS A 1 60 ? -16.917 -25.517 -47.711 1.000 58.041 0 66 HIS AAA CG 1 ? 1 ATOM 275 N ND1 . HIS A 1 60 ? -18.055 -26.076 -48.263 1.000 60.593 0 66 HIS AAA ND1 1 ? 1 ATOM 276 C CD2 . HIS A 1 60 ? -17.103 -25.517 -46.376 1.000 58.704 0 66 HIS AAA CD2 1 ? 1 ATOM 277 C CE1 . HIS A 1 60 ? -18.895 -26.398 -47.306 1.000 63.591 0 66 HIS AAA CE1 1 ? 1 ATOM 278 N NE2 . HIS A 1 60 ? -18.336 -26.064 -46.136 1.000 63.011 0 66 HIS AAA NE2 1 ? 1 ATOM 279 N N . PHE A 1 61 ? -12.622 -23.087 -48.479 1.000 53.528 0 67 PHE AAA N 1 ? 1 ATOM 280 C CA . PHE A 1 61 ? -11.251 -23.025 -49.049 1.000 55.616 0 67 PHE AAA CA 1 ? 1 ATOM 281 C C . PHE A 1 61 ? -10.258 -23.642 -48.060 1.000 54.879 0 67 PHE AAA C 1 ? 1 ATOM 282 O O . PHE A 1 61 ? -10.022 -23.035 -47.017 1.000 64.149 0 67 PHE AAA O 1 ? 1 ATOM 283 C CB . PHE A 1 61 ? -10.862 -21.583 -49.381 1.000 59.924 0 67 PHE AAA CB 1 ? 1 ATOM 284 C CG . PHE A 1 61 ? -9.507 -21.427 -50.029 1.000 60.982 0 67 PHE AAA CG 1 ? 1 ATOM 285 C CD1 . PHE A 1 61 ? -9.339 -21.654 -51.387 1.000 59.357 0 67 PHE AAA CD1 1 ? 1 ATOM 286 C CD2 . PHE A 1 61 ? -8.400 -21.044 -49.284 1.000 62.374 0 67 PHE AAA CD2 1 ? 1 ATOM 287 C CE1 . PHE A 1 61 ? -8.096 -21.499 -51.982 1.000 58.490 0 67 PHE AAA CE1 1 ? 1 ATOM 288 C CE2 . PHE A 1 61 ? -7.156 -20.897 -49.880 1.000 60.045 0 67 PHE AAA CE2 1 ? 1 ATOM 289 C CZ . PHE A 1 61 ? -7.008 -21.123 -51.228 1.000 58.193 0 67 PHE AAA CZ 1 ? 1 ATOM 290 N N . ILE A 1 62 ? -9.675 -24.794 -48.402 1.000 53.061 0 68 ILE AAA N 1 ? 1 ATOM 291 C CA . ILE A 1 62 ? -8.665 -25.527 -47.578 1.000 49.167 0 68 ILE AAA CA 1 ? 1 ATOM 292 C C . ILE A 1 62 ? -7.388 -24.684 -47.452 1.000 48.094 0 68 ILE AAA C 1 ? 1 ATOM 293 O O . ILE A 1 62 ? -6.845 -24.250 -48.486 1.000 51.969 0 68 ILE AAA O 1 ? 1 ATOM 294 C CB . ILE A 1 62 ? -8.361 -26.914 -48.189 1.000 50.896 0 68 ILE AAA CB 1 ? 1 ATOM 295 C CG1 . ILE A 1 62 ? -9.491 -27.925 -47.944 1.000 55.229 0 68 ILE AAA CG1 1 ? 1 ATOM 296 C CG2 . ILE A 1 62 ? -7.019 -27.443 -47.696 1.000 47.384 0 68 ILE AAA CG2 1 ? 1 ATOM 297 C CD1 . ILE A 1 62 ? -10.437 -28.129 -49.116 1.000 56.527 0 68 ILE AAA CD1 1 ? 1 ATOM 298 N N . VAL A 1 63 ? -6.906 -24.505 -46.220 1.000 47.404 0 69 VAL AAA N 1 ? 1 ATOM 299 C CA . VAL A 1 63 ? -5.598 -23.865 -45.881 1.000 42.494 0 69 VAL AAA CA 1 ? 1 ATOM 300 C C . VAL A 1 63 ? -4.827 -24.779 -44.919 1.000 41.159 0 69 VAL AAA C 1 ? 1 ATOM 301 O O . VAL A 1 63 ? -5.422 -25.762 -44.431 1.000 39.747 0 69 VAL AAA O 1 ? 1 ATOM 302 C CB . VAL A 1 63 ? -5.819 -22.477 -45.262 1.000 41.272 0 69 VAL AAA CB 1 ? 1 ATOM 303 C CG1 . VAL A 1 63 ? -6.537 -21.540 -46.220 1.000 39.009 0 69 VAL AAA CG1 1 ? 1 ATOM 304 C CG2 . VAL A 1 63 ? -6.557 -22.585 -43.933 1.000 46.447 0 69 VAL AAA CG2 1 ? 1 ATOM 305 N N . ALA A 1 64 ? -3.544 -24.482 -44.688 1.000 45.538 0 70 ALA AAA N 1 ? 1 ATOM 306 C CA . ALA A 1 64 ? -2.718 -25.043 -43.583 1.000 49.227 0 70 ALA AAA CA 1 ? 1 ATOM 307 C C . ALA A 1 64 ? -2.609 -23.990 -42.475 1.000 46.939 0 70 ALA AAA C 1 ? 1 ATOM 308 O O . ALA A 1 64 ? -1.934 -22.964 -42.695 1.000 46.794 0 70 ALA AAA O 1 ? 1 ATOM 309 C CB . ALA A 1 64 ? -1.352 -25.451 -44.082 1.000 49.585 0 70 ALA AAA CB 1 ? 1 ATOM 310 N N . LEU A 1 65 ? -3.270 -24.224 -41.342 1.000 48.366 0 71 LEU AAA N 1 ? 1 ATOM 311 C CA . LEU A 1 65 ? -3.312 -23.275 -40.197 1.000 50.724 0 71 LEU AAA CA 1 ? 1 ATOM 312 C C . LEU A 1 65 ? -2.149 -23.583 -39.252 1.000 49.284 0 71 LEU AAA C 1 ? 1 ATOM 313 O O . LEU A 1 65 ? -2.111 -24.721 -38.733 1.000 48.955 0 71 LEU AAA O 1 ? 1 ATOM 314 C CB . LEU A 1 65 ? -4.659 -23.431 -39.487 1.000 53.816 0 71 LEU AAA CB 1 ? 1 ATOM 315 C CG . LEU A 1 65 ? -5.112 -22.236 -38.654 1.000 59.705 0 71 LEU AAA CG 1 ? 1 ATOM 316 C CD1 . LEU A 1 65 ? -4.835 -20.920 -39.374 1.000 62.297 0 71 LEU AAA CD1 1 ? 1 ATOM 317 C CD2 . LEU A 1 65 ? -6.587 -22.364 -38.308 1.000 66.434 0 71 LEU AAA CD2 1 ? 1 ATOM 318 N N . LYS A 1 66 ? -1.226 -22.632 -39.067 1.000 48.829 0 72 LYS AAA N 1 ? 1 ATOM 319 C CA . LYS A 1 66 ? -0.077 -22.785 -38.135 1.000 52.512 0 72 LYS AAA CA 1 ? 1 ATOM 320 C C . LYS A 1 66 ? -0.352 -21.958 -36.879 1.000 53.800 0 72 LYS AAA C 1 ? 1 ATOM 321 O O . LYS A 1 66 ? -0.445 -20.711 -36.995 1.000 52.695 0 72 LYS AAA O 1 ? 1 ATOM 322 C CB . LYS A 1 66 ? 1.260 -22.369 -38.756 1.000 54.087 0 72 LYS AAA CB 1 ? 1 ATOM 323 C CG . LYS A 1 66 ? 2.478 -22.765 -37.933 1.000 58.257 0 72 LYS AAA CG 1 ? 1 ATOM 324 C CD . LYS A 1 66 ? 3.774 -22.745 -38.714 1.000 64.902 0 72 LYS AAA CD 1 ? 1 ATOM 325 C CE . LYS A 1 66 ? 4.990 -22.865 -37.821 1.000 72.849 0 72 LYS AAA CE 1 ? 1 ATOM 326 N NZ . LYS A 1 66 ? 6.242 -22.989 -38.604 1.000 74.933 0 72 LYS AAA NZ 1 ? 1 ATOM 327 N N . VAL A 1 67 ? -0.457 -22.655 -35.742 1.000 54.177 0 73 VAL AAA N 1 ? 1 ATOM 328 C CA . VAL A 1 67 ? -0.732 -22.106 -34.384 1.000 56.670 0 73 VAL AAA CA 1 ? 1 ATOM 329 C C . VAL A 1 67 ? 0.606 -21.908 -33.665 1.000 55.892 0 73 VAL AAA C 1 ? 1 ATOM 330 O O . VAL A 1 67 ? 1.195 -22.914 -33.255 1.000 56.102 0 73 VAL AAA O 1 ? 1 ATOM 331 C CB . VAL A 1 67 ? -1.645 -23.063 -33.591 1.000 60.577 0 73 VAL AAA CB 1 ? 1 ATOM 332 C CG1 . VAL A 1 67 ? -2.014 -22.494 -32.238 1.000 65.232 0 73 VAL AAA CG1 1 ? 1 ATOM 333 C CG2 . VAL A 1 67 ? -2.901 -23.432 -34.365 1.000 61.684 0 73 VAL AAA CG2 1 ? 1 ATOM 334 N N . LEU A 1 68 ? 1.050 -20.657 -33.521 1.000 56.335 0 74 LEU AAA N 1 ? 1 ATOM 335 C CA . LEU A 1 68 ? 2.239 -20.263 -32.718 1.000 60.452 0 74 LEU AAA CA 1 ? 1 ATOM 336 C C . LEU A 1 68 ? 1.822 -19.977 -31.271 1.000 62.214 0 74 LEU AAA C 1 ? 1 ATOM 337 O O . LEU A 1 68 ? 0.786 -19.314 -31.090 1.000 64.682 0 74 LEU AAA O 1 ? 1 ATOM 338 C CB . LEU A 1 68 ? 2.844 -18.997 -33.323 1.000 59.098 0 74 LEU AAA CB 1 ? 1 ATOM 339 C CG . LEU A 1 68 ? 3.274 -19.096 -34.778 1.000 54.317 0 74 LEU AAA CG 1 ? 1 ATOM 340 C CD1 . LEU A 1 68 ? 3.601 -17.716 -35.323 1.000 55.850 0 74 LEU AAA CD1 1 ? 1 ATOM 341 C CD2 . LEU A 1 68 ? 4.463 -20.023 -34.920 1.000 54.338 0 74 LEU AAA CD2 1 ? 1 ATOM 342 N N . PHE A 1 69 ? 2.615 -20.416 -30.288 1.000 63.933 0 75 PHE AAA N 1 ? 1 ATOM 343 C CA . PHE A 1 69 ? 2.506 -19.973 -28.871 1.000 67.214 0 75 PHE AAA CA 1 ? 1 ATOM 344 C C . PHE A 1 69 ? 3.205 -18.618 -28.742 1.000 66.598 0 75 PHE AAA C 1 ? 1 ATOM 345 O O . PHE A 1 69 ? 4.411 -18.552 -29.044 1.000 63.679 0 75 PHE AAA O 1 ? 1 ATOM 346 C CB . PHE A 1 69 ? 3.140 -20.974 -27.901 1.000 72.399 0 75 PHE AAA CB 1 ? 1 ATOM 347 C CG . PHE A 1 69 ? 2.653 -22.399 -28.002 1.000 76.788 0 75 PHE AAA CG 1 ? 1 ATOM 348 C CD1 . PHE A 1 69 ? 1.310 -22.698 -28.190 1.000 77.867 0 75 PHE AAA CD1 1 ? 1 ATOM 349 C CD2 . PHE A 1 69 ? 3.549 -23.452 -27.886 1.000 82.976 0 75 PHE AAA CD2 1 ? 1 ATOM 350 C CE1 . PHE A 1 69 ? 0.887 -24.015 -28.289 1.000 79.598 0 75 PHE AAA CE1 1 ? 1 ATOM 351 C CE2 . PHE A 1 69 ? 3.121 -24.768 -27.973 1.000 83.403 0 75 PHE AAA CE2 1 ? 1 ATOM 352 C CZ . PHE A 1 69 ? 1.790 -25.048 -28.174 1.000 80.562 0 75 PHE AAA CZ 1 ? 1 ATOM 353 N N . LYS A 1 70 ? 2.479 -17.578 -28.316 1.000 69.161 0 76 LYS AAA N 1 ? 1 ATOM 354 C CA . LYS A 1 70 ? 3.024 -16.200 -28.167 1.000 72.845 0 76 LYS AAA CA 1 ? 1 ATOM 355 C C . LYS A 1 70 ? 4.282 -16.247 -27.295 1.000 81.658 0 76 LYS AAA C 1 ? 1 ATOM 356 O O . LYS A 1 70 ? 5.279 -15.609 -27.689 1.000 88.474 0 76 LYS AAA O 1 ? 1 ATOM 357 C CB . LYS A 1 70 ? 1.991 -15.251 -27.556 1.000 74.748 0 76 LYS AAA CB 1 ? 1 ATOM 358 C CG . LYS A 1 70 ? 0.969 -14.710 -28.540 1.000 75.429 0 76 LYS AAA CG 1 ? 1 ATOM 359 C CD . LYS A 1 70 ? 0.034 -13.663 -27.966 1.000 79.171 0 76 LYS AAA CD 1 ? 1 ATOM 360 C CE . LYS A 1 70 ? -0.593 -12.804 -29.045 1.000 76.948 0 76 LYS AAA CE 1 ? 1 ATOM 361 N NZ . LYS A 1 70 ? -1.593 -11.857 -28.502 1.000 78.815 0 76 LYS AAA NZ 1 ? 1 ATOM 362 N N . SER A 1 71 ? 4.224 -16.994 -26.181 1.000 82.930 0 77 SER AAA N 1 ? 1 ATOM 363 C CA . SER A 1 71 ? 5.292 -17.140 -25.153 1.000 84.838 0 77 SER AAA CA 1 ? 1 ATOM 364 C C . SER A 1 71 ? 6.593 -17.670 -25.771 1.000 82.727 0 77 SER AAA C 1 ? 1 ATOM 365 O O . SER A 1 71 ? 7.668 -17.320 -25.252 1.000 80.418 0 77 SER AAA O 1 ? 1 ATOM 366 C CB . SER A 1 71 ? 4.833 -18.039 -24.027 1.000 89.205 0 77 SER AAA CB 1 ? 1 ATOM 367 O OG . SER A 1 71 ? 4.747 -19.392 -24.458 1.000 85.900 0 77 SER AAA OG 1 ? 1 ATOM 368 N N . GLN A 1 72 ? 6.500 -18.493 -26.823 1.000 85.345 0 78 GLN AAA N 1 ? 1 ATOM 369 C CA . GLN A 1 72 ? 7.670 -19.134 -27.484 1.000 86.001 0 78 GLN AAA CA 1 ? 1 ATOM 370 C C . GLN A 1 72 ? 8.384 -18.127 -28.389 1.000 80.642 0 78 GLN AAA C 1 ? 1 ATOM 371 O O . GLN A 1 72 ? 9.626 -18.168 -28.419 1.000 80.796 0 78 GLN AAA O 1 ? 1 ATOM 372 C CB . GLN A 1 72 ? 7.258 -20.385 -28.266 1.000 87.632 0 78 GLN AAA CB 1 ? 1 ATOM 373 C CG . GLN A 1 72 ? 7.067 -21.613 -27.381 1.000 97.625 0 78 GLN AAA CG 1 ? 1 ATOM 374 C CD . GLN A 1 72 ? 8.310 -21.975 -26.602 1.000 112.642 0 78 GLN AAA CD 1 ? 1 ATOM 375 O OE1 . GLN A 1 72 ? 8.252 -22.354 -25.437 1.000 124.253 0 78 GLN AAA OE1 1 ? 1 ATOM 376 N NE2 . GLN A 1 72 ? 9.463 -21.845 -27.236 1.000 122.111 0 78 GLN AAA NE2 1 ? 1 ATOM 377 N N . ILE A 1 73 ? 7.649 -17.258 -29.093 1.000 78.675 0 79 ILE AAA N 1 ? 1 ATOM 378 C CA . ILE A 1 73 ? 8.277 -16.295 -30.052 1.000 83.047 0 79 ILE AAA CA 1 ? 1 ATOM 379 C C . ILE A 1 73 ? 8.881 -15.145 -29.225 1.000 85.106 0 79 ILE AAA C 1 ? 1 ATOM 380 O O . ILE A 1 73 ? 9.949 -14.635 -29.628 1.000 86.521 0 79 ILE AAA O 1 ? 1 ATOM 381 C CB . ILE A 1 73 ? 7.338 -15.879 -31.220 1.000 80.975 0 79 ILE AAA CB 1 ? 1 ATOM 382 C CG1 . ILE A 1 73 ? 6.610 -14.550 -31.002 1.000 82.001 0 79 ILE AAA CG1 1 ? 1 ATOM 383 C CG2 . ILE A 1 73 ? 6.368 -16.998 -31.596 1.000 78.908 0 79 ILE AAA CG2 1 ? 1 ATOM 384 C CD1 . ILE A 1 73 ? 7.309 -13.370 -31.646 1.000 82.009 0 79 ILE AAA CD1 1 ? 1 ATOM 385 N N . GLU A 1 74 ? 8.271 -14.815 -28.080 1.000 84.449 0 80 GLU AAA N 1 ? 1 ATOM 386 C CA . GLU A 1 74 ? 8.794 -13.839 -27.079 1.000 88.126 0 80 GLU AAA CA 1 ? 1 ATOM 387 C C . GLU A 1 74 ? 10.110 -14.351 -26.482 1.000 84.249 0 80 GLU AAA C 1 ? 1 ATOM 388 O O . GLU A 1 74 ? 11.090 -13.587 -26.464 1.000 81.763 0 80 GLU AAA O 1 ? 1 ATOM 389 C CB . GLU A 1 74 ? 7.767 -13.594 -25.968 1.000 92.866 0 80 GLU AAA CB 1 ? 1 ATOM 390 C CG . GLU A 1 74 ? 6.665 -12.628 -26.369 1.000 95.460 0 80 GLU AAA CG 1 ? 1 ATOM 391 C CD . GLU A 1 74 ? 5.485 -12.529 -25.414 1.000 94.096 0 80 GLU AAA CD 1 ? 1 ATOM 392 O OE1 . GLU A 1 74 ? 5.094 -13.567 -24.839 1.000 94.577 0 80 GLU AAA OE1 1 ? 1 ATOM 393 O OE2 . GLU A 1 74 ? 4.948 -11.413 -25.261 1.000 91.547 0 80 GLU AAA OE2 1 ? 1 ATOM 394 N N . LYS A 1 75 ? 10.114 -15.597 -26.005 1.000 83.428 0 81 LYS AAA N 1 ? 1 ATOM 395 C CA . LYS A 1 75 ? 11.288 -16.264 -25.385 1.000 87.752 0 81 LYS AAA CA 1 ? 1 ATOM 396 C C . LYS A 1 75 ? 12.492 -16.133 -26.321 1.000 85.519 0 81 LYS AAA C 1 ? 1 ATOM 397 O O . LYS A 1 75 ? 13.561 -15.723 -25.857 1.000 86.681 0 81 LYS AAA O 1 ? 1 ATOM 398 C CB . LYS A 1 75 ? 10.970 -17.734 -25.104 1.000 92.402 0 81 LYS AAA CB 1 ? 1 ATOM 399 C CG . LYS A 1 75 ? 11.984 -18.440 -24.220 1.000 103.630 0 81 LYS AAA CG 1 ? 1 ATOM 400 C CD . LYS A 1 75 ? 11.479 -19.737 -23.640 1.000 110.711 0 81 LYS AAA CD 1 ? 1 ATOM 401 C CE . LYS A 1 75 ? 12.544 -20.476 -22.854 1.000 120.862 0 81 LYS AAA CE 1 ? 1 ATOM 402 N NZ . LYS A 1 75 ? 12.230 -21.917 -22.708 1.000 125.794 0 81 LYS AAA NZ 1 ? 1 ATOM 403 N N . GLU A 1 76 ? 12.298 -16.434 -27.605 1.000 85.530 0 82 GLU AAA N 1 ? 1 ATOM 404 C CA . GLU A 1 76 ? 13.383 -16.557 -28.616 1.000 86.568 0 82 GLU AAA CA 1 ? 1 ATOM 405 C C . GLU A 1 76 ? 13.745 -15.177 -29.184 1.000 85.698 0 82 GLU AAA C 1 ? 1 ATOM 406 O O . GLU A 1 76 ? 14.738 -15.103 -29.943 1.000 85.451 0 82 GLU AAA O 1 ? 1 ATOM 407 C CB . GLU A 1 76 ? 12.956 -17.519 -29.729 1.000 86.125 0 82 GLU AAA CB 1 ? 1 ATOM 408 C CG . GLU A 1 76 ? 12.715 -18.946 -29.259 1.000 88.681 0 82 GLU AAA CG 1 ? 1 ATOM 409 C CD . GLU A 1 76 ? 13.847 -19.590 -28.477 1.000 102.174 0 82 GLU AAA CD 1 ? 1 ATOM 410 O OE1 . GLU A 1 76 ? 13.626 -19.912 -27.289 1.000 112.233 0 82 GLU AAA OE1 1 ? 1 ATOM 411 O OE2 . GLU A 1 76 ? 14.943 -19.763 -29.049 1.000 108.052 0 82 GLU AAA OE2 1 ? 1 ATOM 412 N N . GLY A 1 77 ? 12.973 -14.135 -28.845 1.000 85.563 0 83 GLY AAA N 1 ? 1 ATOM 413 C CA . GLY A 1 77 ? 13.212 -12.739 -29.268 1.000 87.391 0 83 GLY AAA CA 1 ? 1 ATOM 414 C C . GLY A 1 77 ? 13.044 -12.560 -30.769 1.000 86.032 0 83 GLY AAA C 1 ? 1 ATOM 415 O O . GLY A 1 77 ? 13.856 -11.823 -31.371 1.000 86.412 0 83 GLY AAA O 1 ? 1 ATOM 416 N N . LEU A 1 78 ? 12.023 -13.201 -31.354 1.000 81.467 0 84 LEU AAA N 1 ? 1 ATOM 417 C CA . LEU A 1 78 ? 11.752 -13.190 -32.817 1.000 76.048 0 84 LEU AAA CA 1 ? 1 ATOM 418 C C . LEU A 1 78 ? 10.525 -12.324 -33.115 1.000 73.472 0 84 LEU AAA C 1 ? 1 ATOM 419 O O . LEU A 1 78 ? 9.812 -12.650 -34.071 1.000 71.097 0 84 LEU AAA O 1 ? 1 ATOM 420 C CB . LEU A 1 78 ? 11.529 -14.625 -33.311 1.000 73.484 0 84 LEU AAA CB 1 ? 1 ATOM 421 C CG . LEU A 1 78 ? 12.680 -15.606 -33.086 1.000 76.988 0 84 LEU AAA CG 1 ? 1 ATOM 422 C CD1 . LEU A 1 78 ? 12.395 -16.936 -33.771 1.000 71.117 0 84 LEU AAA CD1 1 ? 1 ATOM 423 C CD2 . LEU A 1 78 ? 13.998 -15.025 -33.579 1.000 82.974 0 84 LEU AAA CD2 1 ? 1 ATOM 424 N N . GLU A 1 79 ? 10.293 -11.255 -32.350 1.000 77.283 0 85 GLU AAA N 1 ? 1 ATOM 425 C CA . GLU A 1 79 ? 9.133 -10.347 -32.563 1.000 79.219 0 85 GLU AAA CA 1 ? 1 ATOM 426 C C . GLU A 1 79 ? 9.326 -9.613 -33.897 1.000 77.507 0 85 GLU AAA C 1 ? 1 ATOM 427 O O . GLU A 1 79 ? 8.393 -9.632 -34.717 1.000 76.756 0 85 GLU AAA O 1 ? 1 ATOM 428 C CB . GLU A 1 79 ? 8.967 -9.363 -31.401 1.000 88.076 0 85 GLU AAA CB 1 ? 1 ATOM 429 C CG . GLU A 1 79 ? 8.503 -10.002 -30.100 1.000 92.583 0 85 GLU AAA CG 1 ? 1 ATOM 430 C CD . GLU A 1 79 ? 9.632 -10.506 -29.216 1.000 100.755 0 85 GLU AAA CD 1 ? 1 ATOM 431 O OE1 . GLU A 1 79 ? 9.692 -10.095 -28.035 1.000 101.160 0 85 GLU AAA OE1 1 ? 1 ATOM 432 O OE2 . GLU A 1 79 ? 10.453 -11.302 -29.710 1.000 103.719 0 85 GLU AAA OE2 1 ? 1 ATOM 433 N N . HIS A 1 80 ? 10.502 -9.011 -34.103 1.000 78.754 0 86 HIS AAA N 1 ? 1 ATOM 434 C CA . HIS A 1 80 ? 10.895 -8.258 -35.327 1.000 77.278 0 86 HIS AAA CA 1 ? 1 ATOM 435 C C . HIS A 1 80 ? 10.877 -9.197 -36.537 1.000 73.255 0 86 HIS AAA C 1 ? 1 ATOM 436 O O . HIS A 1 80 ? 10.213 -8.869 -37.537 1.000 72.478 0 86 HIS AAA O 1 ? 1 ATOM 437 C CB . HIS A 1 80 ? 12.279 -7.611 -35.139 1.000 82.037 0 86 HIS AAA CB 1 ? 1 ATOM 438 C CG . HIS A 1 80 ? 12.280 -6.388 -34.281 1.000 84.154 0 86 HIS AAA CG 1 ? 1 ATOM 439 N ND1 . HIS A 1 80 ? 13.292 -5.446 -34.345 1.000 88.440 0 86 HIS AAA ND1 1 ? 1 ATOM 440 C CD2 . HIS A 1 80 ? 11.396 -5.935 -33.366 1.000 82.621 0 86 HIS AAA CD2 1 ? 1 ATOM 441 C CE1 . HIS A 1 80 ? 13.037 -4.475 -33.494 1.000 91.666 0 86 HIS AAA CE1 1 ? 1 ATOM 442 N NE2 . HIS A 1 80 ? 11.876 -4.750 -32.885 1.000 88.991 0 86 HIS AAA NE2 1 ? 1 ATOM 443 N N . GLN A 1 81 ? 11.583 -10.325 -36.432 1.000 71.428 0 87 GLN AAA N 1 ? 1 ATOM 444 C CA . GLN A 1 81 ? 11.697 -11.356 -37.496 1.000 69.568 0 87 GLN AAA CA 1 ? 1 ATOM 445 C C . GLN A 1 81 ? 10.300 -11.687 -38.037 1.000 64.817 0 87 GLN AAA C 1 ? 1 ATOM 446 O O . GLN A 1 81 ? 10.127 -11.657 -39.270 1.000 61.197 0 87 GLN AAA O 1 ? 1 ATOM 447 C CB . GLN A 1 81 ? 12.395 -12.607 -36.956 1.000 70.267 0 87 GLN AAA CB 1 ? 1 ATOM 448 C CG . GLN A 1 81 ? 13.906 -12.459 -36.811 1.000 76.655 0 87 GLN AAA CG 1 ? 1 ATOM 449 C CD . GLN A 1 81 ? 14.346 -11.832 -35.506 1.000 82.277 0 87 GLN AAA CD 1 ? 1 ATOM 450 O OE1 . GLN A 1 81 ? 13.531 -11.343 -34.721 1.000 88.876 0 87 GLN AAA OE1 1 ? 1 ATOM 451 N NE2 . GLN A 1 81 ? 15.649 -11.841 -35.260 1.000 79.794 0 87 GLN AAA NE2 1 ? 1 ATOM 452 N N . LEU A 1 82 ? 9.351 -11.985 -37.144 1.000 65.775 0 88 LEU AAA N 1 ? 1 ATOM 453 C CA . LEU A 1 82 ? 7.955 -12.354 -37.496 1.000 67.321 0 88 LEU AAA CA 1 ? 1 ATOM 454 C C . LEU A 1 82 ? 7.287 -11.170 -38.204 1.000 69.749 0 88 LEU AAA C 1 ? 1 ATOM 455 O O . LEU A 1 82 ? 6.643 -11.407 -39.237 1.000 69.026 0 88 LEU AAA O 1 ? 1 ATOM 456 C CB . LEU A 1 82 ? 7.183 -12.759 -36.234 1.000 68.446 0 88 LEU AAA CB 1 ? 1 ATOM 457 C CG . LEU A 1 82 ? 5.742 -13.224 -36.457 1.000 66.624 0 88 LEU AAA CG 1 ? 1 ATOM 458 C CD1 . LEU A 1 82 ? 5.667 -14.298 -37.531 1.000 65.133 0 88 LEU AAA CD1 1 ? 1 ATOM 459 C CD2 . LEU A 1 82 ? 5.111 -13.729 -35.167 1.000 64.307 0 88 LEU AAA CD2 1 ? 1 ATOM 460 N N . ARG A 1 83 ? 7.445 -9.950 -37.677 1.000 73.506 0 89 ARG AAA N 1 ? 1 ATOM 461 C CA . ARG A 1 83 ? 6.928 -8.701 -38.308 1.000 80.512 0 89 ARG AAA CA 1 ? 1 ATOM 462 C C . ARG A 1 83 ? 7.420 -8.648 -39.761 1.000 78.174 0 89 ARG AAA C 1 ? 1 ATOM 463 O O . ARG A 1 83 ? 6.588 -8.391 -40.654 1.000 73.788 0 89 ARG AAA O 1 ? 1 ATOM 464 C CB . ARG A 1 83 ? 7.372 -7.462 -37.521 1.000 92.087 0 89 ARG AAA CB 1 ? 1 ATOM 465 C CG . ARG A 1 83 ? 6.824 -6.134 -38.035 1.000 101.001 0 89 ARG AAA CG 1 ? 1 ATOM 466 C CD . ARG A 1 83 ? 7.691 -4.925 -37.718 1.000 113.873 0 89 ARG AAA CD 1 ? 1 ATOM 467 N NE . ARG A 1 83 ? 9.125 -5.200 -37.608 1.000 126.882 0 89 ARG AAA NE 1 ? 1 ATOM 468 C CZ . ARG A 1 83 ? 10.029 -5.082 -38.586 1.000 128.639 0 89 ARG AAA CZ 1 ? 1 ATOM 469 N NH1 . ARG A 1 83 ? 9.679 -4.687 -39.801 1.000 129.968 0 89 ARG AAA NH1 1 ? 1 ATOM 470 N NH2 . ARG A 1 83 ? 11.296 -5.372 -38.339 1.000 122.236 0 89 ARG AAA NH2 1 ? 1 ATOM 471 N N . ARG A 1 84 ? 8.719 -8.896 -39.973 1.000 76.223 0 90 ARG AAA N 1 ? 1 ATOM 472 C CA . ARG A 1 84 ? 9.398 -8.825 -41.295 1.000 75.167 0 90 ARG AAA CA 1 ? 1 ATOM 473 C C . ARG A 1 84 ? 8.793 -9.882 -42.229 1.000 68.926 0 90 ARG AAA C 1 ? 1 ATOM 474 O O . ARG A 1 84 ? 8.524 -9.552 -43.402 1.000 65.153 0 90 ARG AAA O 1 ? 1 ATOM 475 C CB . ARG A 1 84 ? 10.913 -8.992 -41.117 1.000 76.622 0 90 ARG AAA CB 1 ? 1 ATOM 476 C CG . ARG A 1 84 ? 11.725 -8.873 -42.401 1.000 77.277 0 90 ARG AAA CG 1 ? 1 ATOM 477 C CD . ARG A 1 84 ? 11.349 -7.688 -43.277 1.000 81.203 0 90 ARG AAA CD 1 ? 1 ATOM 478 N NE . ARG A 1 84 ? 12.184 -7.602 -44.472 1.000 86.395 0 90 ARG AAA NE 1 ? 1 ATOM 479 C CZ . ARG A 1 84 ? 11.911 -6.870 -45.555 1.000 86.966 0 90 ARG AAA CZ 1 ? 1 ATOM 480 N NH1 . ARG A 1 84 ? 10.805 -6.146 -45.628 1.000 87.732 0 90 ARG AAA NH1 1 ? 1 ATOM 481 N NH2 . ARG A 1 84 ? 12.748 -6.873 -46.577 1.000 88.349 0 90 ARG AAA NH2 1 ? 1 ATOM 482 N N . GLU A 1 85 ? 8.575 -11.098 -41.723 1.000 66.523 0 91 GLU AAA N 1 ? 1 ATOM 483 C CA . GLU A 1 85 ? 7.919 -12.208 -42.462 1.000 65.943 0 91 GLU AAA CA 1 ? 1 ATOM 484 C C . GLU A 1 85 ? 6.584 -11.718 -43.036 1.000 69.818 0 91 GLU AAA C 1 ? 1 ATOM 485 O O . GLU A 1 85 ? 6.343 -11.937 -44.244 1.000 77.951 0 91 GLU AAA O 1 ? 1 ATOM 486 C CB . GLU A 1 85 ? 7.689 -13.401 -41.536 1.000 64.849 0 91 GLU AAA CB 1 ? 1 ATOM 487 C CG . GLU A 1 85 ? 7.072 -14.604 -42.227 1.000 60.938 0 91 GLU AAA CG 1 ? 1 ATOM 488 C CD . GLU A 1 85 ? 8.023 -15.335 -43.152 1.000 58.881 0 91 GLU AAA CD 1 ? 1 ATOM 489 O OE1 . GLU A 1 85 ? 9.251 -15.135 -43.003 1.000 60.376 0 91 GLU AAA OE1 1 ? 1 ATOM 490 O OE2 . GLU A 1 85 ? 7.532 -16.092 -44.017 1.000 55.535 0 91 GLU AAA OE2 1 ? 1 ATOM 491 N N . ILE A 1 86 ? 5.761 -11.074 -42.203 1.000 67.301 0 92 ILE AAA N 1 ? 1 ATOM 492 C CA . ILE A 1 86 ? 4.413 -10.555 -42.588 1.000 66.372 0 92 ILE AAA CA 1 ? 1 ATOM 493 C C . ILE A 1 86 ? 4.587 -9.459 -43.651 1.000 64.099 0 92 ILE AAA C 1 ? 1 ATOM 494 O O . ILE A 1 86 ? 3.887 -9.521 -44.671 1.000 62.311 0 92 ILE AAA O 1 ? 1 ATOM 495 C CB . ILE A 1 86 ? 3.630 -10.047 -41.357 1.000 70.296 0 92 ILE AAA CB 1 ? 1 ATOM 496 C CG1 . ILE A 1 86 ? 3.490 -11.115 -40.268 1.000 68.343 0 92 ILE AAA CG1 1 ? 1 ATOM 497 C CG2 . ILE A 1 86 ? 2.270 -9.502 -41.769 1.000 70.775 0 92 ILE AAA CG2 1 ? 1 ATOM 498 C CD1 . ILE A 1 86 ? 2.722 -12.336 -40.696 1.000 67.729 0 92 ILE AAA CD1 1 ? 1 ATOM 499 N N . GLU A 1 87 ? 5.492 -8.506 -43.420 1.000 67.732 0 93 GLU AAA N 1 ? 1 ATOM 500 C CA . GLU A 1 87 ? 5.765 -7.357 -44.324 1.000 72.389 0 93 GLU AAA CA 1 ? 1 ATOM 501 C C . GLU A 1 87 ? 6.223 -7.869 -45.698 1.000 70.658 0 93 GLU AAA C 1 ? 1 ATOM 502 O O . GLU A 1 87 ? 5.716 -7.345 -46.719 1.000 71.494 0 93 GLU AAA O 1 ? 1 ATOM 503 C CB . GLU A 1 87 ? 6.810 -6.421 -43.713 1.000 77.082 0 93 GLU AAA CB 1 ? 1 ATOM 504 C CG . GLU A 1 87 ? 7.029 -5.159 -44.530 1.000 82.361 0 93 GLU AAA CG 1 ? 1 ATOM 505 C CD . GLU A 1 87 ? 7.918 -4.122 -43.871 1.000 89.473 0 93 GLU AAA CD 1 ? 1 ATOM 506 O OE1 . GLU A 1 87 ? 8.782 -4.513 -43.061 1.000 93.842 0 93 GLU AAA OE1 1 ? 1 ATOM 507 O OE2 . GLU A 1 87 ? 7.725 -2.923 -44.154 1.000 91.204 0 93 GLU AAA OE2 1 ? 1 ATOM 508 N N . ILE A 1 88 ? 7.143 -8.839 -45.730 1.000 66.564 0 94 ILE AAA N 1 ? 1 ATOM 509 C CA . ILE A 1 88 ? 7.631 -9.477 -46.990 1.000 66.616 0 94 ILE AAA CA 1 ? 1 ATOM 510 C C . ILE A 1 88 ? 6.441 -10.126 -47.708 1.000 66.762 0 94 ILE AAA C 1 ? 1 ATOM 511 O O . ILE A 1 88 ? 6.289 -9.884 -48.919 1.000 66.337 0 94 ILE AAA O 1 ? 1 ATOM 512 C CB . ILE A 1 88 ? 8.756 -10.502 -46.724 1.000 65.676 0 94 ILE AAA CB 1 ? 1 ATOM 513 C CG1 . ILE A 1 88 ? 10.074 -9.809 -46.383 1.000 64.956 0 94 ILE AAA CG1 1 ? 1 ATOM 514 C CG2 . ILE A 1 88 ? 8.917 -11.455 -47.908 1.000 67.280 0 94 ILE AAA CG2 1 ? 1 ATOM 515 C CD1 . ILE A 1 88 ? 11.198 -10.748 -45.999 1.000 64.426 0 94 ILE AAA CD1 1 ? 1 ATOM 516 N N . GLN A 1 89 ? 5.637 -10.918 -46.989 1.000 66.115 0 95 GLN AAA N 1 ? 1 ATOM 517 C CA . GLN A 1 89 ? 4.585 -11.776 -47.592 1.000 66.343 0 95 GLN AAA CA 1 ? 1 ATOM 518 C C . GLN A 1 89 ? 3.388 -10.927 -48.037 1.000 67.307 0 95 GLN AAA C 1 ? 1 ATOM 519 O O . GLN A 1 89 ? 2.562 -11.444 -48.824 1.000 69.441 0 95 GLN AAA O 1 ? 1 ATOM 520 C CB . GLN A 1 89 ? 4.133 -12.864 -46.624 1.000 68.072 0 95 GLN AAA CB 1 ? 1 ATOM 521 C CG . GLN A 1 89 ? 3.803 -14.156 -47.359 1.000 68.814 0 95 GLN AAA CG 1 ? 1 ATOM 522 C CD . GLN A 1 89 ? 4.822 -15.232 -47.091 1.000 72.116 0 95 GLN AAA CD 1 ? 1 ATOM 523 O OE1 . GLN A 1 89 ? 5.477 -15.238 -46.052 1.000 77.788 0 95 GLN AAA OE1 1 ? 1 ATOM 524 N NE2 . GLN A 1 89 ? 4.975 -16.153 -48.028 1.000 72.085 0 95 GLN AAA NE2 1 ? 1 ATOM 525 N N . ALA A 1 90 ? 3.289 -9.689 -47.547 1.000 66.676 0 96 ALA AAA N 1 ? 1 ATOM 526 C CA . ALA A 1 90 ? 2.236 -8.711 -47.907 1.000 71.806 0 96 ALA AAA CA 1 ? 1 ATOM 527 C C . ALA A 1 90 ? 2.617 -7.955 -49.190 1.000 73.017 0 96 ALA AAA C 1 ? 1 ATOM 528 O O . ALA A 1 90 ? 1.721 -7.341 -49.794 1.000 69.906 0 96 ALA AAA O 1 ? 1 ATOM 529 C CB . ALA A 1 90 ? 2.015 -7.757 -46.756 1.000 73.053 0 96 ALA AAA CB 1 ? 1 ATOM 530 N N . HIS A 1 91 ? 3.901 -7.965 -49.559 1.000 79.913 0 97 HIS AAA N 1 ? 1 ATOM 531 C CA . HIS A 1 91 ? 4.479 -7.217 -50.712 1.000 83.922 0 97 HIS AAA CA 1 ? 1 ATOM 532 C C . HIS A 1 91 ? 4.910 -8.187 -51.829 1.000 77.426 0 97 HIS AAA C 1 ? 1 ATOM 533 O O . HIS A 1 91 ? 4.787 -7.791 -53.001 1.000 76.631 0 97 HIS AAA O 1 ? 1 ATOM 534 C CB . HIS A 1 91 ? 5.633 -6.312 -50.235 1.000 90.686 0 97 HIS AAA CB 1 ? 1 ATOM 535 C CG . HIS A 1 91 ? 5.198 -5.031 -49.597 1.000 99.443 0 97 HIS AAA CG 1 ? 1 ATOM 536 N ND1 . HIS A 1 91 ? 4.019 -4.915 -48.879 1.000 101.515 0 97 HIS AAA ND1 1 ? 1 ATOM 537 C CD2 . HIS A 1 91 ? 5.785 -3.811 -49.556 1.000 104.469 0 97 HIS AAA CD2 1 ? 1 ATOM 538 C CE1 . HIS A 1 91 ? 3.898 -3.680 -48.431 1.000 105.566 0 97 HIS AAA CE1 1 ? 1 ATOM 539 N NE2 . HIS A 1 91 ? 4.969 -2.982 -48.832 1.000 107.118 0 97 HIS AAA NE2 1 ? 1 ATOM 540 N N . LEU A 1 92 ? 5.373 -9.402 -51.491 1.000 71.596 0 98 LEU AAA N 1 ? 1 ATOM 541 C CA . LEU A 1 92 ? 5.981 -10.382 -52.441 1.000 70.164 0 98 LEU AAA CA 1 ? 1 ATOM 542 C C . LEU A 1 92 ? 5.125 -11.653 -52.560 1.000 68.248 0 98 LEU AAA C 1 ? 1 ATOM 543 O O . LEU A 1 92 ? 4.537 -12.088 -51.539 1.000 66.521 0 98 LEU AAA O 1 ? 1 ATOM 544 C CB . LEU A 1 92 ? 7.392 -10.738 -51.961 1.000 71.497 0 98 LEU AAA CB 1 ? 1 ATOM 545 C CG . LEU A 1 92 ? 8.514 -9.816 -52.437 1.000 77.412 0 98 LEU AAA CG 1 ? 1 ATOM 546 C CD1 . LEU A 1 92 ? 8.163 -8.350 -52.220 1.000 80.854 0 98 LEU AAA CD1 1 ? 1 ATOM 547 C CD2 . LEU A 1 92 ? 9.817 -10.161 -51.735 1.000 80.087 0 98 LEU AAA CD2 1 ? 1 ATOM 548 N N . GLN A 1 93 ? 5.080 -12.231 -53.769 1.000 65.918 0 99 GLN AAA N 1 ? 1 ATOM 549 C CA . GLN A 1 93 ? 4.367 -13.499 -54.094 1.000 64.306 0 99 GLN AAA CA 1 ? 1 ATOM 550 C C . GLN A 1 93 ? 5.204 -14.299 -55.098 1.000 62.324 0 99 GLN AAA C 1 ? 1 ATOM 551 O O . GLN A 1 93 ? 5.872 -13.658 -55.939 1.000 66.577 0 99 GLN AAA O 1 ? 1 ATOM 552 C CB . GLN A 1 93 ? 2.976 -13.205 -54.661 1.000 71.613 0 99 GLN AAA CB 1 ? 1 ATOM 553 C CG . GLN A 1 93 ? 1.949 -12.805 -53.604 1.000 77.492 0 99 GLN AAA CG 1 ? 1 ATOM 554 C CD . GLN A 1 93 ? 2.087 -11.366 -53.156 1.000 79.514 0 99 GLN AAA CD 1 ? 1 ATOM 555 O OE1 . GLN A 1 93 ? 2.180 -10.440 -53.962 1.000 84.135 0 99 GLN AAA OE1 1 ? 1 ATOM 556 N NE2 . GLN A 1 93 ? 2.097 -11.163 -51.850 1.000 76.526 0 99 GLN AAA NE2 1 ? 1 ATOM 557 N N . HIS A 1 94 ? 5.177 -15.635 -55.013 1.000 56.172 0 100 HIS AAA N 1 ? 1 ATOM 558 C CA . HIS A 1 94 ? 5.874 -16.552 -55.960 1.000 56.738 0 100 HIS AAA CA 1 ? 1 ATOM 559 C C . HIS A 1 94 ? 5.270 -17.951 -55.889 1.000 54.447 0 100 HIS AAA C 1 ? 1 ATOM 560 O O . HIS A 1 94 ? 4.999 -18.459 -54.810 1.000 60.282 0 100 HIS AAA O 1 ? 1 ATOM 561 C CB . HIS A 1 94 ? 7.385 -16.589 -55.697 1.000 57.849 0 100 HIS AAA CB 1 ? 1 ATOM 562 C CG . HIS A 1 94 ? 8.143 -17.269 -56.788 1.000 59.920 0 100 HIS AAA CG 1 ? 1 ATOM 563 N ND1 . HIS A 1 94 ? 8.520 -16.612 -57.937 1.000 62.212 0 100 HIS AAA ND1 1 ? 1 ATOM 564 C CD2 . HIS A 1 94 ? 8.573 -18.542 -56.924 1.000 60.128 0 100 HIS AAA CD2 1 ? 1 ATOM 565 C CE1 . HIS A 1 94 ? 9.158 -17.448 -58.730 1.000 64.855 0 100 HIS AAA CE1 1 ? 1 ATOM 566 N NE2 . HIS A 1 94 ? 9.197 -18.643 -58.136 1.000 62.244 0 100 HIS AAA NE2 1 ? 1 ATOM 567 N N . PRO A 1 95 ? 5.040 -18.628 -57.031 1.000 53.753 0 101 PRO AAA N 1 ? 1 ATOM 568 C CA . PRO A 1 95 ? 4.420 -19.954 -57.014 1.000 51.342 0 101 PRO AAA CA 1 ? 1 ATOM 569 C C . PRO A 1 95 ? 5.253 -21.069 -56.356 1.000 49.069 0 101 PRO AAA C 1 ? 1 ATOM 570 O O . PRO A 1 95 ? 4.685 -22.089 -56.043 1.000 47.639 0 101 PRO AAA O 1 ? 1 ATOM 571 C CB . PRO A 1 95 ? 4.174 -20.275 -58.498 1.000 54.766 0 101 PRO AAA CB 1 ? 1 ATOM 572 C CG . PRO A 1 95 ? 5.063 -19.319 -59.283 1.000 58.427 0 101 PRO AAA CG 1 ? 1 ATOM 573 C CD . PRO A 1 95 ? 5.311 -18.128 -58.386 1.000 57.032 0 101 PRO AAA CD 1 ? 1 ATOM 574 N N . ASN A 1 96 ? 6.552 -20.858 -56.148 1.000 51.595 0 102 ASN AAA N 1 ? 1 ATOM 575 C CA . ASN A 1 96 ? 7.479 -21.852 -55.538 1.000 54.285 0 102 ASN AAA CA 1 ? 1 ATOM 576 C C . ASN A 1 96 ? 7.965 -21.370 -54.168 1.000 55.088 0 102 ASN AAA C 1 ? 1 ATOM 577 O O . ASN A 1 96 ? 8.975 -21.923 -53.688 1.000 61.001 0 102 ASN AAA O 1 ? 1 ATOM 578 C CB . ASN A 1 96 ? 8.684 -22.143 -56.436 1.000 56.560 0 102 ASN AAA CB 1 ? 1 ATOM 579 C CG . ASN A 1 96 ? 8.268 -22.637 -57.800 1.000 58.098 0 102 ASN AAA CG 1 ? 1 ATOM 580 O OD1 . ASN A 1 96 ? 8.646 -22.055 -58.813 1.000 61.497 0 102 ASN AAA OD1 1 ? 1 ATOM 581 N ND2 . ASN A 1 96 ? 7.471 -23.693 -57.827 1.000 57.637 0 102 ASN AAA ND2 1 ? 1 ATOM 582 N N . ILE A 1 97 ? 7.301 -20.363 -53.590 1.000 52.115 0 103 ILE AAA N 1 ? 1 ATOM 583 C CA . ILE A 1 97 ? 7.449 -19.954 -52.161 1.000 51.245 0 103 ILE AAA CA 1 ? 1 ATOM 584 C C . ILE A 1 97 ? 6.070 -20.079 -51.518 1.000 51.113 0 103 ILE AAA C 1 ? 1 ATOM 585 O O . ILE A 1 97 ? 5.150 -19.393 -52.011 1.000 51.787 0 103 ILE AAA O 1 ? 1 ATOM 586 C CB . ILE A 1 97 ? 7.991 -18.521 -51.999 1.000 51.732 0 103 ILE AAA CB 1 ? 1 ATOM 587 C CG1 . ILE A 1 97 ? 9.408 -18.362 -52.553 1.000 56.132 0 103 ILE AAA CG1 1 ? 1 ATOM 588 C CG2 . ILE A 1 97 ? 7.919 -18.105 -50.540 1.000 51.643 0 103 ILE AAA CG2 1 ? 1 ATOM 589 C CD1 . ILE A 1 97 ? 9.897 -16.922 -52.608 1.000 57.683 0 103 ILE AAA CD1 1 ? 1 ATOM 590 N N . LEU A 1 98 ? 5.946 -20.894 -50.461 1.000 47.607 0 104 LEU AAA N 1 ? 1 ATOM 591 C CA . LEU A 1 98 ? 4.656 -21.162 -49.775 1.000 43.431 0 104 LEU AAA CA 1 ? 1 ATOM 592 C C . LEU A 1 98 ? 4.084 -19.825 -49.303 1.000 41.197 0 104 LEU AAA C 1 ? 1 ATOM 593 O O . LEU A 1 98 ? 4.843 -19.002 -48.793 1.000 43.294 0 104 LEU AAA O 1 ? 1 ATOM 594 C CB . LEU A 1 98 ? 4.871 -22.134 -48.613 1.000 44.883 0 104 LEU AAA CB 1 ? 1 ATOM 595 C CG . LEU A 1 98 ? 3.609 -22.837 -48.110 1.000 46.429 0 104 LEU AAA CG 1 ? 1 ATOM 596 C CD1 . LEU A 1 98 ? 3.153 -23.913 -49.094 1.000 46.206 0 104 LEU AAA CD1 1 ? 1 ATOM 597 C CD2 . LEU A 1 98 ? 3.835 -23.438 -46.725 1.000 46.134 0 104 LEU AAA CD2 1 ? 1 ATOM 598 N N . ARG A 1 99 ? 2.792 -19.611 -49.511 1.000 40.923 0 105 ARG AAA N 1 ? 1 ATOM 599 C CA . ARG A 1 99 ? 2.130 -18.301 -49.307 1.000 44.247 0 105 ARG AAA CA 1 ? 1 ATOM 600 C C . ARG A 1 99 ? 1.605 -18.182 -47.874 1.000 45.143 0 105 ARG AAA C 1 ? 1 ATOM 601 O O . ARG A 1 99 ? 1.063 -19.173 -47.346 1.000 44.292 0 105 ARG AAA O 1 ? 1 ATOM 602 C CB . ARG A 1 99 ? 0.952 -18.153 -50.269 1.000 47.504 0 105 ARG AAA CB 1 ? 1 ATOM 603 C CG . ARG A 1 99 ? 0.350 -16.756 -50.275 1.000 53.141 0 105 ARG AAA CG 1 ? 1 ATOM 604 C CD . ARG A 1 99 ? 0.358 -16.157 -51.662 1.000 59.956 0 105 ARG AAA CD 1 ? 1 ATOM 605 N NE . ARG A 1 99 ? -0.091 -14.778 -51.603 1.000 62.160 0 105 ARG AAA NE 1 ? 1 ATOM 606 C CZ . ARG A 1 99 ? -0.961 -14.226 -52.430 1.000 62.467 0 105 ARG AAA CZ 1 ? 1 ATOM 607 N NH1 . ARG A 1 99 ? -1.501 -14.934 -53.407 1.000 66.846 0 105 ARG AAA NH1 1 ? 1 ATOM 608 N NH2 . ARG A 1 99 ? -1.311 -12.962 -52.262 1.000 64.597 0 105 ARG AAA NH2 1 ? 1 ATOM 609 N N . LEU A 1 100 ? 1.719 -16.985 -47.303 1.000 46.150 0 106 LEU AAA N 1 ? 1 ATOM 610 C CA . LEU A 1 100 ? 0.892 -16.534 -46.157 1.000 49.553 0 106 LEU AAA CA 1 ? 1 ATOM 611 C C . LEU A 1 100 ? -0.280 -15.734 -46.718 1.000 46.839 0 106 LEU AAA C 1 ? 1 ATOM 612 O O . LEU A 1 100 ? -0.025 -14.654 -47.270 1.000 51.330 0 106 LEU AAA O 1 ? 1 ATOM 613 C CB . LEU A 1 100 ? 1.747 -15.679 -45.219 1.000 55.922 0 106 LEU AAA CB 1 ? 1 ATOM 614 C CG . LEU A 1 100 ? 1.127 -15.397 -43.857 1.000 58.803 0 106 LEU AAA CG 1 ? 1 ATOM 615 C CD1 . LEU A 1 100 ? 2.178 -15.538 -42.773 1.000 62.235 0 106 LEU AAA CD1 1 ? 1 ATOM 616 C CD2 . LEU A 1 100 ? 0.501 -14.014 -43.815 1.000 64.545 0 106 LEU AAA CD2 1 ? 1 ATOM 617 N N . TYR A 1 101 ? -1.500 -16.266 -46.627 1.000 47.216 0 107 TYR AAA N 1 ? 1 ATOM 618 C CA . TYR A 1 101 ? -2.734 -15.598 -47.119 1.000 51.497 0 107 TYR AAA CA 1 ? 1 ATOM 619 C C . TYR A 1 101 ? -3.038 -14.407 -46.207 1.000 52.888 0 107 TYR AAA C 1 ? 1 ATOM 620 O O . TYR A 1 101 ? -3.282 -13.297 -46.730 1.000 49.335 0 107 TYR AAA O 1 ? 1 ATOM 621 C CB . TYR A 1 101 ? -3.929 -16.554 -47.167 1.000 49.632 0 107 TYR AAA CB 1 ? 1 ATOM 622 C CG . TYR A 1 101 ? -3.766 -17.763 -48.053 1.000 48.280 0 107 TYR AAA CG 1 ? 1 ATOM 623 C CD1 . TYR A 1 101 ? -3.475 -17.636 -49.402 1.000 47.680 0 107 TYR AAA CD1 1 ? 1 ATOM 624 C CD2 . TYR A 1 101 ? -3.925 -19.043 -47.542 1.000 50.505 0 107 TYR AAA CD2 1 ? 1 ATOM 625 C CE1 . TYR A 1 101 ? -3.340 -18.748 -50.218 1.000 47.892 0 107 TYR AAA CE1 1 ? 1 ATOM 626 C CE2 . TYR A 1 101 ? -3.792 -20.166 -48.343 1.000 50.793 0 107 TYR AAA CE2 1 ? 1 ATOM 627 C CZ . TYR A 1 101 ? -3.507 -20.016 -49.689 1.000 48.707 0 107 TYR AAA CZ 1 ? 1 ATOM 628 O OH . TYR A 1 101 ? -3.377 -21.117 -50.478 1.000 46.828 0 107 TYR AAA OH 1 ? 1 ATOM 629 N N . ASN A 1 102 ? -3.007 -14.655 -44.889 1.000 56.896 0 108 ASN AAA N 1 ? 1 ATOM 630 C CA . ASN A 1 102 ? -3.164 -13.641 -43.808 1.000 58.346 0 108 ASN AAA CA 1 ? 1 ATOM 631 C C . ASN A 1 102 ? -2.930 -14.299 -42.437 1.000 61.013 0 108 ASN AAA C 1 ? 1 ATOM 632 O O . ASN A 1 102 ? -2.666 -15.525 -42.393 1.000 65.116 0 108 ASN AAA O 1 ? 1 ATOM 633 C CB . ASN A 1 102 ? -4.533 -12.959 -43.868 1.000 56.612 0 108 ASN AAA CB 1 ? 1 ATOM 634 C CG . ASN A 1 102 ? -4.463 -11.493 -43.504 1.000 61.637 0 108 ASN AAA CG 1 ? 1 ATOM 635 O OD1 . ASN A 1 102 ? -3.629 -11.091 -42.701 1.000 66.755 0 108 ASN AAA OD1 1 ? 1 ATOM 636 N ND2 . ASN A 1 102 ? -5.318 -10.682 -44.105 1.000 66.348 0 108 ASN AAA ND2 1 ? 1 ATOM 637 N N . TYR A 1 103 ? -3.013 -13.509 -41.361 1.000 58.959 0 109 TYR AAA N 1 ? 1 ATOM 638 C CA . TYR A 1 103 ? -2.798 -13.940 -39.952 1.000 57.064 0 109 TYR AAA CA 1 ? 1 ATOM 639 C C . TYR A 1 103 ? -3.831 -13.258 -39.049 1.000 58.640 0 109 TYR AAA C 1 ? 1 ATOM 640 O O . TYR A 1 103 ? -4.314 -12.161 -39.386 1.000 66.781 0 109 TYR AAA O 1 ? 1 ATOM 641 C CB . TYR A 1 103 ? -1.387 -13.574 -39.473 1.000 53.807 0 109 TYR AAA CB 1 ? 1 ATOM 642 C CG . TYR A 1 103 ? -1.174 -12.092 -39.295 1.000 53.106 0 109 TYR AAA CG 1 ? 1 ATOM 643 C CD1 . TYR A 1 103 ? -0.899 -11.280 -40.379 1.000 55.437 0 109 TYR AAA CD1 1 ? 1 ATOM 644 C CD2 . TYR A 1 103 ? -1.289 -11.489 -38.057 1.000 54.510 0 109 TYR AAA CD2 1 ? 1 ATOM 645 C CE1 . TYR A 1 103 ? -0.711 -9.917 -40.238 1.000 56.532 0 109 TYR AAA CE1 1 ? 1 ATOM 646 C CE2 . TYR A 1 103 ? -1.116 -10.123 -37.898 1.000 56.902 0 109 TYR AAA CE2 1 ? 1 ATOM 647 C CZ . TYR A 1 103 ? -0.819 -9.334 -38.993 1.000 58.114 0 109 TYR AAA CZ 1 ? 1 ATOM 648 O OH . TYR A 1 103 ? -0.640 -7.988 -38.871 1.000 63.650 0 109 TYR AAA OH 1 ? 1 ATOM 649 N N . PHE A 1 104 ? -4.135 -13.887 -37.916 1.000 55.752 0 110 PHE AAA N 1 ? 1 ATOM 650 C CA . PHE A 1 104 ? -4.878 -13.284 -36.779 1.000 57.231 0 110 PHE AAA CA 1 ? 1 ATOM 651 C C . PHE A 1 104 ? -4.160 -13.689 -35.487 1.000 54.529 0 110 PHE AAA C 1 ? 1 ATOM 652 O O . PHE A 1 104 ? -3.151 -14.410 -35.573 1.000 49.569 0 110 PHE AAA O 1 ? 1 ATOM 653 C CB . PHE A 1 104 ? -6.356 -13.693 -36.817 1.000 58.072 0 110 PHE AAA CB 1 ? 1 ATOM 654 C CG . PHE A 1 104 ? -6.614 -15.174 -36.934 1.000 54.917 0 110 PHE AAA CG 1 ? 1 ATOM 655 C CD1 . PHE A 1 104 ? -6.409 -15.840 -38.133 1.000 56.359 0 110 PHE AAA CD1 1 ? 1 ATOM 656 C CD2 . PHE A 1 104 ? -7.076 -15.900 -35.853 1.000 54.541 0 110 PHE AAA CD2 1 ? 1 ATOM 657 C CE1 . PHE A 1 104 ? -6.650 -17.201 -38.246 1.000 56.106 0 110 PHE AAA CE1 1 ? 1 ATOM 658 C CE2 . PHE A 1 104 ? -7.322 -17.259 -35.964 1.000 55.700 0 110 PHE AAA CE2 1 ? 1 ATOM 659 C CZ . PHE A 1 104 ? -7.107 -17.907 -37.158 1.000 57.344 0 110 PHE AAA CZ 1 ? 1 ATOM 660 N N . HIS A 1 105 ? -4.640 -13.221 -34.334 1.000 57.599 0 111 HIS AAA N 1 ? 1 ATOM 661 C CA . HIS A 1 105 ? -4.026 -13.513 -33.013 1.000 58.688 0 111 HIS AAA CA 1 ? 1 ATOM 662 C C . HIS A 1 105 ? -5.068 -13.477 -31.888 1.000 63.887 0 111 HIS AAA C 1 ? 1 ATOM 663 O O . HIS A 1 105 ? -6.058 -12.725 -31.994 1.000 63.288 0 111 HIS AAA O 1 ? 1 ATOM 664 C CB . HIS A 1 105 ? -2.852 -12.566 -32.746 1.000 58.998 0 111 HIS AAA CB 1 ? 1 ATOM 665 C CG . HIS A 1 105 ? -3.251 -11.154 -32.498 1.000 62.208 0 111 HIS AAA CG 1 ? 1 ATOM 666 N ND1 . HIS A 1 105 ? -3.531 -10.685 -31.234 1.000 66.694 0 111 HIS AAA ND1 1 ? 1 ATOM 667 C CD2 . HIS A 1 105 ? -3.403 -10.110 -33.338 1.000 66.235 0 111 HIS AAA CD2 1 ? 1 ATOM 668 C CE1 . HIS A 1 105 ? -3.846 -9.406 -31.300 1.000 71.415 0 111 HIS AAA CE1 1 ? 1 ATOM 669 N NE2 . HIS A 1 105 ? -3.771 -9.027 -32.582 1.000 73.124 0 111 HIS AAA NE2 1 ? 1 ATOM 670 N N . ASP A 1 106 ? -4.804 -14.290 -30.857 1.000 68.047 0 112 ASP AAA N 1 ? 1 ATOM 671 C CA . ASP A 1 106 ? -5.577 -14.473 -29.602 1.000 64.883 0 112 ASP AAA CA 1 ? 1 ATOM 672 C C . ASP A 1 106 ? -4.776 -13.861 -28.451 1.000 67.944 0 112 ASP AAA C 1 ? 1 ATOM 673 O O . ASP A 1 106 ? -3.687 -13.318 -28.713 1.000 64.033 0 112 ASP AAA O 1 ? 1 ATOM 674 C CB . ASP A 1 106 ? -5.796 -15.964 -29.314 1.000 64.677 0 112 ASP AAA CB 1 ? 1 ATOM 675 C CG . ASP A 1 106 ? -7.203 -16.469 -29.603 1.000 69.685 0 112 ASP AAA CG 1 ? 1 ATOM 676 O OD1 . ASP A 1 106 ? -8.180 -15.712 -29.324 1.000 74.680 0 112 ASP AAA OD1 1 ? 1 ATOM 677 O OD2 . ASP A 1 106 ? -7.316 -17.628 -30.080 1.000 71.694 0 112 ASP AAA OD2 1 ? 1 ATOM 678 N N . ALA A 1 107 ? -5.295 -13.975 -27.224 1.000 73.337 0 113 ALA AAA N 1 ? 1 ATOM 679 C CA . ALA A 1 107 ? -4.596 -13.658 -25.957 1.000 73.927 0 113 ALA AAA CA 1 ? 1 ATOM 680 C C . ALA A 1 107 ? -3.318 -14.500 -25.826 1.000 71.891 0 113 ALA AAA C 1 ? 1 ATOM 681 O O . ALA A 1 107 ? -2.279 -13.943 -25.393 1.000 73.366 0 113 ALA AAA O 1 ? 1 ATOM 682 C CB . ALA A 1 107 ? -5.528 -13.917 -24.806 1.000 79.241 0 113 ALA AAA CB 1 ? 1 ATOM 683 N N . ARG A 1 108 ? -3.402 -15.789 -26.187 1.000 67.407 0 114 ARG AAA N 1 ? 1 ATOM 684 C CA . ARG A 1 108 ? -2.329 -16.806 -26.015 1.000 65.660 0 114 ARG AAA CA 1 ? 1 ATOM 685 C C . ARG A 1 108 ? -1.635 -17.107 -27.357 1.000 63.364 0 114 ARG AAA C 1 ? 1 ATOM 686 O O . ARG A 1 108 ? -0.438 -17.445 -27.338 1.000 62.389 0 114 ARG AAA O 1 ? 1 ATOM 687 C CB . ARG A 1 108 ? -2.963 -18.052 -25.382 1.000 64.893 0 114 ARG AAA CB 1 ? 1 ATOM 688 C CG . ARG A 1 108 ? -3.555 -17.784 -24.002 1.000 69.842 0 114 ARG AAA CG 1 ? 1 ATOM 689 C CD . ARG A 1 108 ? -4.859 -18.479 -23.599 1.000 71.582 0 114 ARG AAA CD 1 ? 1 ATOM 690 N NE . ARG A 1 108 ? -4.757 -19.448 -22.500 1.000 76.007 0 114 ARG AAA NE 1 ? 1 ATOM 691 C CZ . ARG A 1 108 ? -5.019 -19.223 -21.203 1.000 79.591 0 114 ARG AAA CZ 1 ? 1 ATOM 692 N NH1 . ARG A 1 108 ? -5.416 -18.039 -20.768 1.000 82.763 0 114 ARG AAA NH1 1 ? 1 ATOM 693 N NH2 . ARG A 1 108 ? -4.877 -20.204 -20.328 1.000 81.363 0 114 ARG AAA NH2 1 ? 1 ATOM 694 N N . ARG A 1 109 ? -2.347 -16.991 -28.486 1.000 62.592 0 115 ARG AAA N 1 ? 1 ATOM 695 C CA . ARG A 1 109 ? -1.951 -17.609 -29.785 1.000 58.154 0 115 ARG AAA CA 1 ? 1 ATOM 696 C C . ARG A 1 109 ? -1.708 -16.539 -30.860 1.000 57.465 0 115 ARG AAA C 1 ? 1 ATOM 697 O O . ARG A 1 109 ? -2.316 -15.459 -30.780 1.000 59.625 0 115 ARG AAA O 1 ? 1 ATOM 698 C CB . ARG A 1 109 ? -3.046 -18.572 -30.257 1.000 56.378 0 115 ARG AAA CB 1 ? 1 ATOM 699 C CG . ARG A 1 109 ? -2.680 -20.049 -30.177 1.000 56.686 0 115 ARG AAA CG 1 ? 1 ATOM 700 C CD . ARG A 1 109 ? -2.002 -20.509 -28.906 1.000 60.092 0 115 ARG AAA CD 1 ? 1 ATOM 701 N NE . ARG A 1 109 ? -2.154 -21.943 -28.693 1.000 60.184 0 115 ARG AAA NE 1 ? 1 ATOM 702 C CZ . ARG A 1 109 ? -2.119 -22.540 -27.502 1.000 62.794 0 115 ARG AAA CZ 1 ? 1 ATOM 703 N NH1 . ARG A 1 109 ? -2.289 -23.847 -27.421 1.000 65.722 0 115 ARG AAA NH1 1 ? 1 ATOM 704 N NH2 . ARG A 1 109 ? -1.906 -21.848 -26.397 1.000 63.637 0 115 ARG AAA NH2 1 ? 1 ATOM 705 N N . VAL A 1 110 ? -0.835 -16.851 -31.825 1.000 56.026 0 116 VAL AAA N 1 ? 1 ATOM 706 C CA . VAL A 1 110 ? -0.740 -16.184 -33.161 1.000 55.659 0 116 VAL AAA CA 1 ? 1 ATOM 707 C C . VAL A 1 110 ? -1.009 -17.254 -34.220 1.000 54.397 0 116 VAL AAA C 1 ? 1 ATOM 708 O O . VAL A 1 110 ? -0.367 -18.315 -34.154 1.000 59.722 0 116 VAL AAA O 1 ? 1 ATOM 709 C CB . VAL A 1 110 ? 0.624 -15.507 -33.404 1.000 53.393 0 116 VAL AAA CB 1 ? 1 ATOM 710 C CG1 . VAL A 1 110 ? 0.768 -15.023 -34.839 1.000 47.738 0 116 VAL AAA CG1 1 ? 1 ATOM 711 C CG2 . VAL A 1 110 ? 0.887 -14.374 -32.420 1.000 54.911 0 116 VAL AAA CG2 1 ? 1 ATOM 712 N N . TYR A 1 111 ? -1.930 -16.986 -35.146 1.000 52.537 0 117 TYR AAA N 1 ? 1 ATOM 713 C CA . TYR A 1 111 ? -2.344 -17.924 -36.219 1.000 51.189 0 117 TYR AAA CA 1 ? 1 ATOM 714 C C . TYR A 1 111 ? -1.834 -17.397 -37.558 1.000 47.774 0 117 TYR AAA C 1 ? 1 ATOM 715 O O . TYR A 1 111 ? -2.107 -16.238 -37.916 1.000 47.325 0 117 TYR AAA O 1 ? 1 ATOM 716 C CB . TYR A 1 111 ? -3.864 -18.100 -36.214 1.000 55.455 0 117 TYR AAA CB 1 ? 1 ATOM 717 C CG . TYR A 1 111 ? -4.419 -18.528 -34.879 1.000 59.921 0 117 TYR AAA CG 1 ? 1 ATOM 718 C CD1 . TYR A 1 111 ? -4.798 -17.595 -33.928 1.000 61.318 0 117 TYR AAA CD1 1 ? 1 ATOM 719 C CD2 . TYR A 1 111 ? -4.533 -19.868 -34.553 1.000 61.800 0 117 TYR AAA CD2 1 ? 1 ATOM 720 C CE1 . TYR A 1 111 ? -5.300 -17.982 -32.698 1.000 63.229 0 117 TYR AAA CE1 1 ? 1 ATOM 721 C CE2 . TYR A 1 111 ? -5.023 -20.272 -33.323 1.000 63.502 0 117 TYR AAA CE2 1 ? 1 ATOM 722 C CZ . TYR A 1 111 ? -5.423 -19.326 -32.398 1.000 64.399 0 117 TYR AAA CZ 1 ? 1 ATOM 723 O OH . TYR A 1 111 ? -5.907 -19.724 -31.186 1.000 66.725 0 117 TYR AAA OH 1 ? 1 ATOM 724 N N . LEU A 1 112 ? -1.080 -18.233 -38.263 1.000 47.766 0 118 LEU AAA N 1 ? 1 ATOM 725 C CA . LEU A 1 112 ? -0.709 -18.010 -39.682 1.000 46.784 0 118 LEU AAA CA 1 ? 1 ATOM 726 C C . LEU A 1 112 ? -1.592 -18.908 -40.553 1.000 44.828 0 118 LEU AAA C 1 ? 1 ATOM 727 O O . LEU A 1 112 ? -1.554 -20.146 -40.352 1.000 44.598 0 118 LEU AAA O 1 ? 1 ATOM 728 C CB . LEU A 1 112 ? 0.785 -18.306 -39.854 1.000 43.975 0 118 LEU AAA CB 1 ? 1 ATOM 729 C CG . LEU A 1 112 ? 1.697 -17.473 -38.954 1.000 44.110 0 118 LEU AAA CG 1 ? 1 ATOM 730 C CD1 . LEU A 1 112 ? 3.152 -17.638 -39.346 1.000 45.653 0 118 LEU AAA CD1 1 ? 1 ATOM 731 C CD2 . LEU A 1 112 ? 1.293 -16.003 -38.971 1.000 43.413 0 118 LEU AAA CD2 1 ? 1 ATOM 732 N N . ILE A 1 113 ? -2.402 -18.290 -41.419 1.000 45.005 0 119 ILE AAA N 1 ? 1 ATOM 733 C CA . ILE A 1 113 ? -3.200 -18.976 -42.480 1.000 44.232 0 119 ILE AAA CA 1 ? 1 ATOM 734 C C . ILE A 1 113 ? -2.268 -19.162 -43.675 1.000 41.986 0 119 ILE AAA C 1 ? 1 ATOM 735 O O . ILE A 1 113 ? -2.016 -18.159 -44.367 1.000 43.781 0 119 ILE AAA O 1 ? 1 ATOM 736 C CB . ILE A 1 113 ? -4.456 -18.179 -42.891 1.000 44.978 0 119 ILE AAA CB 1 ? 1 ATOM 737 C CG1 . ILE A 1 113 ? -5.232 -17.603 -41.702 1.000 46.106 0 119 ILE AAA CG1 1 ? 1 ATOM 738 C CG2 . ILE A 1 113 ? -5.347 -19.046 -43.765 1.000 47.346 0 119 ILE AAA CG2 1 ? 1 ATOM 739 C CD1 . ILE A 1 113 ? -6.133 -16.445 -42.078 1.000 46.303 0 119 ILE AAA CD1 1 ? 1 ATOM 740 N N . LEU A 1 114 ? -1.765 -20.379 -43.885 1.000 41.250 0 120 LEU AAA N 1 ? 1 ATOM 741 C CA . LEU A 1 114 ? -0.736 -20.680 -44.916 1.000 43.048 0 120 LEU AAA CA 1 ? 1 ATOM 742 C C . LEU A 1 114 ? -1.332 -21.503 -46.074 1.000 44.166 0 120 LEU AAA C 1 ? 1 ATOM 743 O O . LEU A 1 114 ? -2.330 -22.232 -45.862 1.000 40.124 0 120 LEU AAA O 1 ? 1 ATOM 744 C CB . LEU A 1 114 ? 0.425 -21.428 -44.248 1.000 43.367 0 120 LEU AAA CB 1 ? 1 ATOM 745 C CG . LEU A 1 114 ? 1.268 -20.625 -43.255 1.000 43.309 0 120 LEU AAA CG 1 ? 1 ATOM 746 C CD1 . LEU A 1 114 ? 2.337 -21.502 -42.623 1.000 42.968 0 120 LEU AAA CD1 1 ? 1 ATOM 747 C CD2 . LEU A 1 114 ? 1.911 -19.414 -43.916 1.000 42.772 0 120 LEU AAA CD2 1 ? 1 ATOM 748 N N . GLU A 1 115 ? -0.719 -21.391 -47.259 1.000 44.919 0 121 GLU AAA N 1 ? 1 ATOM 749 C CA . GLU A 1 115 ? -0.947 -22.293 -48.421 1.000 46.326 0 121 GLU AAA CA 1 ? 1 ATOM 750 C C . GLU A 1 115 ? -0.737 -23.736 -47.949 1.000 46.939 0 121 GLU AAA C 1 ? 1 ATOM 751 O O . GLU A 1 115 ? 0.285 -23.983 -47.274 1.000 48.421 0 121 GLU AAA O 1 ? 1 ATOM 752 C CB . GLU A 1 115 ? 0.003 -21.946 -49.575 1.000 48.597 0 121 GLU AAA CB 1 ? 1 ATOM 753 C CG . GLU A 1 115 ? -0.279 -22.708 -50.860 1.000 49.966 0 121 GLU AAA CG 1 ? 1 ATOM 754 C CD . GLU A 1 115 ? 0.781 -22.608 -51.949 1.000 51.048 0 121 GLU AAA CD 1 ? 1 ATOM 755 O OE1 . GLU A 1 115 ? 1.501 -21.578 -51.995 1.000 49.423 0 121 GLU AAA OE1 1 ? 1 ATOM 756 O OE2 . GLU A 1 115 ? 0.885 -23.574 -52.750 1.000 48.279 0 121 GLU AAA OE2 1 ? 1 ATOM 757 N N . TYR A 1 116 ? -1.688 -24.630 -48.259 1.000 44.996 0 122 TYR AAA N 1 ? 1 ATOM 758 C CA . TYR A 1 116 ? -1.628 -26.091 -47.984 1.000 42.107 0 122 TYR AAA CA 1 ? 1 ATOM 759 C C . TYR A 1 116 ? -0.862 -26.756 -49.129 1.000 41.246 0 122 TYR AAA C 1 ? 1 ATOM 760 O O . TYR A 1 116 ? -1.254 -26.553 -50.299 1.000 47.506 0 122 TYR AAA O 1 ? 1 ATOM 761 C CB . TYR A 1 116 ? -3.032 -26.681 -47.784 1.000 43.313 0 122 TYR AAA CB 1 ? 1 ATOM 762 C CG . TYR A 1 116 ? -3.096 -28.185 -47.616 1.000 44.808 0 122 TYR AAA CG 1 ? 1 ATOM 763 C CD1 . TYR A 1 116 ? -2.357 -28.834 -46.640 1.000 45.662 0 122 TYR AAA CD1 1 ? 1 ATOM 764 C CD2 . TYR A 1 116 ? -3.921 -28.963 -48.414 1.000 46.089 0 122 TYR AAA CD2 1 ? 1 ATOM 765 C CE1 . TYR A 1 116 ? -2.406 -30.210 -46.485 1.000 47.340 0 122 TYR AAA CE1 1 ? 1 ATOM 766 C CE2 . TYR A 1 116 ? -3.985 -30.339 -48.272 1.000 47.773 0 122 TYR AAA CE2 1 ? 1 ATOM 767 C CZ . TYR A 1 116 ? -3.220 -30.967 -47.308 1.000 49.215 0 122 TYR AAA CZ 1 ? 1 ATOM 768 O OH . TYR A 1 116 ? -3.276 -32.321 -47.157 1.000 52.980 0 122 TYR AAA OH 1 ? 1 ATOM 769 N N . ALA A 1 117 ? 0.216 -27.471 -48.787 1.000 38.098 0 123 ALA AAA N 1 ? 1 ATOM 770 C CA . ALA A 1 117 ? 1.043 -28.312 -49.678 1.000 39.545 0 123 ALA AAA CA 1 ? 1 ATOM 771 C C . ALA A 1 117 ? 0.511 -29.744 -49.678 1.000 43.969 0 123 ALA AAA C 1 ? 1 ATOM 772 O O . ALA A 1 117 ? 0.925 -30.550 -48.851 1.000 47.296 0 123 ALA AAA O 1 ? 1 ATOM 773 C CB . ALA A 1 117 ? 2.485 -28.267 -49.238 1.000 37.645 0 123 ALA AAA CB 1 ? 1 ATOM 774 N N . PRO A 1 118 ? -0.372 -30.124 -50.636 1.000 52.915 0 124 PRO AAA N 1 ? 2 ATOM 775 C CA . PRO A 1 118 ? -1.007 -31.446 -50.634 1.000 54.733 0 124 PRO AAA CA 1 ? 2 ATOM 776 C C . PRO A 1 118 ? -0.062 -32.657 -50.629 1.000 54.887 0 124 PRO AAA C 1 ? 2 ATOM 777 O O . PRO A 1 118 ? -0.472 -33.671 -50.132 1.000 57.445 0 124 PRO AAA O 1 ? 2 ATOM 778 C CB . PRO A 1 118 ? -1.806 -31.471 -51.950 1.000 54.713 0 124 PRO AAA CB 1 ? 2 ATOM 779 C CG . PRO A 1 118 ? -2.053 -30.017 -52.263 1.000 52.983 0 124 PRO AAA CG 1 ? 2 ATOM 780 C CD . PRO A 1 118 ? -0.799 -29.313 -51.788 1.000 50.875 0 124 PRO AAA CD 1 ? 2 ATOM 781 N N . ARG A 1 119 ? 1.143 -32.538 -51.199 1.000 56.668 0 125 ARG AAA N 1 ? 2 ATOM 782 C CA . ARG A 1 119 ? 2.111 -33.663 -51.356 1.000 60.463 0 125 ARG AAA CA 1 ? 2 ATOM 783 C C . ARG A 1 119 ? 3.187 -33.600 -50.261 1.000 60.177 0 125 ARG AAA C 1 ? 2 ATOM 784 O O . ARG A 1 119 ? 4.173 -34.333 -50.376 1.000 64.791 0 125 ARG AAA O 1 ? 2 ATOM 785 C CB . ARG A 1 119 ? 2.695 -33.659 -52.774 1.000 64.583 0 125 ARG AAA CB 1 ? 2 ATOM 786 C CG . ARG A 1 119 ? 1.716 -34.168 -53.825 1.000 69.640 0 125 ARG AAA CG 1 ? 2 ATOM 787 C CD . ARG A 1 119 ? 2.299 -34.437 -55.196 1.000 73.958 0 125 ARG AAA CD 1 ? 2 ATOM 788 N NE . ARG A 1 119 ? 1.629 -35.588 -55.802 1.000 80.409 0 125 ARG AAA NE 1 ? 2 ATOM 789 C CZ . ARG A 1 119 ? 2.084 -36.843 -55.795 1.000 83.991 0 125 ARG AAA CZ 1 ? 2 ATOM 790 N NH1 . ARG A 1 119 ? 3.242 -37.139 -55.226 1.000 87.649 0 125 ARG AAA NH1 1 ? 2 ATOM 791 N NH2 . ARG A 1 119 ? 1.380 -37.804 -56.369 1.000 83.622 0 125 ARG AAA NH2 1 ? 2 ATOM 792 N N . GLY A 1 120 ? 2.996 -32.764 -49.237 1.000 59.851 0 126 GLY AAA N 1 ? 2 ATOM 793 C CA . GLY A 1 120 ? 3.798 -32.742 -47.998 1.000 59.481 0 126 GLY AAA CA 1 ? 2 ATOM 794 C C . GLY A 1 120 ? 5.251 -32.343 -48.210 1.000 59.970 0 126 GLY AAA C 1 ? 2 ATOM 795 O O . GLY A 1 120 ? 5.537 -31.508 -49.089 1.000 60.652 0 126 GLY AAA O 1 ? 2 ATOM 796 N N . GLU A 1 121 ? 6.138 -32.913 -47.391 1.000 63.911 0 127 GLU AAA N 1 ? 2 ATOM 797 C CA . GLU A 1 121 ? 7.580 -32.564 -47.279 1.000 62.109 0 127 GLU AAA CA 1 ? 2 ATOM 798 C C . GLU A 1 121 ? 8.349 -33.275 -48.397 1.000 57.922 0 127 GLU AAA C 1 ? 2 ATOM 799 O O . GLU A 1 121 ? 8.012 -34.443 -48.698 1.000 57.206 0 127 GLU AAA O 1 ? 2 ATOM 800 C CB . GLU A 1 121 ? 8.063 -32.955 -45.878 1.000 67.030 0 127 GLU AAA CB 1 ? 2 ATOM 801 C CG . GLU A 1 121 ? 9.465 -32.482 -45.531 1.000 71.999 0 127 GLU AAA CG 1 ? 2 ATOM 802 C CD . GLU A 1 121 ? 9.794 -32.623 -44.050 1.000 75.967 0 127 GLU AAA CD 1 ? 2 ATOM 803 O OE1 . GLU A 1 121 ? 9.021 -32.067 -43.237 1.000 86.275 0 127 GLU AAA OE1 1 ? 2 ATOM 804 O OE2 . GLU A 1 121 ? 10.800 -33.307 -43.706 1.000 64.637 0 127 GLU AAA OE2 1 ? 2 ATOM 805 N N . LEU A 1 122 ? 9.328 -32.592 -49.003 1.000 55.472 0 128 LEU AAA N 1 ? 2 ATOM 806 C CA . LEU A 1 122 ? 10.156 -33.143 -50.110 1.000 53.765 0 128 LEU AAA CA 1 ? 2 ATOM 807 C C . LEU A 1 122 ? 10.996 -34.302 -49.568 1.000 59.483 0 128 LEU AAA C 1 ? 2 ATOM 808 O O . LEU A 1 122 ? 11.021 -35.354 -50.226 1.000 63.577 0 128 LEU AAA O 1 ? 2 ATOM 809 C CB . LEU A 1 122 ? 11.043 -32.044 -50.707 1.000 52.392 0 128 LEU AAA CB 1 ? 2 ATOM 810 C CG . LEU A 1 122 ? 11.982 -32.469 -51.841 1.000 52.620 0 128 LEU AAA CG 1 ? 2 ATOM 811 C CD1 . LEU A 1 122 ? 11.233 -33.195 -52.949 1.000 49.818 0 128 LEU AAA CD1 1 ? 2 ATOM 812 C CD2 . LEU A 1 122 ? 12.723 -31.266 -52.412 1.000 54.321 0 128 LEU AAA CD2 1 ? 2 ATOM 813 N N . TYR A 1 123 ? 11.637 -34.127 -48.406 1.000 64.086 0 129 TYR AAA N 1 ? 2 ATOM 814 C CA . TYR A 1 123 ? 12.531 -35.147 -47.798 1.000 61.865 0 129 TYR AAA CA 1 ? 2 ATOM 815 C C . TYR A 1 123 ? 11.760 -36.456 -47.610 1.000 60.804 0 129 TYR AAA C 1 ? 2 ATOM 816 O O . TYR A 1 123 ? 12.327 -37.545 -47.846 1.000 58.417 0 129 TYR AAA O 1 ? 2 ATOM 817 C CB . TYR A 1 123 ? 13.101 -34.699 -46.453 1.000 62.576 0 129 TYR AAA CB 1 ? 2 ATOM 818 C CG . TYR A 1 123 ? 14.002 -35.739 -45.837 1.000 66.016 0 129 TYR AAA CG 1 ? 2 ATOM 819 C CD1 . TYR A 1 123 ? 15.270 -35.983 -46.348 1.000 65.225 0 129 TYR AAA CD1 1 ? 2 ATOM 820 C CD2 . TYR A 1 123 ? 13.572 -36.517 -44.773 1.000 68.818 0 129 TYR AAA CD2 1 ? 2 ATOM 821 C CE1 . TYR A 1 123 ? 16.096 -36.954 -45.806 1.000 66.567 0 129 TYR AAA CE1 1 ? 2 ATOM 822 C CE2 . TYR A 1 123 ? 14.387 -37.491 -44.218 1.000 70.096 0 129 TYR AAA CE2 1 ? 2 ATOM 823 C CZ . TYR A 1 123 ? 15.653 -37.710 -44.735 1.000 69.617 0 129 TYR AAA CZ 1 ? 2 ATOM 824 O OH . TYR A 1 123 ? 16.443 -38.675 -44.182 1.000 72.774 0 129 TYR AAA OH 1 ? 2 ATOM 825 N N . LYS A 1 124 ? 10.501 -36.343 -47.189 1.000 60.641 0 130 LYS AAA N 1 ? 2 ATOM 826 C CA . LYS A 1 124 ? 9.616 -37.512 -46.952 1.000 60.862 0 130 LYS AAA CA 1 ? 2 ATOM 827 C C . LYS A 1 124 ? 9.310 -38.172 -48.299 1.000 55.463 0 130 LYS AAA C 1 ? 2 ATOM 828 O O . LYS A 1 124 ? 9.368 -39.406 -48.367 1.000 55.303 0 130 LYS AAA O 1 ? 2 ATOM 829 C CB . LYS A 1 124 ? 8.352 -37.089 -46.196 1.000 62.303 0 130 LYS AAA CB 1 ? 2 ATOM 830 C CG . LYS A 1 124 ? 7.481 -38.240 -45.705 1.000 66.109 0 130 LYS AAA CG 1 ? 2 ATOM 831 C CD . LYS A 1 124 ? 5.994 -37.922 -45.710 1.000 68.877 0 130 LYS AAA CD 1 ? 2 ATOM 832 C CE . LYS A 1 124 ? 5.117 -39.155 -45.766 1.000 71.144 0 130 LYS AAA CE 1 ? 2 ATOM 833 N NZ . LYS A 1 124 ? 3.713 -38.789 -46.058 1.000 71.630 0 130 LYS AAA NZ 1 ? 2 ATOM 834 N N . GLU A 1 125 ? 9.022 -37.379 -49.332 1.000 53.871 0 131 GLU AAA N 1 ? 2 ATOM 835 C CA . GLU A 1 125 ? 8.760 -37.887 -50.709 1.000 57.198 0 131 GLU AAA CA 1 ? 2 ATOM 836 C C . GLU A 1 125 ? 10.017 -38.588 -51.246 1.000 57.022 0 131 GLU AAA C 1 ? 2 ATOM 837 O O . GLU A 1 125 ? 9.870 -39.635 -51.897 1.000 56.368 0 131 GLU AAA O 1 ? 2 ATOM 838 C CB . GLU A 1 125 ? 8.319 -36.750 -51.636 1.000 57.512 0 131 GLU AAA CB 1 ? 2 ATOM 839 C CG . GLU A 1 125 ? 8.118 -37.169 -53.078 1.000 58.617 0 131 GLU AAA CG 1 ? 2 ATOM 840 C CD . GLU A 1 125 ? 7.200 -38.360 -53.273 1.000 65.706 0 131 GLU AAA CD 1 ? 2 ATOM 841 O OE1 . GLU A 1 125 ? 6.188 -38.442 -52.553 1.000 71.430 0 131 GLU AAA OE1 1 ? 2 ATOM 842 O OE2 . GLU A 1 125 ? 7.501 -39.202 -54.151 1.000 69.094 0 131 GLU AAA OE2 1 ? 2 ATOM 843 N N . LEU A 1 126 ? 11.204 -38.040 -50.967 1.000 57.587 0 132 LEU AAA N 1 ? 2 ATOM 844 C CA . LEU A 1 126 ? 12.507 -38.603 -51.413 1.000 60.200 0 132 LEU AAA CA 1 ? 2 ATOM 845 C C . LEU A 1 126 ? 12.727 -39.991 -50.792 1.000 65.279 0 132 LEU AAA C 1 ? 2 ATOM 846 O O . LEU A 1 126 ? 13.065 -40.926 -51.544 1.000 73.292 0 132 LEU AAA O 1 ? 2 ATOM 847 C CB . LEU A 1 126 ? 13.638 -37.638 -51.045 1.000 57.194 0 132 LEU AAA CB 1 ? 2 ATOM 848 C CG . LEU A 1 126 ? 15.048 -38.094 -51.416 1.000 58.097 0 132 LEU AAA CG 1 ? 2 ATOM 849 C CD1 . LEU A 1 126 ? 15.193 -38.239 -52.923 1.000 59.983 0 132 LEU AAA CD1 1 ? 2 ATOM 850 C CD2 . LEU A 1 126 ? 16.085 -37.121 -50.877 1.000 58.826 0 132 LEU AAA CD2 1 ? 2 ATOM 851 N N . GLN A 1 127 ? 12.549 -40.139 -49.480 1.000 68.005 0 133 GLN AAA N 1 ? 2 ATOM 852 C CA . GLN A 1 127 ? 12.764 -41.442 -48.792 1.000 76.424 0 133 GLN AAA CA 1 ? 2 ATOM 853 C C . GLN A 1 127 ? 11.839 -42.489 -49.417 1.000 74.316 0 133 GLN AAA C 1 ? 2 ATOM 854 O O . GLN A 1 127 ? 12.305 -43.622 -49.626 1.000 76.154 0 133 GLN AAA O 1 ? 2 ATOM 855 C CB . GLN A 1 127 ? 12.507 -41.344 -47.289 1.000 84.009 0 133 GLN AAA CB 1 ? 2 ATOM 856 C CG . GLN A 1 127 ? 13.553 -40.542 -46.528 1.000 89.231 0 133 GLN AAA CG 1 ? 2 ATOM 857 C CD . GLN A 1 127 ? 13.194 -40.481 -45.065 1.000 106.377 0 133 GLN AAA CD 1 ? 2 ATOM 858 O OE1 . GLN A 1 127 ? 12.459 -39.598 -44.625 1.000 115.905 0 133 GLN AAA OE1 1 ? 2 ATOM 859 N NE2 . GLN A 1 127 ? 13.702 -41.433 -44.295 1.000 114.813 0 133 GLN AAA NE2 1 ? 2 ATOM 860 N N . LYS A 1 128 ? 10.589 -42.109 -49.700 1.000 73.352 0 134 LYS AAA N 1 ? 2 ATOM 861 C CA . LYS A 1 128 ? 9.543 -42.993 -50.285 1.000 77.121 0 134 LYS AAA CA 1 ? 2 ATOM 862 C C . LYS A 1 128 ? 9.918 -43.353 -51.730 1.000 75.296 0 134 LYS AAA C 1 ? 2 ATOM 863 O O . LYS A 1 128 ? 9.653 -44.494 -52.133 1.000 78.231 0 134 LYS AAA O 1 ? 2 ATOM 864 C CB . LYS A 1 128 ? 8.170 -42.312 -50.210 1.000 83.013 0 134 LYS AAA CB 1 ? 2 ATOM 865 C CG . LYS A 1 128 ? 7.094 -42.881 -51.129 1.000 90.985 0 134 LYS AAA CG 1 ? 2 ATOM 866 C CD . LYS A 1 128 ? 5.746 -42.201 -50.978 1.000 96.574 0 134 LYS AAA CD 1 ? 2 ATOM 867 C CE . LYS A 1 128 ? 4.980 -42.113 -52.280 1.000 94.638 0 134 LYS AAA CE 1 ? 2 ATOM 868 N NZ . LYS A 1 128 ? 4.836 -43.444 -52.916 1.000 101.423 0 134 LYS AAA NZ 1 ? 2 ATOM 869 N N . SER A 1 129 ? 10.496 -42.415 -52.485 1.000 69.910 0 135 SER AAA N 1 ? 2 ATOM 870 C CA . SER A 1 129 ? 10.878 -42.597 -53.911 1.000 66.787 0 135 SER AAA CA 1 ? 2 ATOM 871 C C . SER A 1 129 ? 12.250 -43.282 -54.025 1.000 68.094 0 135 SER AAA C 1 ? 2 ATOM 872 O O . SER A 1 129 ? 12.573 -43.748 -55.133 1.000 68.702 0 135 SER AAA O 1 ? 2 ATOM 873 C CB . SER A 1 129 ? 10.865 -41.277 -54.648 1.000 61.655 0 135 SER AAA CB 1 ? 2 ATOM 874 O OG . SER A 1 129 ? 9.548 -40.758 -54.748 1.000 57.723 0 135 SER AAA OG 1 ? 2 ATOM 875 N N . GLU A 1 130 ? 13.023 -43.336 -52.933 1.000 65.651 0 136 GLU AAA N 1 ? 2 ATOM 876 C CA . GLU A 1 130 ? 14.464 -43.717 -52.901 1.000 67.916 0 136 GLU AAA CA 1 ? 2 ATOM 877 C C . GLU A 1 130 ? 15.276 -42.635 -53.621 1.000 66.853 0 136 GLU AAA C 1 ? 2 ATOM 878 O O . GLU A 1 130 ? 16.165 -42.048 -52.983 1.000 67.855 0 136 GLU AAA O 1 ? 2 ATOM 879 C CB . GLU A 1 130 ? 14.722 -45.100 -53.506 1.000 72.867 0 136 GLU AAA CB 1 ? 2 ATOM 880 C CG . GLU A 1 130 ? 14.154 -46.255 -52.694 1.000 78.416 0 136 GLU AAA CG 1 ? 2 ATOM 881 C CD . GLU A 1 130 ? 14.352 -47.624 -53.330 1.000 85.120 0 136 GLU AAA CD 1 ? 2 ATOM 882 O OE1 . GLU A 1 130 ? 15.363 -47.802 -54.042 1.000 91.129 0 136 GLU AAA OE1 1 ? 2 ATOM 883 O OE2 . GLU A 1 130 ? 13.493 -48.509 -53.126 1.000 86.150 0 136 GLU AAA OE2 1 ? 2 ATOM 884 N N . LYS A 1 131 ? 14.979 -42.379 -54.898 1.000 69.894 0 137 LYS AAA N 1 ? 2 ATOM 885 C CA . LYS A 1 131 ? 15.627 -41.316 -55.720 1.000 68.398 0 137 LYS AAA CA 1 ? 2 ATOM 886 C C . LYS A 1 131 ? 14.584 -40.713 -56.665 1.000 62.694 0 137 LYS AAA C 1 ? 2 ATOM 887 O O . LYS A 1 131 ? 13.582 -41.392 -56.938 1.000 63.644 0 137 LYS AAA O 1 ? 2 ATOM 888 C CB . LYS A 1 131 ? 16.828 -41.887 -56.484 1.000 71.509 0 137 LYS AAA CB 1 ? 2 ATOM 889 C CG . LYS A 1 131 ? 16.647 -43.287 -57.056 1.000 74.867 0 137 LYS AAA CG 1 ? 2 ATOM 890 C CD . LYS A 1 131 ? 17.946 -43.957 -57.431 1.000 78.570 0 137 LYS AAA CD 1 ? 2 ATOM 891 C CE . LYS A 1 131 ? 17.975 -45.415 -57.039 1.000 89.035 0 137 LYS AAA CE 1 ? 2 ATOM 892 N NZ . LYS A 1 131 ? 18.920 -46.178 -57.886 1.000 100.871 0 137 LYS AAA NZ 1 ? 2 ATOM 893 N N . LEU A 1 132 ? 14.804 -39.478 -57.122 1.000 59.303 0 138 LEU AAA N 1 ? 2 ATOM 894 C CA . LEU A 1 132 ? 13.905 -38.791 -58.088 1.000 62.466 0 138 LEU AAA CA 1 ? 2 ATOM 895 C C . LEU A 1 132 ? 14.480 -38.930 -59.501 1.000 69.415 0 138 LEU AAA C 1 ? 2 ATOM 896 O O . LEU A 1 132 ? 15.715 -38.825 -59.659 1.000 74.427 0 138 LEU AAA O 1 ? 2 ATOM 897 C CB . LEU A 1 132 ? 13.730 -37.325 -57.685 1.000 60.083 0 138 LEU AAA CB 1 ? 2 ATOM 898 C CG . LEU A 1 132 ? 12.493 -37.038 -56.833 1.000 59.106 0 138 LEU AAA CG 1 ? 2 ATOM 899 C CD1 . LEU A 1 132 ? 12.479 -37.889 -55.573 1.000 59.572 0 138 LEU AAA CD1 1 ? 2 ATOM 900 C CD2 . LEU A 1 132 ? 12.393 -35.561 -56.484 1.000 55.749 0 138 LEU AAA CD2 1 ? 2 ATOM 901 N N . ASP A 1 133 ? 13.617 -39.199 -60.486 1.000 71.952 0 139 ASP AAA N 1 ? 2 ATOM 902 C CA . ASP A 1 133 ? 14.000 -39.269 -61.922 1.000 73.407 0 139 ASP AAA CA 1 ? 2 ATOM 903 C C . ASP A 1 133 ? 14.538 -37.898 -62.342 1.000 73.313 0 139 ASP AAA C 1 ? 2 ATOM 904 O O . ASP A 1 133 ? 14.411 -36.940 -61.552 1.000 74.836 0 139 ASP AAA O 1 ? 2 ATOM 905 C CB . ASP A 1 133 ? 12.834 -39.721 -62.804 1.000 76.725 0 139 ASP AAA CB 1 ? 2 ATOM 906 C CG . ASP A 1 133 ? 11.565 -38.908 -62.619 1.000 78.216 0 139 ASP AAA CG 1 ? 2 ATOM 907 O OD1 . ASP A 1 133 ? 11.671 -37.675 -62.484 1.000 78.471 0 139 ASP AAA OD1 1 ? 2 ATOM 908 O OD2 . ASP A 1 133 ? 10.484 -39.517 -62.595 1.000 85.801 0 139 ASP AAA OD2 1 ? 2 ATOM 909 N N . GLU A 1 134 ? 15.100 -37.807 -63.546 1.000 74.008 0 140 GLU AAA N 1 ? 2 ATOM 910 C CA . GLU A 1 134 ? 15.734 -36.570 -64.067 1.000 69.929 0 140 GLU AAA CA 1 ? 2 ATOM 911 C C . GLU A 1 134 ? 14.668 -35.480 -64.210 1.000 66.490 0 140 GLU AAA C 1 ? 2 ATOM 912 O O . GLU A 1 134 ? 15.025 -34.297 -64.064 1.000 67.502 0 140 GLU AAA O 1 ? 2 ATOM 913 C CB . GLU A 1 134 ? 16.410 -36.834 -65.411 1.000 72.349 0 140 GLU AAA CB 1 ? 2 ATOM 914 C CG . GLU A 1 134 ? 17.410 -37.972 -65.379 1.000 74.582 0 140 GLU AAA CG 1 ? 2 ATOM 915 C CD . GLU A 1 134 ? 18.185 -38.119 -66.673 1.000 79.433 0 140 GLU AAA CD 1 ? 2 ATOM 916 O OE1 . GLU A 1 134 ? 18.612 -37.082 -67.218 1.000 76.995 0 140 GLU AAA OE1 1 ? 2 ATOM 917 O OE2 . GLU A 1 134 ? 18.346 -39.265 -67.140 1.000 86.638 0 140 GLU AAA OE2 1 ? 2 ATOM 918 N N . GLN A 1 135 ? 13.419 -35.876 -64.484 1.000 64.209 0 141 GLN AAA N 1 ? 2 ATOM 919 C CA . GLN A 1 135 ? 12.281 -34.963 -64.783 1.000 64.786 0 141 GLN AAA CA 1 ? 2 ATOM 920 C C . GLN A 1 135 ? 11.945 -34.159 -63.515 1.000 59.656 0 141 GLN AAA C 1 ? 2 ATOM 921 O O . GLN A 1 135 ? 12.023 -32.910 -63.549 1.000 54.147 0 141 GLN AAA O 1 ? 2 ATOM 922 C CB . GLN A 1 135 ? 11.090 -35.774 -65.312 1.000 70.935 0 141 GLN AAA CB 1 ? 2 ATOM 923 C CG . GLN A 1 135 ? 10.180 -35.002 -66.259 1.000 78.545 0 141 GLN AAA CG 1 ? 2 ATOM 924 C CD . GLN A 1 135 ? 9.145 -35.884 -66.920 1.000 86.491 0 141 GLN AAA CD 1 ? 2 ATOM 925 O OE1 . GLN A 1 135 ? 9.343 -36.387 -68.025 1.000 76.351 0 141 GLN AAA OE1 1 ? 2 ATOM 926 N NE2 . GLN A 1 135 ? 8.022 -36.081 -66.246 1.000 90.308 0 141 GLN AAA NE2 1 ? 2 ATOM 927 N N . ARG A 1 136 ? 11.612 -34.857 -62.425 1.000 57.003 0 142 ARG AAA N 1 ? 2 ATOM 928 C CA . ARG A 1 136 ? 11.141 -34.253 -61.149 1.000 55.260 0 142 ARG AAA CA 1 ? 2 ATOM 929 C C . ARG A 1 136 ? 12.250 -33.376 -60.548 1.000 52.777 0 142 ARG AAA C 1 ? 2 ATOM 930 O O . ARG A 1 136 ? 11.940 -32.251 -60.088 1.000 51.550 0 142 ARG AAA O 1 ? 2 ATOM 931 C CB . ARG A 1 136 ? 10.715 -35.359 -60.185 1.000 58.178 0 142 ARG AAA CB 1 ? 2 ATOM 932 C CG . ARG A 1 136 ? 9.525 -36.172 -60.673 1.000 64.543 0 142 ARG AAA CG 1 ? 2 ATOM 933 C CD . ARG A 1 136 ? 9.343 -37.437 -59.862 1.000 67.863 0 142 ARG AAA CD 1 ? 2 ATOM 934 N NE . ARG A 1 136 ? 8.807 -37.115 -58.552 1.000 70.025 0 142 ARG AAA NE 1 ? 2 ATOM 935 C CZ . ARG A 1 136 ? 8.693 -37.972 -57.541 1.000 79.323 0 142 ARG AAA CZ 1 ? 2 ATOM 936 N NH1 . ARG A 1 136 ? 9.069 -39.232 -57.687 1.000 83.719 0 142 ARG AAA NH1 1 ? 2 ATOM 937 N NH2 . ARG A 1 136 ? 8.202 -37.564 -56.381 1.000 79.347 0 142 ARG AAA NH2 1 ? 2 ATOM 938 N N . THR A 1 137 ? 13.492 -33.867 -60.594 1.000 51.379 0 143 THR AAA N 1 ? 2 ATOM 939 C CA . THR A 1 137 ? 14.718 -33.194 -60.089 1.000 50.223 0 143 THR AAA CA 1 ? 2 ATOM 940 C C . THR A 1 137 ? 14.962 -31.872 -60.837 1.000 50.845 0 143 THR AAA C 1 ? 2 ATOM 941 O O . THR A 1 137 ? 15.112 -30.835 -60.167 1.000 53.907 0 143 THR AAA O 1 ? 2 ATOM 942 C CB . THR A 1 137 ? 15.913 -34.146 -60.200 1.000 50.373 0 143 THR AAA CB 1 ? 2 ATOM 943 O OG1 . THR A 1 137 ? 15.576 -35.310 -59.443 1.000 49.307 0 143 THR AAA OG1 1 ? 2 ATOM 944 C CG2 . THR A 1 137 ? 17.206 -33.535 -59.707 1.000 50.275 0 143 THR AAA CG2 1 ? 2 ATOM 945 N N . ALA A 1 138 ? 15.017 -31.903 -62.170 1.000 50.237 0 144 ALA AAA N 1 ? 2 ATOM 946 C CA . ALA A 1 138 ? 15.320 -30.731 -63.030 1.000 51.638 0 144 ALA AAA CA 1 ? 2 ATOM 947 C C . ALA A 1 138 ? 14.179 -29.702 -62.956 1.000 49.799 0 144 ALA AAA C 1 ? 2 ATOM 948 O O . ALA A 1 138 ? 14.451 -28.473 -63.112 1.000 53.134 0 144 ALA AAA O 1 ? 2 ATOM 949 C CB . ALA A 1 138 ? 15.564 -31.167 -64.458 1.000 51.836 0 144 ALA AAA CB 1 ? 2 ATOM 950 N N . THR A 1 139 ? 12.943 -30.172 -62.769 1.000 45.793 0 145 THR AAA N 1 ? 2 ATOM 951 C CA . THR A 1 139 ? 11.761 -29.293 -62.578 1.000 45.944 0 145 THR AAA CA 1 ? 2 ATOM 952 C C . THR A 1 139 ? 11.943 -28.496 -61.281 1.000 44.661 0 145 THR AAA C 1 ? 2 ATOM 953 O O . THR A 1 139 ? 11.740 -27.267 -61.314 1.000 44.989 0 145 THR AAA O 1 ? 2 ATOM 954 C CB . THR A 1 139 ? 10.442 -30.079 -62.590 1.000 47.086 0 145 THR AAA CB 1 ? 2 ATOM 955 O OG1 . THR A 1 139 ? 10.364 -30.897 -63.761 1.000 44.357 0 145 THR AAA OG1 1 ? 2 ATOM 956 C CG2 . THR A 1 139 ? 9.236 -29.164 -62.545 1.000 46.706 0 145 THR AAA CG2 1 ? 2 ATOM 957 N N . ILE A 1 140 ? 12.343 -29.161 -60.193 1.000 44.026 0 146 ILE AAA N 1 ? 2 ATOM 958 C CA . ILE A 1 140 ? 12.585 -28.508 -58.869 1.000 44.320 0 146 ILE AAA CA 1 ? 2 ATOM 959 C C . ILE A 1 140 ? 13.723 -27.480 -59.025 1.000 45.056 0 146 ILE AAA C 1 ? 2 ATOM 960 O O . ILE A 1 140 ? 13.521 -26.306 -58.646 1.000 46.893 0 146 ILE AAA O 1 ? 2 ATOM 961 C CB . ILE A 1 140 ? 12.829 -29.564 -57.761 1.000 43.995 0 146 ILE AAA CB 1 ? 2 ATOM 962 C CG1 . ILE A 1 140 ? 11.546 -30.323 -57.403 1.000 43.117 0 146 ILE AAA CG1 1 ? 2 ATOM 963 C CG2 . ILE A 1 140 ? 13.422 -28.931 -56.516 1.000 46.073 0 146 ILE AAA CG2 1 ? 2 ATOM 964 C CD1 . ILE A 1 140 ? 11.764 -31.748 -56.942 1.000 42.184 0 146 ILE AAA CD1 1 ? 2 ATOM 965 N N . ILE A 1 141 ? 14.855 -27.881 -59.607 1.000 43.684 0 147 ILE AAA N 1 ? 2 ATOM 966 C CA . ILE A 1 141 ? 16.080 -27.033 -59.737 1.000 44.933 0 147 ILE AAA CA 1 ? 2 ATOM 967 C C . ILE A 1 141 ? 15.742 -25.713 -60.454 1.000 46.351 0 147 ILE AAA C 1 ? 2 ATOM 968 O O . ILE A 1 141 ? 16.259 -24.658 -60.049 1.000 45.119 0 147 ILE AAA O 1 ? 2 ATOM 969 C CB . ILE A 1 141 ? 17.195 -27.819 -60.456 1.000 46.504 0 147 ILE AAA CB 1 ? 2 ATOM 970 C CG1 . ILE A 1 141 ? 17.621 -29.064 -59.667 1.000 48.896 0 147 ILE AAA CG1 1 ? 2 ATOM 971 C CG2 . ILE A 1 141 ? 18.382 -26.920 -60.776 1.000 46.620 0 147 ILE AAA CG2 1 ? 2 ATOM 972 C CD1 . ILE A 1 141 ? 18.181 -28.783 -58.287 1.000 49.402 0 147 ILE AAA CD1 1 ? 2 ATOM 973 N N . GLU A 1 142 ? 14.924 -25.749 -61.503 1.000 50.130 0 148 GLU AAA N 1 ? 2 ATOM 974 C CA . GLU A 1 142 ? 14.532 -24.516 -62.235 1.000 53.588 0 148 GLU AAA CA 1 ? 2 ATOM 975 C C . GLU A 1 142 ? 13.609 -23.697 -61.324 1.000 54.211 0 148 GLU AAA C 1 ? 2 ATOM 976 O O . GLU A 1 142 ? 13.908 -22.500 -61.099 1.000 51.588 0 148 GLU AAA O 1 ? 2 ATOM 977 C CB . GLU A 1 142 ? 13.867 -24.861 -63.569 1.000 54.555 0 148 GLU AAA CB 1 ? 2 ATOM 978 C CG . GLU A 1 142 ? 13.363 -23.639 -64.327 1.000 54.656 0 148 GLU AAA CG 1 ? 2 ATOM 979 C CD . GLU A 1 142 ? 12.739 -23.946 -65.674 1.000 54.712 0 148 GLU AAA CD 1 ? 2 ATOM 980 O OE1 . GLU A 1 142 ? 12.559 -23.001 -66.466 1.000 58.216 0 148 GLU AAA OE1 1 ? 2 ATOM 981 O OE2 . GLU A 1 142 ? 12.453 -25.131 -65.931 1.000 50.981 0 148 GLU AAA OE2 1 ? 2 ATOM 982 N N . GLU A 1 143 ? 12.540 -24.330 -60.825 1.000 54.830 0 149 GLU AAA N 1 ? 2 ATOM 983 C CA . GLU A 1 143 ? 11.568 -23.727 -59.873 1.000 58.643 0 149 GLU AAA CA 1 ? 2 ATOM 984 C C . GLU A 1 143 ? 12.340 -22.979 -58.771 1.000 56.593 0 149 GLU AAA C 1 ? 2 ATOM 985 O O . GLU A 1 143 ? 12.053 -21.783 -58.551 1.000 57.467 0 149 GLU AAA O 1 ? 2 ATOM 986 C CB . GLU A 1 143 ? 10.653 -24.808 -59.284 1.000 60.633 0 149 GLU AAA CB 1 ? 2 ATOM 987 C CG . GLU A 1 143 ? 9.513 -25.217 -60.198 1.000 62.602 0 149 GLU AAA CG 1 ? 2 ATOM 988 C CD . GLU A 1 143 ? 8.545 -26.250 -59.636 1.000 66.113 0 149 GLU AAA CD 1 ? 2 ATOM 989 O OE1 . GLU A 1 143 ? 7.325 -26.018 -59.749 1.000 73.970 0 149 GLU AAA OE1 1 ? 2 ATOM 990 O OE2 . GLU A 1 143 ? 9.000 -27.293 -59.104 1.000 60.062 0 149 GLU AAA OE2 1 ? 2 ATOM 991 N N . LEU A 1 144 ? 13.300 -23.652 -58.128 1.000 50.463 0 150 LEU AAA N 1 ? 2 ATOM 992 C CA . LEU A 1 144 ? 14.112 -23.084 -57.023 1.000 54.150 0 150 LEU AAA CA 1 ? 2 ATOM 993 C C . LEU A 1 144 ? 14.987 -21.940 -57.545 1.000 56.586 0 150 LEU AAA C 1 ? 2 ATOM 994 O O . LEU A 1 144 ? 14.984 -20.852 -56.926 1.000 62.032 0 150 LEU AAA O 1 ? 2 ATOM 995 C CB . LEU A 1 144 ? 14.978 -24.184 -56.403 1.000 54.543 0 150 LEU AAA CB 1 ? 2 ATOM 996 C CG . LEU A 1 144 ? 14.267 -25.092 -55.404 1.000 50.961 0 150 LEU AAA CG 1 ? 2 ATOM 997 C CD1 . LEU A 1 144 ? 15.166 -26.244 -55.005 1.000 50.187 0 150 LEU AAA CD1 1 ? 2 ATOM 998 C CD2 . LEU A 1 144 ? 13.822 -24.310 -54.181 1.000 49.824 0 150 LEU AAA CD2 1 ? 2 ATOM 999 N N . ALA A 1 145 ? 15.727 -22.176 -58.625 1.000 53.162 0 151 ALA AAA N 1 ? 2 ATOM 1000 C CA . ALA A 1 145 ? 16.583 -21.149 -59.252 1.000 55.088 0 151 ALA AAA CA 1 ? 2 ATOM 1001 C C . ALA A 1 145 ? 15.736 -19.900 -59.506 1.000 54.057 0 151 ALA AAA C 1 ? 2 ATOM 1002 O O . ALA A 1 145 ? 16.266 -18.794 -59.327 1.000 56.649 0 151 ALA AAA O 1 ? 2 ATOM 1003 C CB . ALA A 1 145 ? 17.208 -21.676 -60.520 1.000 58.048 0 151 ALA AAA CB 1 ? 2 ATOM 1004 N N . ASP A 1 146 ? 14.467 -20.068 -59.892 1.000 52.625 0 152 ASP AAA N 1 ? 2 ATOM 1005 C CA . ASP A 1 146 ? 13.569 -18.932 -60.237 1.000 56.214 0 152 ASP AAA CA 1 ? 2 ATOM 1006 C C . ASP A 1 146 ? 13.212 -18.188 -58.949 1.000 52.519 0 152 ASP AAA C 1 ? 2 ATOM 1007 O O . ASP A 1 146 ? 13.528 -16.982 -58.844 1.000 51.383 0 152 ASP AAA O 1 ? 2 ATOM 1008 C CB . ASP A 1 146 ? 12.314 -19.391 -60.990 1.000 59.018 0 152 ASP AAA CB 1 ? 2 ATOM 1009 C CG . ASP A 1 146 ? 11.494 -18.244 -61.570 1.000 62.645 0 152 ASP AAA CG 1 ? 2 ATOM 1010 O OD1 . ASP A 1 146 ? 12.064 -17.144 -61.782 1.000 62.541 0 152 ASP AAA OD1 1 ? 2 ATOM 1011 O OD2 . ASP A 1 146 ? 10.287 -18.450 -61.797 1.000 65.377 0 152 ASP AAA OD2 1 ? 2 ATOM 1012 N N . ALA A 1 147 ? 12.598 -18.904 -58.009 1.000 51.886 0 153 ALA AAA N 1 ? 2 ATOM 1013 C CA . ALA A 1 147 ? 12.195 -18.400 -56.673 1.000 52.901 0 153 ALA AAA CA 1 ? 2 ATOM 1014 C C . ALA A 1 147 ? 13.341 -17.600 -56.049 1.000 52.375 0 153 ALA AAA C 1 ? 2 ATOM 1015 O O . ALA A 1 147 ? 13.058 -16.549 -55.451 1.000 51.907 0 153 ALA AAA O 1 ? 2 ATOM 1016 C CB . ALA A 1 147 ? 11.789 -19.550 -55.786 1.000 51.011 0 153 ALA AAA CB 1 ? 2 ATOM 1017 N N . LEU A 1 148 ? 14.579 -18.077 -56.205 1.000 52.287 0 154 LEU AAA N 1 ? 2 ATOM 1018 C CA . LEU A 1 148 ? 15.786 -17.450 -55.601 1.000 56.587 0 154 LEU AAA CA 1 ? 2 ATOM 1019 C C . LEU A 1 148 ? 16.172 -16.178 -56.369 1.000 60.755 0 154 LEU AAA C 1 ? 2 ATOM 1020 O O . LEU A 1 148 ? 16.537 -15.197 -55.692 1.000 62.431 0 154 LEU AAA O 1 ? 2 ATOM 1021 C CB . LEU A 1 148 ? 16.915 -18.482 -55.555 1.000 58.137 0 154 LEU AAA CB 1 ? 2 ATOM 1022 C CG . LEU A 1 148 ? 16.719 -19.573 -54.497 1.000 58.289 0 154 LEU AAA CG 1 ? 2 ATOM 1023 C CD1 . LEU A 1 148 ? 17.633 -20.764 -54.743 1.000 56.737 0 154 LEU AAA CD1 1 ? 2 ATOM 1024 C CD2 . LEU A 1 148 ? 16.920 -19.017 -53.095 1.000 56.537 0 154 LEU AAA CD2 1 ? 2 ATOM 1025 N N . THR A 1 149 ? 16.061 -16.172 -57.707 1.000 62.144 0 155 THR AAA N 1 ? 2 ATOM 1026 C CA . THR A 1 149 ? 16.293 -14.975 -58.566 1.000 63.035 0 155 THR AAA CA 1 ? 2 ATOM 1027 C C . THR A 1 149 ? 15.352 -13.857 -58.109 1.000 64.340 0 155 THR AAA C 1 ? 2 ATOM 1028 O O . THR A 1 149 ? 15.830 -12.722 -57.893 1.000 65.139 0 155 THR AAA O 1 ? 2 ATOM 1029 C CB . THR A 1 149 ? 16.091 -15.270 -60.060 1.000 63.858 0 155 THR AAA CB 1 ? 2 ATOM 1030 O OG1 . THR A 1 149 ? 16.974 -16.324 -60.445 1.000 64.103 0 155 THR AAA OG1 1 ? 2 ATOM 1031 C CG2 . THR A 1 149 ? 16.351 -14.068 -60.945 1.000 64.471 0 155 THR AAA CG2 1 ? 2 ATOM 1032 N N . TYR A 1 150 ? 14.066 -14.186 -57.965 1.000 65.137 0 156 TYR AAA N 1 ? 2 ATOM 1033 C CA . TYR A 1 150 ? 13.010 -13.302 -57.403 1.000 67.620 0 156 TYR AAA CA 1 ? 2 ATOM 1034 C C . TYR A 1 150 ? 13.454 -12.770 -56.033 1.000 68.511 0 156 TYR AAA C 1 ? 2 ATOM 1035 O O . TYR A 1 150 ? 13.393 -11.545 -55.816 1.000 71.735 0 156 TYR AAA O 1 ? 2 ATOM 1036 C CB . TYR A 1 150 ? 11.684 -14.061 -57.321 1.000 66.601 0 156 TYR AAA CB 1 ? 2 ATOM 1037 C CG . TYR A 1 150 ? 10.518 -13.257 -56.810 1.000 69.364 0 156 TYR AAA CG 1 ? 2 ATOM 1038 C CD1 . TYR A 1 150 ? 10.131 -12.084 -57.437 1.000 71.959 0 156 TYR AAA CD1 1 ? 2 ATOM 1039 C CD2 . TYR A 1 150 ? 9.791 -13.677 -55.707 1.000 72.005 0 156 TYR AAA CD2 1 ? 2 ATOM 1040 C CE1 . TYR A 1 150 ? 9.056 -11.340 -56.979 1.000 74.816 0 156 TYR AAA CE1 1 ? 2 ATOM 1041 C CE2 . TYR A 1 150 ? 8.715 -12.944 -55.233 1.000 73.925 0 156 TYR AAA CE2 1 ? 2 ATOM 1042 C CZ . TYR A 1 150 ? 8.342 -11.775 -55.877 1.000 74.741 0 156 TYR AAA CZ 1 ? 2 ATOM 1043 O OH . TYR A 1 150 ? 7.280 -11.048 -55.430 1.000 74.792 0 156 TYR AAA OH 1 ? 2 ATOM 1044 N N . CYS A 1 151 ? 13.910 -13.657 -55.145 1.000 66.920 0 157 CYS AAA N 1 ? 2 ATOM 1045 C CA . CYS A 1 151 ? 14.264 -13.324 -53.737 1.000 71.078 0 157 CYS AAA CA 1 ? 2 ATOM 1046 C C . CYS A 1 151 ? 15.454 -12.355 -53.698 1.000 77.055 0 157 CYS AAA C 1 ? 2 ATOM 1047 O O . CYS A 1 151 ? 15.426 -11.453 -52.838 1.000 82.169 0 157 CYS AAA O 1 ? 2 ATOM 1048 C CB . CYS A 1 151 ? 14.547 -14.572 -52.906 1.000 68.905 0 157 CYS AAA CB 1 ? 2 ATOM 1049 S SG . CYS A 1 151 ? 13.049 -15.391 -52.292 1.000 65.912 0 157 CYS AAA SG 1 ? 2 ATOM 1050 N N . HIS A 1 152 ? 16.434 -12.501 -54.599 1.000 77.965 0 158 HIS AAA N 1 ? 2 ATOM 1051 C CA . HIS A 1 152 ? 17.659 -11.652 -54.640 1.000 81.438 0 158 HIS AAA CA 1 ? 2 ATOM 1052 C C . HIS A 1 152 ? 17.347 -10.321 -55.336 1.000 80.131 0 158 HIS AAA C 1 ? 2 ATOM 1053 O O . HIS A 1 152 ? 17.882 -9.291 -54.888 1.000 79.752 0 158 HIS AAA O 1 ? 2 ATOM 1054 C CB . HIS A 1 152 ? 18.844 -12.399 -55.276 1.000 85.218 0 158 HIS AAA CB 1 ? 2 ATOM 1055 C CG . HIS A 1 152 ? 19.140 -13.713 -54.632 1.000 91.018 0 158 HIS AAA CG 1 ? 2 ATOM 1056 N ND1 . HIS A 1 152 ? 18.447 -14.170 -53.525 1.000 99.720 0 158 HIS AAA ND1 1 ? 2 ATOM 1057 C CD2 . HIS A 1 152 ? 20.056 -14.666 -54.918 1.000 90.578 0 158 HIS AAA CD2 1 ? 2 ATOM 1058 C CE1 . HIS A 1 152 ? 18.911 -15.352 -53.170 1.000 95.056 0 158 HIS AAA CE1 1 ? 2 ATOM 1059 N NE2 . HIS A 1 152 ? 19.900 -15.680 -54.009 1.000 91.325 0 158 HIS AAA NE2 1 ? 2 ATOM 1060 N N . ASP A 1 153 ? 16.498 -10.335 -56.370 1.000 80.905 0 159 ASP AAA N 1 ? 2 ATOM 1061 C CA . ASP A 1 153 ? 16.036 -9.106 -57.072 1.000 84.439 0 159 ASP AAA CA 1 ? 2 ATOM 1062 C C . ASP A 1 153 ? 15.355 -8.184 -56.059 1.000 82.286 0 159 ASP AAA C 1 ? 2 ATOM 1063 O O . ASP A 1 153 ? 15.706 -6.994 -56.023 1.000 80.509 0 159 ASP AAA O 1 ? 2 ATOM 1064 C CB . ASP A 1 153 ? 15.091 -9.419 -58.238 1.000 85.608 0 159 ASP AAA CB 1 ? 2 ATOM 1065 C CG . ASP A 1 153 ? 15.803 -9.682 -59.551 1.000 88.824 0 159 ASP AAA CG 1 ? 2 ATOM 1066 O OD1 . ASP A 1 153 ? 17.036 -9.868 -59.525 1.000 90.733 0 159 ASP AAA OD1 1 ? 2 ATOM 1067 O OD2 . ASP A 1 153 ? 15.121 -9.694 -60.590 1.000 90.823 0 159 ASP AAA OD2 1 ? 2 ATOM 1068 N N . LYS A 1 154 ? 14.440 -8.732 -55.254 1.000 83.538 0 160 LYS AAA N 1 ? 2 ATOM 1069 C CA . LYS A 1 154 ? 13.598 -7.962 -54.298 1.000 86.047 0 160 LYS AAA CA 1 ? 2 ATOM 1070 C C . LYS A 1 154 ? 14.365 -7.744 -52.983 1.000 86.639 0 160 LYS AAA C 1 ? 2 ATOM 1071 O O . LYS A 1 154 ? 13.810 -7.075 -52.094 1.000 87.676 0 160 LYS AAA O 1 ? 2 ATOM 1072 C CB . LYS A 1 154 ? 12.259 -8.677 -54.088 1.000 84.456 0 160 LYS AAA CB 1 ? 2 ATOM 1073 C CG . LYS A 1 154 ? 11.457 -8.955 -55.359 1.000 84.335 0 160 LYS AAA CG 1 ? 2 ATOM 1074 C CD . LYS A 1 154 ? 10.963 -7.713 -56.085 1.000 87.323 0 160 LYS AAA CD 1 ? 2 ATOM 1075 C CE . LYS A 1 154 ? 10.107 -8.027 -57.295 1.000 88.074 0 160 LYS AAA CE 1 ? 2 ATOM 1076 N NZ . LYS A 1 154 ? 10.068 -6.899 -58.256 1.000 90.949 0 160 LYS AAA NZ 1 ? 2 ATOM 1077 N N . LYS A 1 155 ? 15.593 -8.273 -52.885 1.000 87.088 0 161 LYS AAA N 1 ? 2 ATOM 1078 C CA . LYS A 1 155 ? 16.571 -8.032 -51.787 1.000 89.337 0 161 LYS AAA CA 1 ? 2 ATOM 1079 C C . LYS A 1 155 ? 15.957 -8.465 -50.451 1.000 86.721 0 161 LYS AAA C 1 ? 2 ATOM 1080 O O . LYS A 1 155 ? 15.902 -7.632 -49.529 1.000 92.913 0 161 LYS AAA O 1 ? 2 ATOM 1081 C CB . LYS A 1 155 ? 17.037 -6.567 -51.767 1.000 93.349 0 161 LYS AAA CB 1 ? 2 ATOM 1082 C CG . LYS A 1 155 ? 18.041 -6.185 -52.851 1.000 95.295 0 161 LYS AAA CG 1 ? 2 ATOM 1083 C CD . LYS A 1 155 ? 19.237 -5.386 -52.353 1.000 100.566 0 161 LYS AAA CD 1 ? 2 ATOM 1084 C CE . LYS A 1 155 ? 18.907 -3.951 -51.997 1.000 107.736 0 161 LYS AAA CE 1 ? 2 ATOM 1085 N NZ . LYS A 1 155 ? 19.077 -3.042 -53.155 1.000 111.298 0 161 LYS AAA NZ 1 ? 2 ATOM 1086 N N . VAL A 1 156 ? 15.535 -9.731 -50.358 1.000 80.352 0 162 VAL AAA N 1 ? 2 ATOM 1087 C CA . VAL A 1 156 ? 14.875 -10.323 -49.154 1.000 75.924 0 162 VAL AAA CA 1 ? 2 ATOM 1088 C C . VAL A 1 156 ? 15.574 -11.635 -48.774 1.000 71.808 0 162 VAL AAA C 1 ? 2 ATOM 1089 O O . VAL A 1 156 ? 16.082 -12.340 -49.673 1.000 68.343 0 162 VAL AAA O 1 ? 2 ATOM 1090 C CB . VAL A 1 156 ? 13.363 -10.528 -49.381 1.000 73.049 0 162 VAL AAA CB 1 ? 2 ATOM 1091 C CG1 . VAL A 1 156 ? 12.676 -9.212 -49.721 1.000 75.143 0 162 VAL AAA CG1 1 ? 2 ATOM 1092 C CG2 . VAL A 1 156 ? 13.062 -11.584 -50.441 1.000 68.520 0 162 VAL AAA CG2 1 ? 2 ATOM 1093 N N . ILE A 1 157 ? 15.605 -11.937 -47.477 1.000 72.221 0 163 ILE AAA N 1 ? 2 ATOM 1094 C CA . ILE A 1 157 ? 16.102 -13.239 -46.942 1.000 71.382 0 163 ILE AAA CA 1 ? 2 ATOM 1095 C C . ILE A 1 157 ? 15.062 -14.302 -47.296 1.000 67.510 0 163 ILE AAA C 1 ? 2 ATOM 1096 O O . ILE A 1 157 ? 13.903 -13.936 -47.507 1.000 70.075 0 163 ILE AAA O 1 ? 2 ATOM 1097 C CB . ILE A 1 157 ? 16.392 -13.171 -45.430 1.000 75.826 0 163 ILE AAA CB 1 ? 2 ATOM 1098 C CG1 . ILE A 1 157 ? 15.169 -12.738 -44.612 1.000 82.482 0 163 ILE AAA CG1 1 ? 2 ATOM 1099 C CG2 . ILE A 1 157 ? 17.598 -12.282 -45.171 1.000 77.535 0 163 ILE AAA CG2 1 ? 2 ATOM 1100 C CD1 . ILE A 1 157 ? 15.299 -12.983 -43.123 1.000 85.759 0 163 ILE AAA CD1 1 ? 2 ATOM 1101 N N . HIS A 1 158 ? 15.489 -15.557 -47.404 1.000 64.391 0 164 HIS AAA N 1 ? 2 ATOM 1102 C CA . HIS A 1 158 ? 14.638 -16.735 -47.706 1.000 63.786 0 164 HIS AAA CA 1 ? 2 ATOM 1103 C C . HIS A 1 158 ? 15.119 -17.908 -46.847 1.000 67.804 0 164 HIS AAA C 1 ? 2 ATOM 1104 O O . HIS A 1 158 ? 16.313 -17.907 -46.475 1.000 71.259 0 164 HIS AAA O 1 ? 2 ATOM 1105 C CB . HIS A 1 158 ? 14.689 -17.068 -49.206 1.000 60.373 0 164 HIS AAA CB 1 ? 2 ATOM 1106 C CG . HIS A 1 158 ? 16.047 -17.479 -49.672 1.000 57.875 0 164 HIS AAA CG 1 ? 2 ATOM 1107 N ND1 . HIS A 1 158 ? 16.541 -18.759 -49.477 1.000 53.693 0 164 HIS AAA ND1 1 ? 2 ATOM 1108 C CD2 . HIS A 1 158 ? 17.028 -16.780 -50.287 1.000 58.532 0 164 HIS AAA CD2 1 ? 2 ATOM 1109 C CE1 . HIS A 1 158 ? 17.762 -18.832 -49.964 1.000 54.118 0 164 HIS AAA CE1 1 ? 2 ATOM 1110 N NE2 . HIS A 1 158 ? 18.086 -17.630 -50.468 1.000 56.537 0 164 HIS AAA NE2 1 ? 2 ATOM 1111 N N . ARG A 1 159 ? 14.236 -18.868 -46.564 1.000 67.337 0 165 ARG AAA N 1 ? 2 ATOM 1112 C CA . ARG A 1 159 ? 14.579 -20.116 -45.837 1.000 69.855 0 165 ARG AAA CA 1 ? 2 ATOM 1113 C C . ARG A 1 159 ? 15.623 -20.893 -46.649 1.000 72.163 0 165 ARG AAA C 1 ? 2 ATOM 1114 O O . ARG A 1 159 ? 15.319 -21.247 -47.796 1.000 72.249 0 165 ARG AAA O 1 ? 2 ATOM 1115 C CB . ARG A 1 159 ? 13.310 -20.934 -45.590 1.000 70.206 0 165 ARG AAA CB 1 ? 2 ATOM 1116 C CG . ARG A 1 159 ? 13.496 -22.067 -44.590 1.000 72.395 0 165 ARG AAA CG 1 ? 2 ATOM 1117 C CD . ARG A 1 159 ? 12.347 -22.130 -43.606 1.000 72.813 0 165 ARG AAA CD 1 ? 2 ATOM 1118 N NE . ARG A 1 159 ? 12.121 -23.478 -43.106 1.000 77.963 0 165 ARG AAA NE 1 ? 2 ATOM 1119 C CZ . ARG A 1 159 ? 11.201 -23.808 -42.200 1.000 85.139 0 165 ARG AAA CZ 1 ? 2 ATOM 1120 N NH1 . ARG A 1 159 ? 11.073 -25.070 -41.821 1.000 86.145 0 165 ARG AAA NH1 1 ? 2 ATOM 1121 N NH2 . ARG A 1 159 ? 10.409 -22.886 -41.674 1.000 83.915 0 165 ARG AAA NH2 1 ? 2 ATOM 1122 N N . ASP A 1 160 ? 16.812 -21.129 -46.077 1.000 82.027 0 166 ASP AAA N 1 ? 2 ATOM 1123 C CA . ASP A 1 160 ? 17.904 -21.934 -46.693 1.000 86.528 0 166 ASP AAA CA 1 ? 2 ATOM 1124 C C . ASP A 1 160 ? 17.286 -23.179 -47.340 1.000 80.243 0 166 ASP AAA C 1 ? 2 ATOM 1125 O O . ASP A 1 160 ? 16.364 -23.775 -46.744 1.000 76.373 0 166 ASP AAA O 1 ? 2 ATOM 1126 C CB . ASP A 1 160 ? 18.992 -22.304 -45.676 1.000 95.193 0 166 ASP AAA CB 1 ? 2 ATOM 1127 C CG . ASP A 1 160 ? 20.088 -23.213 -46.223 1.000 108.825 0 166 ASP AAA CG 1 ? 2 ATOM 1128 O OD1 . ASP A 1 160 ? 20.458 -23.047 -47.407 1.000 121.257 0 166 ASP AAA OD1 1 ? 2 ATOM 1129 O OD2 . ASP A 1 160 ? 20.564 -24.087 -45.463 1.000 102.223 0 166 ASP AAA OD2 1 ? 2 ATOM 1130 N N . ILE A 1 161 ? 17.777 -23.555 -48.521 1.000 73.917 0 167 ILE AAA N 1 ? 2 ATOM 1131 C CA . ILE A 1 161 ? 17.157 -24.633 -49.339 1.000 73.849 0 167 ILE AAA CA 1 ? 2 ATOM 1132 C C . ILE A 1 161 ? 17.798 -25.971 -48.945 1.000 71.863 0 167 ILE AAA C 1 ? 2 ATOM 1133 O O . ILE A 1 161 ? 19.042 -26.032 -48.829 1.000 74.019 0 167 ILE AAA O 1 ? 2 ATOM 1134 C CB . ILE A 1 161 ? 17.229 -24.300 -50.847 1.000 72.185 0 167 ILE AAA CB 1 ? 2 ATOM 1135 C CG1 . ILE A 1 161 ? 18.630 -24.458 -51.443 1.000 72.268 0 167 ILE AAA CG1 1 ? 2 ATOM 1136 C CG2 . ILE A 1 161 ? 16.671 -22.906 -51.098 1.000 70.700 0 167 ILE AAA CG2 1 ? 2 ATOM 1137 C CD1 . ILE A 1 161 ? 18.850 -25.783 -52.133 1.000 72.602 0 167 ILE AAA CD1 1 ? 2 ATOM 1138 N N . LYS A 1 162 ? 16.950 -26.971 -48.671 1.000 68.574 0 168 LYS AAA N 1 ? 2 ATOM 1139 C CA . LYS A 1 162 ? 17.297 -28.386 -48.360 1.000 67.072 0 168 LYS AAA CA 1 ? 2 ATOM 1140 C C . LYS A 1 162 ? 15.995 -29.172 -48.239 1.000 63.000 0 168 LYS AAA C 1 ? 2 ATOM 1141 O O . LYS A 1 162 ? 14.956 -28.608 -47.906 1.000 64.305 0 168 LYS AAA O 1 ? 2 ATOM 1142 C CB . LYS A 1 162 ? 18.155 -28.522 -47.093 1.000 71.679 0 168 LYS AAA CB 1 ? 2 ATOM 1143 C CG . LYS A 1 162 ? 17.654 -27.815 -45.839 1.000 75.280 0 168 LYS AAA CG 1 ? 2 ATOM 1144 C CD . LYS A 1 162 ? 18.358 -28.272 -44.571 1.000 73.611 0 168 LYS AAA CD 1 ? 2 ATOM 1145 C CE . LYS A 1 162 ? 19.755 -27.709 -44.418 1.000 74.332 0 168 LYS AAA CE 1 ? 2 ATOM 1146 N NZ . LYS A 1 162 ? 19.802 -26.606 -43.427 1.000 75.420 0 168 LYS AAA NZ 1 ? 2 ATOM 1147 N N . PRO A 1 163 ? 15.997 -30.493 -48.509 1.000 62.985 0 169 PRO AAA N 1 ? 2 ATOM 1148 C CA . PRO A 1 163 ? 14.747 -31.242 -48.652 1.000 64.368 0 169 PRO AAA CA 1 ? 2 ATOM 1149 C C . PRO A 1 163 ? 13.761 -31.047 -47.485 1.000 63.564 0 169 PRO AAA C 1 ? 2 ATOM 1150 O O . PRO A 1 163 ? 12.566 -31.000 -47.730 1.000 58.522 0 169 PRO AAA O 1 ? 2 ATOM 1151 C CB . PRO A 1 163 ? 15.220 -32.702 -48.730 1.000 65.739 0 169 PRO AAA CB 1 ? 2 ATOM 1152 C CG . PRO A 1 163 ? 16.636 -32.620 -49.253 1.000 66.412 0 169 PRO AAA CG 1 ? 2 ATOM 1153 C CD . PRO A 1 163 ? 17.189 -31.338 -48.673 1.000 63.430 0 169 PRO AAA CD 1 ? 2 ATOM 1154 N N . GLU A 1 164 ? 14.272 -30.924 -46.254 1.000 64.896 0 170 GLU AAA N 1 ? 2 ATOM 1155 C CA . GLU A 1 164 ? 13.455 -30.729 -45.018 1.000 67.346 0 170 GLU AAA CA 1 ? 2 ATOM 1156 C C . GLU A 1 164 ? 12.655 -29.421 -45.104 1.000 64.834 0 170 GLU AAA C 1 ? 2 ATOM 1157 O O . GLU A 1 164 ? 11.502 -29.403 -44.620 1.000 64.944 0 170 GLU AAA O 1 ? 2 ATOM 1158 C CB . GLU A 1 164 ? 14.329 -30.667 -43.764 1.000 67.371 0 170 GLU AAA CB 1 ? 2 ATOM 1159 C CG . GLU A 1 164 ? 15.217 -31.879 -43.566 1.000 69.677 0 170 GLU AAA CG 1 ? 2 ATOM 1160 C CD . GLU A 1 164 ? 16.630 -31.708 -44.094 1.000 70.355 0 170 GLU AAA CD 1 ? 2 ATOM 1161 O OE1 . GLU A 1 164 ? 16.771 -31.321 -45.267 1.000 71.346 0 170 GLU AAA OE1 1 ? 2 ATOM 1162 O OE2 . GLU A 1 164 ? 17.583 -31.949 -43.329 1.000 71.982 0 170 GLU AAA OE2 1 ? 2 ATOM 1163 N N . ASN A 1 165 ? 13.259 -28.385 -45.701 1.000 59.860 0 171 ASN AAA N 1 ? 2 ATOM 1164 C CA . ASN A 1 165 ? 12.771 -26.979 -45.719 1.000 58.625 0 171 ASN AAA CA 1 ? 2 ATOM 1165 C C . ASN A 1 165 ? 11.897 -26.713 -46.949 1.000 55.998 0 171 ASN AAA C 1 ? 2 ATOM 1166 O O . ASN A 1 165 ? 11.456 -25.549 -47.110 1.000 53.015 0 171 ASN AAA O 1 ? 2 ATOM 1167 C CB . ASN A 1 165 ? 13.943 -25.993 -45.722 1.000 62.081 0 171 ASN AAA CB 1 ? 2 ATOM 1168 C CG . ASN A 1 165 ? 14.622 -25.850 -44.374 1.000 63.086 0 171 ASN AAA CG 1 ? 2 ATOM 1169 O OD1 . ASN A 1 165 ? 13.961 -25.848 -43.335 1.000 57.625 0 171 ASN AAA OD1 1 ? 2 ATOM 1170 N ND2 . ASN A 1 165 ? 15.937 -25.688 -44.388 1.000 62.433 0 171 ASN AAA ND2 1 ? 2 ATOM 1171 N N . LEU A 1 166 ? 11.675 -27.736 -47.784 1.000 53.359 0 172 LEU AAA N 1 ? 2 ATOM 1172 C CA . LEU A 1 166 ? 10.912 -27.646 -49.057 1.000 48.531 0 172 LEU AAA CA 1 ? 2 ATOM 1173 C C . LEU A 1 166 ? 9.645 -28.506 -48.953 1.000 48.111 0 172 LEU AAA C 1 ? 2 ATOM 1174 O O . LEU A 1 166 ? 9.754 -29.667 -48.480 1.000 48.101 0 172 LEU AAA O 1 ? 2 ATOM 1175 C CB . LEU A 1 166 ? 11.818 -28.118 -50.195 1.000 46.707 0 172 LEU AAA CB 1 ? 2 ATOM 1176 C CG . LEU A 1 166 ? 13.065 -27.271 -50.434 1.000 47.860 0 172 LEU AAA CG 1 ? 2 ATOM 1177 C CD1 . LEU A 1 166 ? 13.937 -27.892 -51.518 1.000 48.242 0 172 LEU AAA CD1 1 ? 2 ATOM 1178 C CD2 . LEU A 1 166 ? 12.692 -25.838 -50.796 1.000 48.056 0 172 LEU AAA CD2 1 ? 2 ATOM 1179 N N . LEU A 1 167 ? 8.493 -27.941 -49.349 1.000 46.705 0 173 LEU AAA N 1 ? 2 ATOM 1180 C CA . LEU A 1 167 ? 7.175 -28.633 -49.418 1.000 47.142 0 173 LEU AAA CA 1 ? 2 ATOM 1181 C C . LEU A 1 167 ? 6.785 -28.794 -50.896 1.000 49.691 0 173 LEU AAA C 1 ? 2 ATOM 1182 O O . LEU A 1 167 ? 7.478 -28.199 -51.753 1.000 51.403 0 173 LEU AAA O 1 ? 2 ATOM 1183 C CB . LEU A 1 167 ? 6.135 -27.823 -48.632 1.000 46.372 0 173 LEU AAA CB 1 ? 2 ATOM 1184 C CG . LEU A 1 167 ? 6.301 -27.803 -47.104 1.000 46.729 0 173 LEU AAA CG 1 ? 2 ATOM 1185 C CD1 . LEU A 1 167 ? 5.627 -26.594 -46.487 1.000 46.496 0 173 LEU AAA CD1 1 ? 2 ATOM 1186 C CD2 . LEU A 1 167 ? 5.744 -29.058 -46.452 1.000 47.192 0 173 LEU AAA CD2 1 ? 2 ATOM 1187 N N . LEU A 1 168 ? 5.731 -29.570 -51.179 1.000 48.408 0 174 LEU AAA N 1 ? 2 ATOM 1188 C CA . LEU A 1 168 ? 5.318 -29.976 -52.550 1.000 47.118 0 174 LEU AAA CA 1 ? 2 ATOM 1189 C C . LEU A 1 168 ? 3.845 -29.626 -52.794 1.000 48.410 0 174 LEU AAA C 1 ? 2 ATOM 1190 O O . LEU A 1 168 ? 3.001 -30.048 -51.986 1.000 46.922 0 174 LEU AAA O 1 ? 2 ATOM 1191 C CB . LEU A 1 168 ? 5.523 -31.487 -52.686 1.000 47.929 0 174 LEU AAA CB 1 ? 2 ATOM 1192 C CG . LEU A 1 168 ? 6.970 -31.974 -52.725 1.000 46.781 0 174 LEU AAA CG 1 ? 2 ATOM 1193 C CD1 . LEU A 1 168 ? 7.023 -33.495 -52.625 1.000 46.469 0 174 LEU AAA CD1 1 ? 2 ATOM 1194 C CD2 . LEU A 1 168 ? 7.675 -31.495 -53.986 1.000 44.750 0 174 LEU AAA CD2 1 ? 2 ATOM 1195 N N . GLY A 1 169 ? 3.548 -28.966 -53.918 1.000 49.236 0 175 GLY AAA N 1 ? 2 ATOM 1196 C CA . GLY A 1 169 ? 2.173 -28.669 -54.375 1.000 50.598 0 175 GLY AAA CA 1 ? 2 ATOM 1197 C C . GLY A 1 169 ? 1.446 -29.896 -54.917 1.000 49.500 0 175 GLY AAA C 1 ? 2 ATOM 1198 O O . GLY A 1 169 ? 2.019 -31.009 -54.866 1.000 47.048 0 175 GLY AAA O 1 ? 2 ATOM 1199 N N . PHE A 1 170 ? 0.226 -29.701 -55.434 1.000 51.459 0 176 PHE AAA N 1 ? 2 ATOM 1200 C CA . PHE A 1 170 ? -0.668 -30.783 -55.934 1.000 55.229 0 176 PHE AAA CA 1 ? 2 ATOM 1201 C C . PHE A 1 170 ? -0.028 -31.530 -57.111 1.000 54.706 0 176 PHE AAA C 1 ? 2 ATOM 1202 O O . PHE A 1 170 ? -0.295 -32.743 -57.238 1.000 56.659 0 176 PHE AAA O 1 ? 2 ATOM 1203 C CB . PHE A 1 170 ? -2.038 -30.249 -56.364 1.000 56.024 0 176 PHE AAA CB 1 ? 2 ATOM 1204 C CG . PHE A 1 170 ? -2.920 -31.291 -57.005 1.000 55.883 0 176 PHE AAA CG 1 ? 2 ATOM 1205 C CD1 . PHE A 1 170 ? -3.429 -32.342 -56.261 1.000 56.460 0 176 PHE AAA CD1 1 ? 2 ATOM 1206 C CD2 . PHE A 1 170 ? -3.205 -31.248 -58.362 1.000 59.211 0 176 PHE AAA CD2 1 ? 2 ATOM 1207 C CE1 . PHE A 1 170 ? -4.237 -33.306 -56.847 1.000 58.892 0 176 PHE AAA CE1 1 ? 2 ATOM 1208 C CE2 . PHE A 1 170 ? -4.011 -32.214 -58.948 1.000 59.592 0 176 PHE AAA CE2 1 ? 2 ATOM 1209 C CZ . PHE A 1 170 ? -4.531 -33.237 -58.188 1.000 59.499 0 176 PHE AAA CZ 1 ? 2 ATOM 1210 N N . ARG A 1 171 ? 0.760 -30.844 -57.947 1.000 54.068 0 177 ARG AAA N 1 ? 2 ATOM 1211 C CA . ARG A 1 171 ? 1.533 -31.481 -59.051 1.000 58.657 0 177 ARG AAA CA 1 ? 2 ATOM 1212 C C . ARG A 1 171 ? 3.035 -31.437 -58.744 1.000 56.557 0 177 ARG AAA C 1 ? 2 ATOM 1213 O O . ARG A 1 171 ? 3.827 -31.306 -59.695 1.000 58.122 0 177 ARG AAA O 1 ? 2 ATOM 1214 C CB . ARG A 1 171 ? 1.230 -30.805 -60.389 1.000 62.289 0 177 ARG AAA CB 1 ? 2 ATOM 1215 C CG . ARG A 1 171 ? -0.193 -31.023 -60.874 1.000 67.134 0 177 ARG AAA CG 1 ? 2 ATOM 1216 C CD . ARG A 1 171 ? -0.620 -29.879 -61.760 1.000 74.028 0 177 ARG AAA CD 1 ? 2 ATOM 1217 N NE . ARG A 1 171 ? -0.732 -30.254 -63.158 1.000 88.474 0 177 ARG AAA NE 1 ? 2 ATOM 1218 C CZ . ARG A 1 171 ? -0.680 -29.406 -64.181 1.000 93.978 0 177 ARG AAA CZ 1 ? 2 ATOM 1219 N NH1 . ARG A 1 171 ? -0.481 -28.110 -63.991 1.000 91.537 0 177 ARG AAA NH1 1 ? 2 ATOM 1220 N NH2 . ARG A 1 171 ? -0.828 -29.868 -65.408 1.000 100.204 0 177 ARG AAA NH2 1 ? 2 ATOM 1221 N N . GLY A 1 172 ? 3.412 -31.571 -57.473 1.000 52.992 0 178 GLY AAA N 1 ? 2 ATOM 1222 C CA . GLY A 1 172 ? 4.814 -31.753 -57.058 1.000 51.253 0 178 GLY AAA CA 1 ? 2 ATOM 1223 C C . GLY A 1 172 ? 5.669 -30.524 -57.332 1.000 48.313 0 178 GLY AAA C 1 ? 2 ATOM 1224 O O . GLY A 1 172 ? 6.913 -30.700 -57.506 1.000 51.566 0 178 GLY AAA O 1 ? 2 ATOM 1225 N N . GLU A 1 173 ? 5.039 -29.334 -57.355 1.000 45.994 0 179 GLU AAA N 1 ? 2 ATOM 1226 C CA . GLU A 1 173 ? 5.741 -28.022 -57.415 1.000 47.783 0 179 GLU AAA CA 1 ? 2 ATOM 1227 C C . GLU A 1 173 ? 6.454 -27.773 -56.079 1.000 51.004 0 179 GLU AAA C 1 ? 2 ATOM 1228 O O . GLU A 1 173 ? 5.780 -27.835 -55.019 1.000 51.707 0 179 GLU AAA O 1 ? 2 ATOM 1229 C CB . GLU A 1 173 ? 4.773 -26.860 -57.650 1.000 48.000 0 179 GLU AAA CB 1 ? 2 ATOM 1230 C CG . GLU A 1 173 ? 3.972 -26.956 -58.928 1.000 50.659 0 179 GLU AAA CG 1 ? 2 ATOM 1231 C CD . GLU A 1 173 ? 2.555 -27.467 -58.777 1.000 52.135 0 179 GLU AAA CD 1 ? 2 ATOM 1232 O OE1 . GLU A 1 173 ? 2.258 -28.097 -57.741 1.000 51.536 0 179 GLU AAA OE1 1 ? 2 ATOM 1233 O OE2 . GLU A 1 173 ? 1.758 -27.226 -59.706 1.000 54.648 0 179 GLU AAA OE2 1 ? 2 ATOM 1234 N N . VAL A 1 174 ? 7.755 -27.479 -56.114 1.000 49.746 0 180 VAL AAA N 1 ? 2 ATOM 1235 C CA . VAL A 1 174 ? 8.544 -27.215 -54.878 1.000 48.205 0 180 VAL AAA CA 1 ? 2 ATOM 1236 C C . VAL A 1 174 ? 8.023 -25.917 -54.262 1.000 49.185 0 180 VAL AAA C 1 ? 2 ATOM 1237 O O . VAL A 1 174 ? 7.705 -24.985 -55.024 1.000 48.814 0 180 VAL AAA O 1 ? 2 ATOM 1238 C CB . VAL A 1 174 ? 10.055 -27.139 -55.148 1.000 46.867 0 180 VAL AAA CB 1 ? 2 ATOM 1239 C CG1 . VAL A 1 174 ? 10.445 -25.843 -55.848 1.000 46.497 0 180 VAL AAA CG1 1 ? 2 ATOM 1240 C CG2 . VAL A 1 174 ? 10.838 -27.328 -53.864 1.000 44.582 0 180 VAL AAA CG2 1 ? 2 ATOM 1241 N N . LYS A 1 175 ? 7.919 -25.890 -52.934 1.000 48.987 0 181 LYS AAA N 1 ? 2 ATOM 1242 C CA . LYS A 1 175 ? 7.510 -24.706 -52.143 1.000 50.160 0 181 LYS AAA CA 1 ? 2 ATOM 1243 C C . LYS A 1 175 ? 8.550 -24.506 -51.034 1.000 52.119 0 181 LYS AAA C 1 ? 2 ATOM 1244 O O . LYS A 1 175 ? 8.671 -25.396 -50.162 1.000 54.305 0 181 LYS AAA O 1 ? 2 ATOM 1245 C CB . LYS A 1 175 ? 6.115 -24.912 -51.545 1.000 53.001 0 181 LYS AAA CB 1 ? 2 ATOM 1246 C CG . LYS A 1 175 ? 5.035 -25.421 -52.491 1.000 53.806 0 181 LYS AAA CG 1 ? 2 ATOM 1247 C CD . LYS A 1 175 ? 4.243 -24.315 -53.168 1.000 54.211 0 181 LYS AAA CD 1 ? 2 ATOM 1248 C CE . LYS A 1 175 ? 3.591 -24.769 -54.455 1.000 50.213 0 181 LYS AAA CE 1 ? 2 ATOM 1249 N NZ . LYS A 1 175 ? 2.761 -23.692 -55.030 1.000 50.084 0 181 LYS AAA NZ 1 ? 2 ATOM 1250 N N . ILE A 1 176 ? 9.307 -23.411 -51.096 1.000 51.102 0 182 ILE AAA N 1 ? 2 ATOM 1251 C CA . ILE A 1 176 ? 10.172 -22.934 -49.979 1.000 52.624 0 182 ILE AAA CA 1 ? 2 ATOM 1252 C C . ILE A 1 176 ? 9.219 -22.552 -48.839 1.000 55.040 0 182 ILE AAA C 1 ? 2 ATOM 1253 O O . ILE A 1 176 ? 8.282 -21.773 -49.105 1.000 60.622 0 182 ILE AAA O 1 ? 2 ATOM 1254 C CB . ILE A 1 176 ? 11.071 -21.768 -50.443 1.000 53.886 0 182 ILE AAA CB 1 ? 2 ATOM 1255 C CG1 . ILE A 1 176 ? 12.031 -22.197 -51.556 1.000 51.948 0 182 ILE AAA CG1 1 ? 2 ATOM 1256 C CG2 . ILE A 1 176 ? 11.821 -21.158 -49.268 1.000 57.779 0 182 ILE AAA CG2 1 ? 2 ATOM 1257 C CD1 . ILE A 1 176 ? 12.672 -21.045 -52.287 1.000 51.514 0 182 ILE AAA CD1 1 ? 2 ATOM 1258 N N . ALA A 1 177 ? 9.409 -23.108 -47.641 1.000 51.721 0 183 ALA AAA N 1 ? 2 ATOM 1259 C CA . ALA A 1 177 ? 8.369 -23.150 -46.584 1.000 53.821 0 183 ALA AAA CA 1 ? 2 ATOM 1260 C C . ALA A 1 177 ? 7.972 -21.730 -46.152 1.000 55.723 0 183 ALA AAA C 1 ? 2 ATOM 1261 O O . ALA A 1 177 ? 6.805 -21.558 -45.739 1.000 56.852 0 183 ALA AAA O 1 ? 2 ATOM 1262 C CB . ALA A 1 177 ? 8.835 -23.991 -45.415 1.000 55.130 0 183 ALA AAA CB 1 ? 2 ATOM 1263 N N . ASP A 1 178 ? 8.890 -20.759 -46.256 1.000 56.619 0 184 ASP AAA N 1 ? 2 ATOM 1264 C CA . ASP A 1 178 ? 8.668 -19.332 -45.879 1.000 58.721 0 184 ASP AAA CA 1 ? 2 ATOM 1265 C C . ASP A 1 178 ? 9.961 -18.540 -46.122 1.000 59.009 0 184 ASP AAA C 1 ? 2 ATOM 1266 O O . ASP A 1 178 ? 10.927 -19.135 -46.641 1.000 58.920 0 184 ASP AAA O 1 ? 2 ATOM 1267 C CB . ASP A 1 178 ? 8.212 -19.215 -44.423 1.000 62.443 0 184 ASP AAA CB 1 ? 2 ATOM 1268 C CG . ASP A 1 178 ? 9.122 -19.935 -43.442 1.000 65.164 0 184 ASP AAA CG 1 ? 2 ATOM 1269 O OD1 . ASP A 1 178 ? 10.354 -19.720 -43.512 1.000 66.251 0 184 ASP AAA OD1 1 ? 2 ATOM 1270 O OD2 . ASP A 1 178 ? 8.592 -20.714 -42.623 1.000 65.846 0 184 ASP AAA OD2 1 ? 2 ATOM 1271 N N . PHE A 1 179 ? 9.989 -17.261 -45.734 1.000 59.949 0 185 PHE AAA N 1 ? 2 ATOM 1272 C CA . PHE A 1 179 ? 11.165 -16.359 -45.867 1.000 62.870 0 185 PHE AAA CA 1 ? 2 ATOM 1273 C C . PHE A 1 179 ? 12.072 -16.460 -44.624 1.000 68.219 0 185 PHE AAA C 1 ? 2 ATOM 1274 O O . PHE A 1 179 ? 12.798 -15.481 -44.308 1.000 69.515 0 185 PHE AAA O 1 ? 2 ATOM 1275 C CB . PHE A 1 179 ? 10.686 -14.934 -46.150 1.000 64.430 0 185 PHE AAA CB 1 ? 2 ATOM 1276 C CG . PHE A 1 179 ? 9.983 -14.773 -47.473 1.000 66.225 0 185 PHE AAA CG 1 ? 2 ATOM 1277 C CD1 . PHE A 1 179 ? 10.706 -14.545 -48.636 1.000 65.639 0 185 PHE AAA CD1 1 ? 2 ATOM 1278 C CD2 . PHE A 1 179 ? 8.601 -14.849 -47.559 1.000 67.847 0 185 PHE AAA CD2 1 ? 2 ATOM 1279 C CE1 . PHE A 1 179 ? 10.061 -14.386 -49.854 1.000 64.139 0 185 PHE AAA CE1 1 ? 2 ATOM 1280 C CE2 . PHE A 1 179 ? 7.958 -14.699 -48.781 1.000 66.250 0 185 PHE AAA CE2 1 ? 2 ATOM 1281 C CZ . PHE A 1 179 ? 8.689 -14.466 -49.924 1.000 64.217 0 185 PHE AAA CZ 1 ? 2 ATOM 1282 N N . GLY A 1 180 ? 12.027 -17.604 -43.928 1.000 68.152 0 186 GLY AAA N 1 ? 2 ATOM 1283 C CA . GLY A 1 180 ? 13.039 -18.041 -42.946 1.000 73.584 0 186 GLY AAA CA 1 ? 2 ATOM 1284 C C . GLY A 1 180 ? 13.217 -17.071 -41.787 1.000 79.581 0 186 GLY AAA C 1 ? 2 ATOM 1285 O O . GLY A 1 180 ? 14.348 -16.581 -41.603 1.000 84.524 0 186 GLY AAA O 1 ? 2 ATOM 1286 N N . TRP A 1 181 ? 12.153 -16.830 -41.012 1.000 80.389 0 187 TRP AAA N 1 ? 2 ATOM 1287 C CA . TRP A 1 181 ? 12.171 -15.985 -39.785 1.000 78.719 0 187 TRP AAA CA 1 ? 2 ATOM 1288 C C . TRP A 1 181 ? 12.596 -16.828 -38.573 1.000 77.014 0 187 TRP AAA C 1 ? 2 ATOM 1289 O O . TRP A 1 181 ? 13.280 -16.273 -37.700 1.000 76.151 0 187 TRP AAA O 1 ? 2 ATOM 1290 C CB . TRP A 1 181 ? 10.816 -15.295 -39.567 1.000 77.538 0 187 TRP AAA CB 1 ? 2 ATOM 1291 C CG . TRP A 1 181 ? 9.678 -16.226 -39.279 1.000 74.686 0 187 TRP AAA CG 1 ? 2 ATOM 1292 C CD1 . TRP A 1 181 ? 8.933 -16.921 -40.186 1.000 70.717 0 187 TRP AAA CD1 1 ? 2 ATOM 1293 C CD2 . TRP A 1 181 ? 9.141 -16.558 -37.985 1.000 75.065 0 187 TRP AAA CD2 1 ? 2 ATOM 1294 N NE1 . TRP A 1 181 ? 7.974 -17.661 -39.549 1.000 70.981 0 187 TRP AAA NE1 1 ? 2 ATOM 1295 C CE2 . TRP A 1 181 ? 8.076 -17.458 -38.199 1.000 72.866 0 187 TRP AAA CE2 1 ? 2 ATOM 1296 C CE3 . TRP A 1 181 ? 9.451 -16.183 -36.672 1.000 76.702 0 187 TRP AAA CE3 1 ? 2 ATOM 1297 C CZ2 . TRP A 1 181 ? 7.332 -17.992 -37.149 1.000 74.744 0 187 TRP AAA CZ2 1 ? 2 ATOM 1298 C CZ3 . TRP A 1 181 ? 8.712 -16.708 -35.635 1.000 77.562 0 187 TRP AAA CZ3 1 ? 2 ATOM 1299 C CH2 . TRP A 1 181 ? 7.669 -17.603 -35.871 1.000 77.169 0 187 TRP AAA CH2 1 ? 2 ATOM 1300 N N . SER A 1 182 ? 12.221 -18.115 -38.543 1.000 78.505 0 188 SER AAA N 1 ? 2 ATOM 1301 C CA . SER A 1 182 ? 12.549 -19.102 -37.477 1.000 79.385 0 188 SER AAA CA 1 ? 2 ATOM 1302 C C . SER A 1 182 ? 13.881 -19.805 -37.769 1.000 80.766 0 188 SER AAA C 1 ? 2 ATOM 1303 O O . SER A 1 182 ? 14.221 -20.733 -37.014 1.000 78.781 0 188 SER AAA O 1 ? 2 ATOM 1304 C CB . SER A 1 182 ? 11.450 -20.122 -37.326 1.000 79.505 0 188 SER AAA CB 1 ? 2 ATOM 1305 O OG . SER A 1 182 ? 10.176 -19.500 -37.332 1.000 84.760 0 188 SER AAA OG 1 ? 2 ATOM 1306 N N . VAL A 1 183 ? 14.583 -19.414 -38.839 1.000 86.769 0 189 VAL AAA N 1 ? 2 ATOM 1307 C CA . VAL A 1 183 ? 15.948 -19.914 -39.183 1.000 89.304 0 189 VAL AAA CA 1 ? 2 ATOM 1308 C C . VAL A 1 183 ? 16.926 -19.404 -38.119 1.000 94.196 0 189 VAL AAA C 1 ? 2 ATOM 1309 O O . VAL A 1 183 ? 17.002 -18.174 -37.930 1.000 91.953 0 189 VAL AAA O 1 ? 2 ATOM 1310 C CB . VAL A 1 183 ? 16.364 -19.475 -40.602 1.000 92.620 0 189 VAL AAA CB 1 ? 2 ATOM 1311 C CG1 . VAL A 1 183 ? 17.872 -19.303 -40.753 1.000 91.340 0 189 VAL AAA CG1 1 ? 2 ATOM 1312 C CG2 . VAL A 1 183 ? 15.821 -20.432 -41.657 1.000 96.246 0 189 VAL AAA CG2 1 ? 2 ATOM 1313 N N . HIS A 1 184 ? 17.644 -20.321 -37.463 1.000 100.321 0 190 HIS AAA N 1 ? 2 ATOM 1314 C CA . HIS A 1 184 ? 18.661 -20.030 -36.416 1.000 105.332 0 190 HIS AAA CA 1 ? 2 ATOM 1315 C C . HIS A 1 184 ? 20.050 -19.962 -37.068 1.000 108.007 0 190 HIS AAA C 1 ? 2 ATOM 1316 O O . HIS A 1 184 ? 20.322 -20.790 -37.962 1.000 116.271 0 190 HIS AAA O 1 ? 2 ATOM 1317 C CB . HIS A 1 184 ? 18.564 -21.071 -35.292 1.000 106.667 0 190 HIS AAA CB 1 ? 2 ATOM 1318 C CG . HIS A 1 184 ? 19.296 -20.699 -34.044 1.000 114.823 0 190 HIS AAA CG 1 ? 2 ATOM 1319 N ND1 . HIS A 1 184 ? 18.904 -19.646 -33.237 1.000 114.474 0 190 HIS AAA ND1 1 ? 2 ATOM 1320 C CD2 . HIS A 1 184 ? 20.381 -21.245 -33.453 1.000 111.704 0 190 HIS AAA CD2 1 ? 2 ATOM 1321 C CE1 . HIS A 1 184 ? 19.725 -19.555 -32.209 1.000 111.965 0 190 HIS AAA CE1 1 ? 2 ATOM 1322 N NE2 . HIS A 1 184 ? 20.638 -20.526 -32.316 1.000 108.971 0 190 HIS AAA NE2 1 ? 2 ATOM 1323 N N . THR A 1 185 ? 20.865 -18.976 -36.675 1.000 105.599 0 191 THR AAA N 1 ? 2 ATOM 1324 C CA . THR A 1 185 ? 22.266 -18.777 -37.139 1.000 105.214 0 191 THR AAA CA 1 ? 2 ATOM 1325 C C . THR A 1 185 ? 22.984 -20.128 -37.137 1.000 102.086 0 191 THR AAA C 1 ? 2 ATOM 1326 O O . THR A 1 185 ? 23.376 -20.615 -36.083 1.000 100.440 0 191 THR AAA O 1 ? 2 ATOM 1327 C CB . THR A 1 185 ? 22.993 -17.723 -36.289 1.000 113.749 0 191 THR AAA CB 1 ? 2 ATOM 1328 O OG1 . THR A 1 185 ? 22.518 -17.762 -34.942 1.000 123.512 0 191 THR AAA OG1 1 ? 2 ATOM 1329 C CG2 . THR A 1 185 ? 22.822 -16.316 -36.822 1.000 112.498 0 191 THR AAA CG2 1 ? 2 ATOM 1330 N N . PRO A 1 186 ? 23.184 -20.774 -38.311 1.000 107.442 0 192 PRO AAA N 1 ? 2 ATOM 1331 C CA . PRO A 1 186 ? 23.603 -22.179 -38.360 1.000 102.115 0 192 PRO AAA CA 1 ? 2 ATOM 1332 C C . PRO A 1 186 ? 24.938 -22.447 -37.649 1.000 95.987 0 192 PRO AAA C 1 ? 2 ATOM 1333 O O . PRO A 1 186 ? 25.904 -21.787 -37.969 1.000 100.116 0 192 PRO AAA O 1 ? 2 ATOM 1334 C CB . PRO A 1 186 ? 23.719 -22.481 -39.864 1.000 102.898 0 192 PRO AAA CB 1 ? 2 ATOM 1335 C CG . PRO A 1 186 ? 23.872 -21.117 -40.514 1.000 105.588 0 192 PRO AAA CG 1 ? 2 ATOM 1336 C CD . PRO A 1 186 ? 23.046 -20.185 -39.653 1.000 105.872 0 192 PRO AAA CD 1 ? 2 ATOM 1337 N N . SER A 1 187 ? 24.944 -23.393 -36.704 1.000 85.539 0 193 SER AAA N 1 ? 2 ATOM 1338 C CA . SER A 1 187 ? 26.140 -23.860 -35.955 1.000 79.953 0 193 SER AAA CA 1 ? 2 ATOM 1339 C C . SER A 1 187 ? 26.831 -24.979 -36.746 1.000 79.696 0 193 SER AAA C 1 ? 2 ATOM 1340 O O . SER A 1 187 ? 26.125 -25.774 -37.389 1.000 84.957 0 193 SER AAA O 1 ? 2 ATOM 1341 C CB . SER A 1 187 ? 25.763 -24.303 -34.563 1.000 78.366 0 193 SER AAA CB 1 ? 2 ATOM 1342 O OG . SER A 1 187 ? 26.875 -24.865 -33.875 1.000 78.442 0 193 SER AAA OG 1 ? 2 ATOM 1343 N N . LEU A 1 188 ? 28.166 -25.027 -36.708 1.000 77.604 0 194 LEU AAA N 1 ? 2 ATOM 1344 C CA . LEU A 1 188 ? 28.987 -26.140 -37.254 1.000 74.884 0 194 LEU AAA CA 1 ? 2 ATOM 1345 C C . LEU A 1 188 ? 28.615 -27.435 -36.513 1.000 75.644 0 194 LEU AAA C 1 ? 2 ATOM 1346 O O . LEU A 1 188 ? 28.316 -28.434 -37.188 1.000 73.974 0 194 LEU AAA O 1 ? 2 ATOM 1347 C CB . LEU A 1 188 ? 30.464 -25.760 -37.078 1.000 75.907 0 194 LEU AAA CB 1 ? 2 ATOM 1348 C CG . LEU A 1 188 ? 31.517 -26.636 -37.760 1.000 76.828 0 194 LEU AAA CG 1 ? 2 ATOM 1349 C CD1 . LEU A 1 188 ? 31.192 -26.876 -39.222 1.000 76.597 0 194 LEU AAA CD1 1 ? 2 ATOM 1350 C CD2 . LEU A 1 188 ? 32.898 -26.011 -37.625 1.000 80.150 0 194 LEU AAA CD2 1 ? 2 ATOM 1351 N N . ALA A 1 189 ? 28.591 -27.404 -35.176 1.000 80.007 0 195 ALA AAA N 1 ? 2 ATOM 1352 C CA . ALA A 1 189 ? 28.295 -28.565 -34.299 1.000 85.474 0 195 ALA AAA CA 1 ? 2 ATOM 1353 C C . ALA A 1 189 ? 26.883 -29.112 -34.569 1.000 84.995 0 195 ALA AAA C 1 ? 2 ATOM 1354 O O . ALA A 1 189 ? 26.724 -30.348 -34.605 1.000 83.959 0 195 ALA AAA O 1 ? 2 ATOM 1355 C CB . ALA A 1 189 ? 28.459 -28.170 -32.851 1.000 87.194 0 195 ALA AAA CB 1 ? 2 ATOM 1356 N N . ALA A 1 190 ? 25.894 -28.228 -34.731 1.000 84.741 0 196 ALA AAA N 1 ? 2 ATOM 1357 C CA . ALA A 1 190 ? 24.469 -28.581 -34.938 1.000 82.744 0 196 ALA AAA CA 1 ? 2 ATOM 1358 C C . ALA A 1 190 ? 24.314 -29.339 -36.258 1.000 80.166 0 196 ALA AAA C 1 ? 2 ATOM 1359 O O . ALA A 1 190 ? 23.663 -30.410 -36.253 1.000 78.599 0 196 ALA AAA O 1 ? 2 ATOM 1360 C CB . ALA A 1 190 ? 23.616 -27.338 -34.930 1.000 81.715 0 196 ALA AAA CB 1 ? 2 ATOM 1361 N N . ALA A 1 191 ? 24.887 -28.779 -37.330 1.000 79.013 0 197 ALA AAA N 1 ? 2 ATOM 1362 C CA . ALA A 1 191 ? 24.849 -29.307 -38.714 1.000 75.410 0 197 ALA AAA CA 1 ? 2 ATOM 1363 C C . ALA A 1 191 ? 25.502 -30.692 -38.760 1.000 75.255 0 197 ALA AAA C 1 ? 2 ATOM 1364 O O . ALA A 1 191 ? 24.966 -31.571 -39.469 1.000 72.688 0 197 ALA AAA O 1 ? 2 ATOM 1365 C CB . ALA A 1 191 ? 25.537 -28.346 -39.652 1.000 75.585 0 197 ALA AAA CB 1 ? 2 ATOM 1366 N N . THR A 1 192 ? 26.617 -30.865 -38.039 1.000 78.111 0 198 THR AAA N 1 ? 2 ATOM 1367 C CA . THR A 1 192 ? 27.343 -32.155 -37.893 1.000 83.489 0 198 THR AAA CA 1 ? 2 ATOM 1368 C C . THR A 1 192 ? 26.361 -33.210 -37.362 1.000 87.076 0 198 THR AAA C 1 ? 2 ATOM 1369 O O . THR A 1 192 ? 26.216 -34.260 -38.019 1.000 94.578 0 198 THR AAA O 1 ? 2 ATOM 1370 C CB . THR A 1 192 ? 28.595 -31.995 -37.016 1.000 85.114 0 198 THR AAA CB 1 ? 2 ATOM 1371 O OG1 . THR A 1 192 ? 29.504 -31.139 -37.706 1.000 84.070 0 198 THR AAA OG1 1 ? 2 ATOM 1372 C CG2 . THR A 1 192 ? 29.294 -33.303 -36.716 1.000 86.106 0 198 THR AAA CG2 1 ? 2 ATOM 1373 N N . MET A 1 193 ? 25.687 -32.920 -36.246 1.000 84.285 0 199 MET AAA N 1 ? 2 ATOM 1374 C CA . MET A 1 193 ? 24.750 -33.852 -35.567 1.000 85.935 0 199 MET AAA CA 1 ? 2 ATOM 1375 C C . MET A 1 193 ? 23.468 -34.029 -36.387 1.000 85.155 0 199 MET AAA C 1 ? 2 ATOM 1376 O O . MET A 1 193 ? 23.041 -35.189 -36.535 1.000 85.893 0 199 MET AAA O 1 ? 2 ATOM 1377 C CB . MET A 1 193 ? 24.376 -33.334 -34.179 1.000 90.486 0 199 MET AAA CB 1 ? 2 ATOM 1378 C CG . MET A 1 193 ? 25.546 -33.288 -33.232 1.000 94.332 0 199 MET AAA CG 1 ? 2 ATOM 1379 S SD . MET A 1 193 ? 25.020 -33.625 -31.551 1.000 100.743 0 199 MET AAA SD 1 ? 2 ATOM 1380 C CE . MET A 1 193 ? 23.616 -32.517 -31.428 1.000 102.615 0 199 MET AAA CE 1 ? 2 ATOM 1381 N N . CYS A 1 194 ? 22.871 -32.934 -36.879 1.000 86.823 0 200 CYS AAA N 1 ? 2 ATOM 1382 C CA . CYS A 1 194 ? 21.641 -32.944 -37.730 1.000 91.675 0 200 CYS AAA CA 1 ? 2 ATOM 1383 C C . CYS A 1 194 ? 21.868 -33.759 -39.014 1.000 83.522 0 200 CYS AAA C 1 ? 2 ATOM 1384 O O . CYS A 1 194 ? 20.855 -34.209 -39.597 1.000 77.921 0 200 CYS AAA O 1 ? 2 ATOM 1385 C CB . CYS A 1 194 ? 21.177 -31.540 -38.113 1.000 93.942 0 200 CYS AAA CB 1 ? 2 ATOM 1386 S SG . CYS A 1 194 ? 20.120 -30.745 -36.875 1.000 105.916 0 200 CYS AAA SG 1 ? 2 ATOM 1387 N N . GLY A 1 195 ? 23.131 -33.929 -39.433 1.000 78.818 0 201 GLY AAA N 1 ? 2 ATOM 1388 C CA . GLY A 1 195 ? 23.521 -34.576 -40.699 1.000 78.294 0 201 GLY AAA CA 1 ? 2 ATOM 1389 C C . GLY A 1 195 ? 23.275 -33.657 -41.881 1.000 74.539 0 201 GLY AAA C 1 ? 2 ATOM 1390 O O . GLY A 1 195 ? 22.951 -34.181 -42.963 1.000 71.555 0 201 GLY AAA O 1 ? 2 ATOM 1391 N N . THR A 1 196 ? 23.433 -32.343 -41.673 1.000 80.184 0 202 THR AAA N 1 ? 2 ATOM 1392 C CA . THR A 1 196 ? 23.131 -31.261 -42.654 1.000 80.649 0 202 THR AAA CA 1 ? 2 ATOM 1393 C C . THR A 1 196 ? 24.415 -30.474 -42.952 1.000 80.240 0 202 THR AAA C 1 ? 2 ATOM 1394 O O . THR A 1 196 ? 24.329 -29.339 -43.484 1.000 78.049 0 202 THR AAA O 1 ? 2 ATOM 1395 C CB . THR A 1 196 ? 21.985 -30.365 -42.161 1.000 79.182 0 202 THR AAA CB 1 ? 2 ATOM 1396 O OG1 . THR A 1 196 ? 22.214 -30.015 -40.795 1.000 79.838 0 202 THR AAA OG1 1 ? 2 ATOM 1397 C CG2 . THR A 1 196 ? 20.633 -31.030 -42.296 1.000 78.133 0 202 THR AAA CG2 1 ? 2 ATOM 1398 N N . LEU A 1 197 ? 25.569 -31.076 -42.656 1.000 75.579 0 203 LEU AAA N 1 ? 2 ATOM 1399 C CA . LEU A 1 197 ? 26.909 -30.474 -42.874 1.000 71.981 0 203 LEU AAA CA 1 ? 2 ATOM 1400 C C . LEU A 1 197 ? 27.141 -30.271 -44.381 1.000 69.326 0 203 LEU AAA C 1 ? 2 ATOM 1401 O O . LEU A 1 197 ? 27.867 -29.322 -44.761 1.000 64.962 0 203 LEU AAA O 1 ? 2 ATOM 1402 C CB . LEU A 1 197 ? 27.952 -31.405 -42.250 1.000 71.649 0 203 LEU AAA CB 1 ? 2 ATOM 1403 C CG . LEU A 1 197 ? 29.290 -30.761 -41.895 1.000 75.630 0 203 LEU AAA CG 1 ? 2 ATOM 1404 C CD1 . LEU A 1 197 ? 29.113 -29.601 -40.920 1.000 76.295 0 203 LEU AAA CD1 1 ? 2 ATOM 1405 C CD2 . LEU A 1 197 ? 30.238 -31.802 -41.315 1.000 80.307 0 203 LEU AAA CD2 1 ? 2 ATOM 1406 N N . ASP A 1 198 ? 26.522 -31.120 -45.206 1.000 67.910 0 204 ASP AAA N 1 ? 2 ATOM 1407 C CA . ASP A 1 198 ? 26.673 -31.133 -46.685 1.000 69.799 0 204 ASP AAA CA 1 ? 2 ATOM 1408 C C . ASP A 1 198 ? 26.233 -29.783 -47.266 1.000 66.750 0 204 ASP AAA C 1 ? 2 ATOM 1409 O O . ASP A 1 198 ? 26.862 -29.334 -48.241 1.000 66.299 0 204 ASP AAA O 1 ? 2 ATOM 1410 C CB . ASP A 1 198 ? 25.875 -32.283 -47.304 1.000 73.750 0 204 ASP AAA CB 1 ? 2 ATOM 1411 C CG . ASP A 1 198 ? 26.262 -33.654 -46.775 1.000 80.434 0 204 ASP AAA CG 1 ? 2 ATOM 1412 O OD1 . ASP A 1 198 ? 25.797 -34.017 -45.670 1.000 81.040 0 204 ASP AAA OD1 1 ? 2 ATOM 1413 O OD2 . ASP A 1 198 ? 27.027 -34.348 -47.474 1.000 86.904 0 204 ASP AAA OD2 1 ? 2 ATOM 1414 N N . TYR A 1 199 ? 25.199 -29.166 -46.681 1.000 62.742 0 205 TYR AAA N 1 ? 2 ATOM 1415 C CA . TYR A 1 199 ? 24.550 -27.914 -47.156 1.000 60.723 0 205 TYR AAA CA 1 ? 2 ATOM 1416 C C . TYR A 1 199 ? 25.263 -26.687 -46.557 1.000 62.821 0 205 TYR AAA C 1 ? 2 ATOM 1417 O O . TYR A 1 199 ? 24.658 -25.590 -46.466 1.000 61.204 0 205 TYR AAA O 1 ? 2 ATOM 1418 C CB . TYR A 1 199 ? 23.052 -27.952 -46.825 1.000 57.701 0 205 TYR AAA CB 1 ? 2 ATOM 1419 C CG . TYR A 1 199 ? 22.256 -28.985 -47.587 1.000 55.718 0 205 TYR AAA CG 1 ? 2 ATOM 1420 C CD1 . TYR A 1 199 ? 22.142 -30.288 -47.128 1.000 54.423 0 205 TYR AAA CD1 1 ? 2 ATOM 1421 C CD2 . TYR A 1 199 ? 21.605 -28.659 -48.767 1.000 56.042 0 205 TYR AAA CD2 1 ? 2 ATOM 1422 C CE1 . TYR A 1 199 ? 21.414 -31.242 -47.818 1.000 53.658 0 205 TYR AAA CE1 1 ? 2 ATOM 1423 C CE2 . TYR A 1 199 ? 20.874 -29.603 -49.475 1.000 56.484 0 205 TYR AAA CE2 1 ? 2 ATOM 1424 C CZ . TYR A 1 199 ? 20.774 -30.899 -48.994 1.000 56.745 0 205 TYR AAA CZ 1 ? 2 ATOM 1425 O OH . TYR A 1 199 ? 20.059 -31.844 -49.677 1.000 59.014 0 205 TYR AAA OH 1 ? 2 ATOM 1426 N N . LEU A 1 200 ? 26.524 -26.859 -46.157 1.000 64.652 0 206 LEU AAA N 1 ? 2 ATOM 1427 C CA . LEU A 1 200 ? 27.392 -25.773 -45.635 1.000 67.823 0 206 LEU AAA CA 1 ? 2 ATOM 1428 C C . LEU A 1 200 ? 28.661 -25.747 -46.476 1.000 70.439 0 206 LEU AAA C 1 ? 2 ATOM 1429 O O . LEU A 1 200 ? 29.456 -26.681 -46.422 1.000 74.426 0 206 LEU AAA O 1 ? 2 ATOM 1430 C CB . LEU A 1 200 ? 27.706 -26.025 -44.154 1.000 68.408 0 206 LEU AAA CB 1 ? 2 ATOM 1431 C CG . LEU A 1 200 ? 26.966 -25.138 -43.152 1.000 66.014 0 206 LEU AAA CG 1 ? 2 ATOM 1432 C CD1 . LEU A 1 200 ? 25.504 -25.538 -43.029 1.000 63.788 0 206 LEU AAA CD1 1 ? 2 ATOM 1433 C CD2 . LEU A 1 200 ? 27.642 -25.198 -41.799 1.000 68.282 0 206 LEU AAA CD2 1 ? 2 ATOM 1434 N N . PRO A 1 201 ? 28.881 -24.696 -47.294 1.000 70.681 0 207 PRO AAA N 1 ? 2 ATOM 1435 C CA . PRO A 1 201 ? 30.095 -24.603 -48.103 1.000 74.002 0 207 PRO AAA CA 1 ? 2 ATOM 1436 C C . PRO A 1 201 ? 31.327 -24.256 -47.267 1.000 76.517 0 207 PRO AAA C 1 ? 2 ATOM 1437 O O . PRO A 1 201 ? 31.201 -23.799 -46.134 1.000 74.034 0 207 PRO AAA O 1 ? 2 ATOM 1438 C CB . PRO A 1 201 ? 29.762 -23.494 -49.110 1.000 73.052 0 207 PRO AAA CB 1 ? 2 ATOM 1439 C CG . PRO A 1 201 ? 28.745 -22.627 -48.404 1.000 70.327 0 207 PRO AAA CG 1 ? 2 ATOM 1440 C CD . PRO A 1 201 ? 27.970 -23.561 -47.498 1.000 69.198 0 207 PRO AAA CD 1 ? 2 ATOM 1441 N N . PRO A 1 202 ? 32.552 -24.482 -47.797 1.000 79.855 0 208 PRO AAA N 1 ? 2 ATOM 1442 C CA . PRO A 1 202 ? 33.793 -24.141 -47.098 1.000 81.933 0 208 PRO AAA CA 1 ? 2 ATOM 1443 C C . PRO A 1 202 ? 33.813 -22.798 -46.350 1.000 84.571 0 208 PRO AAA C 1 ? 2 ATOM 1444 O O . PRO A 1 202 ? 34.266 -22.785 -45.220 1.000 91.612 0 208 PRO AAA O 1 ? 2 ATOM 1445 C CB . PRO A 1 202 ? 34.801 -24.113 -48.251 1.000 84.715 0 208 PRO AAA CB 1 ? 2 ATOM 1446 C CG . PRO A 1 202 ? 34.316 -25.208 -49.176 1.000 83.343 0 208 PRO AAA CG 1 ? 2 ATOM 1447 C CD . PRO A 1 202 ? 32.805 -25.132 -49.094 1.000 80.679 0 208 PRO AAA CD 1 ? 2 ATOM 1448 N N . GLU A 1 203 ? 33.341 -21.717 -46.977 1.000 84.812 0 209 GLU AAA N 1 ? 2 ATOM 1449 C CA . GLU A 1 203 ? 33.325 -20.351 -46.374 1.000 89.819 0 209 GLU AAA CA 1 ? 2 ATOM 1450 C C . GLU A 1 203 ? 32.664 -20.415 -44.990 1.000 89.388 0 209 GLU AAA C 1 ? 2 ATOM 1451 O O . GLU A 1 203 ? 33.255 -19.888 -44.023 1.000 91.592 0 209 GLU AAA O 1 ? 2 ATOM 1452 C CB . GLU A 1 203 ? 32.562 -19.334 -47.230 1.000 92.550 0 209 GLU AAA CB 1 ? 2 ATOM 1453 C CG . GLU A 1 203 ? 32.766 -19.497 -48.721 1.000 97.209 0 209 GLU AAA CG 1 ? 2 ATOM 1454 C CD . GLU A 1 203 ? 31.780 -20.442 -49.384 1.000 96.626 0 209 GLU AAA CD 1 ? 2 ATOM 1455 O OE1 . GLU A 1 203 ? 30.563 -20.168 -49.316 1.000 87.849 0 209 GLU AAA OE1 1 ? 2 ATOM 1456 O OE2 . GLU A 1 203 ? 32.237 -21.457 -49.957 1.000 105.372 0 209 GLU AAA OE2 1 ? 2 ATOM 1457 N N . MET A 1 204 ? 31.476 -21.024 -44.922 1.000 85.600 0 210 MET AAA N 1 ? 2 ATOM 1458 C CA . MET A 1 204 ? 30.682 -21.209 -43.680 1.000 83.952 0 210 MET AAA CA 1 ? 2 ATOM 1459 C C . MET A 1 204 ? 31.434 -22.150 -42.738 1.000 81.369 0 210 MET AAA C 1 ? 2 ATOM 1460 O O . MET A 1 204 ? 31.531 -21.810 -41.553 1.000 85.050 0 210 MET AAA O 1 ? 2 ATOM 1461 C CB . MET A 1 204 ? 29.299 -21.800 -43.973 1.000 83.840 0 210 MET AAA CB 1 ? 2 ATOM 1462 C CG . MET A 1 204 ? 28.441 -20.927 -44.857 1.000 84.551 0 210 MET AAA CG 1 ? 2 ATOM 1463 S SD . MET A 1 204 ? 26.683 -21.159 -44.536 1.000 85.155 0 210 MET AAA SD 1 ? 2 ATOM 1464 C CE . MET A 1 204 ? 26.539 -20.137 -43.070 1.000 82.695 0 210 MET AAA CE 1 ? 2 ATOM 1465 N N . ILE A 1 205 ? 31.930 -23.281 -43.256 1.000 78.713 0 211 ILE AAA N 1 ? 2 ATOM 1466 C CA . ILE A 1 205 ? 32.662 -24.334 -42.484 1.000 80.052 0 211 ILE AAA CA 1 ? 2 ATOM 1467 C C . ILE A 1 205 ? 33.794 -23.667 -41.699 1.000 85.143 0 211 ILE AAA C 1 ? 2 ATOM 1468 O O . ILE A 1 205 ? 33.887 -23.904 -40.478 1.000 91.758 0 211 ILE AAA O 1 ? 2 ATOM 1469 C CB . ILE A 1 205 ? 33.191 -25.450 -43.413 1.000 81.629 0 211 ILE AAA CB 1 ? 2 ATOM 1470 C CG1 . ILE A 1 205 ? 32.070 -26.358 -43.929 1.000 80.160 0 211 ILE AAA CG1 1 ? 2 ATOM 1471 C CG2 . ILE A 1 205 ? 34.291 -26.259 -42.744 1.000 84.753 0 211 ILE AAA CG2 1 ? 2 ATOM 1472 C CD1 . ILE A 1 205 ? 31.442 -27.247 -42.872 1.000 79.702 0 211 ILE AAA CD1 1 ? 2 ATOM 1473 N N . GLU A 1 206 ? 34.606 -22.852 -42.379 1.000 84.065 0 212 GLU AAA N 1 ? 2 ATOM 1474 C CA . GLU A 1 206 ? 35.743 -22.097 -41.788 1.000 83.653 0 212 GLU AAA CA 1 ? 2 ATOM 1475 C C . GLU A 1 206 ? 35.193 -20.788 -41.204 1.000 83.594 0 212 GLU AAA C 1 ? 2 ATOM 1476 O O . GLU A 1 206 ? 33.962 -20.625 -41.174 1.000 78.857 0 212 GLU AAA O 1 ? 2 ATOM 1477 C CB . GLU A 1 206 ? 36.813 -21.918 -42.867 1.000 84.729 0 212 GLU AAA CB 1 ? 2 ATOM 1478 C CG . GLU A 1 206 ? 37.327 -23.252 -43.391 1.000 84.398 0 212 GLU AAA CG 1 ? 2 ATOM 1479 C CD . GLU A 1 206 ? 38.388 -23.202 -44.476 1.000 83.767 0 212 GLU AAA CD 1 ? 2 ATOM 1480 O OE1 . GLU A 1 206 ? 38.011 -23.010 -45.647 1.000 81.885 0 212 GLU AAA OE1 1 ? 2 ATOM 1481 O OE2 . GLU A 1 206 ? 39.582 -23.367 -44.150 1.000 84.862 0 212 GLU AAA OE2 1 ? 2 ATOM 1482 N N . GLY A 1 207 ? 36.049 -19.880 -40.747 1.000 91.101 0 213 GLY AAA N 1 ? 2 ATOM 1483 C CA . GLY A 1 207 ? 35.595 -18.640 -40.089 1.000 97.259 0 213 GLY AAA CA 1 ? 2 ATOM 1484 C C . GLY A 1 207 ? 34.897 -17.689 -41.053 1.000 99.553 0 213 GLY AAA C 1 ? 2 ATOM 1485 O O . GLY A 1 207 ? 34.292 -16.730 -40.555 1.000 102.578 0 213 GLY AAA O 1 ? 2 ATOM 1486 N N . ARG A 1 208 ? 34.946 -17.957 -42.366 1.000 102.070 0 214 ARG AAA N 1 ? 2 ATOM 1487 C CA . ARG A 1 208 ? 34.972 -16.918 -43.435 1.000 107.663 0 214 ARG AAA CA 1 ? 2 ATOM 1488 C C . ARG A 1 208 ? 33.569 -16.369 -43.724 1.000 103.506 0 214 ARG AAA C 1 ? 2 ATOM 1489 O O . ARG A 1 208 ? 32.572 -17.070 -43.453 1.000 96.828 0 214 ARG AAA O 1 ? 2 ATOM 1490 C CB . ARG A 1 208 ? 35.617 -17.480 -44.706 1.000 113.134 0 214 ARG AAA CB 1 ? 2 ATOM 1491 C CG . ARG A 1 208 ? 36.200 -16.432 -45.646 1.000 118.976 0 214 ARG AAA CG 1 ? 2 ATOM 1492 C CD . ARG A 1 208 ? 36.823 -17.051 -46.883 1.000 121.807 0 214 ARG AAA CD 1 ? 2 ATOM 1493 N NE . ARG A 1 208 ? 37.415 -18.343 -46.555 1.000 125.721 0 214 ARG AAA NE 1 ? 2 ATOM 1494 C CZ . ARG A 1 208 ? 37.076 -19.517 -47.085 1.000 126.424 0 214 ARG AAA CZ 1 ? 2 ATOM 1495 N NH1 . ARG A 1 208 ? 37.686 -20.614 -46.671 1.000 127.361 0 214 ARG AAA NH1 1 ? 2 ATOM 1496 N NH2 . ARG A 1 208 ? 36.183 -19.606 -48.055 1.000 127.463 0 214 ARG AAA NH2 1 ? 2 ATOM 1497 N N . THR A 1 209 ? 33.520 -15.142 -44.264 1.000 105.637 0 215 THR AAA N 1 ? 2 ATOM 1498 C CA . THR A 1 209 ? 32.282 -14.395 -44.616 1.000 102.219 0 215 THR AAA CA 1 ? 2 ATOM 1499 C C . THR A 1 209 ? 31.586 -15.102 -45.781 1.000 100.675 0 215 THR AAA C 1 ? 2 ATOM 1500 O O . THR A 1 209 ? 32.293 -15.665 -46.651 1.000 93.954 0 215 THR AAA O 1 ? 2 ATOM 1501 C CB . THR A 1 209 ? 32.558 -12.931 -44.988 1.000 103.520 0 215 THR AAA CB 1 ? 2 ATOM 1502 O OG1 . THR A 1 209 ? 33.387 -12.921 -46.150 1.000 106.744 0 215 THR AAA OG1 1 ? 2 ATOM 1503 C CG2 . THR A 1 209 ? 33.205 -12.137 -43.874 1.000 106.186 0 215 THR AAA CG2 1 ? 2 ATOM 1504 N N . TYR A 1 210 ? 30.253 -15.030 -45.794 1.000 104.701 0 216 TYR AAA N 1 ? 2 ATOM 1505 C CA . TYR A 1 210 ? 29.347 -15.742 -46.729 1.000 99.328 0 216 TYR AAA CA 1 ? 2 ATOM 1506 C C . TYR A 1 210 ? 28.263 -14.769 -47.202 1.000 96.740 0 216 TYR AAA C 1 ? 2 ATOM 1507 O O . TYR A 1 210 ? 27.804 -13.950 -46.385 1.000 97.520 0 216 TYR AAA O 1 ? 2 ATOM 1508 C CB . TYR A 1 210 ? 28.775 -16.972 -46.021 1.000 100.967 0 216 TYR AAA CB 1 ? 2 ATOM 1509 C CG . TYR A 1 210 ? 27.794 -16.669 -44.917 1.000 99.986 0 216 TYR AAA CG 1 ? 2 ATOM 1510 C CD1 . TYR A 1 210 ? 26.439 -16.564 -45.185 1.000 100.678 0 216 TYR AAA CD1 1 ? 2 ATOM 1511 C CD2 . TYR A 1 210 ? 28.214 -16.478 -43.612 1.000 101.557 0 216 TYR AAA CD2 1 ? 2 ATOM 1512 C CE1 . TYR A 1 210 ? 25.523 -16.280 -44.186 1.000 102.141 0 216 TYR AAA CE1 1 ? 2 ATOM 1513 C CE2 . TYR A 1 210 ? 27.314 -16.185 -42.601 1.000 104.956 0 216 TYR AAA CE2 1 ? 2 ATOM 1514 C CZ . TYR A 1 210 ? 25.963 -16.091 -42.889 1.000 105.153 0 216 TYR AAA CZ 1 ? 2 ATOM 1515 O OH . TYR A 1 210 ? 25.061 -15.804 -41.908 1.000 112.228 0 216 TYR AAA OH 1 ? 2 ATOM 1516 N N . ASP A 1 211 ? 27.890 -14.849 -48.483 1.000 93.339 0 217 ASP AAA N 1 ? 2 ATOM 1517 C CA . ASP A 1 211 ? 26.798 -14.052 -49.104 1.000 89.741 0 217 ASP AAA CA 1 ? 2 ATOM 1518 C C . ASP A 1 211 ? 25.811 -15.031 -49.749 1.000 84.332 0 217 ASP AAA C 1 ? 2 ATOM 1519 O O . ASP A 1 211 ? 25.926 -16.238 -49.473 1.000 79.900 0 217 ASP AAA O 1 ? 2 ATOM 1520 C CB . ASP A 1 211 ? 27.372 -13.027 -50.085 1.000 98.129 0 217 ASP AAA CB 1 ? 2 ATOM 1521 C CG . ASP A 1 211 ? 28.031 -13.642 -51.313 1.000 106.204 0 217 ASP AAA CG 1 ? 2 ATOM 1522 O OD1 . ASP A 1 211 ? 28.653 -14.716 -51.167 1.000 111.616 0 217 ASP AAA OD1 1 ? 2 ATOM 1523 O OD2 . ASP A 1 211 ? 27.916 -13.046 -52.406 1.000 104.100 0 217 ASP AAA OD2 1 ? 2 ATOM 1524 N N . GLU A 1 212 ? 24.900 -14.538 -50.596 1.000 88.071 0 218 GLU AAA N 1 ? 2 ATOM 1525 C CA . GLU A 1 212 ? 23.839 -15.362 -51.241 1.000 82.531 0 218 GLU AAA CA 1 ? 2 ATOM 1526 C C . GLU A 1 212 ? 24.451 -16.302 -52.294 1.000 77.514 0 218 GLU AAA C 1 ? 2 ATOM 1527 O O . GLU A 1 212 ? 23.677 -17.040 -52.922 1.000 73.861 0 218 GLU AAA O 1 ? 2 ATOM 1528 C CB . GLU A 1 212 ? 22.738 -14.474 -51.830 1.000 83.594 0 218 GLU AAA CB 1 ? 2 ATOM 1529 C CG . GLU A 1 212 ? 21.784 -13.902 -50.785 1.000 88.680 0 218 GLU AAA CG 1 ? 2 ATOM 1530 C CD . GLU A 1 212 ? 20.910 -14.898 -50.027 1.000 85.714 0 218 GLU AAA CD 1 ? 2 ATOM 1531 O OE1 . GLU A 1 212 ? 20.045 -15.548 -50.659 1.000 75.511 0 218 GLU AAA OE1 1 ? 2 ATOM 1532 O OE2 . GLU A 1 212 ? 21.080 -15.012 -48.796 1.000 85.951 0 218 GLU AAA OE2 1 ? 2 ATOM 1533 N N . LYS A 1 213 ? 25.780 -16.322 -52.454 1.000 76.563 0 219 LYS AAA N 1 ? 2 ATOM 1534 C CA . LYS A 1 213 ? 26.488 -17.335 -53.288 1.000 75.084 0 219 LYS AAA CA 1 ? 2 ATOM 1535 C C . LYS A 1 213 ? 26.481 -18.697 -52.582 1.000 71.442 0 219 LYS AAA C 1 ? 2 ATOM 1536 O O . LYS A 1 213 ? 26.838 -19.696 -53.232 1.000 67.020 0 219 LYS AAA O 1 ? 2 ATOM 1537 C CB . LYS A 1 213 ? 27.915 -16.890 -53.619 1.000 79.256 0 219 LYS AAA CB 1 ? 2 ATOM 1538 C CG . LYS A 1 213 ? 28.021 -16.037 -54.876 1.000 83.959 0 219 LYS AAA CG 1 ? 2 ATOM 1539 C CD . LYS A 1 213 ? 29.294 -15.231 -54.960 1.000 90.943 0 219 LYS AAA CD 1 ? 2 ATOM 1540 C CE . LYS A 1 213 ? 29.149 -13.991 -55.812 1.000 97.403 0 219 LYS AAA CE 1 ? 2 ATOM 1541 N NZ . LYS A 1 213 ? 28.451 -12.905 -55.083 1.000 100.932 0 219 LYS AAA NZ 1 ? 2 ATOM 1542 N N . VAL A 1 214 ? 26.101 -18.736 -51.302 1.000 73.660 0 220 VAL AAA N 1 ? 2 ATOM 1543 C CA . VAL A 1 214 ? 25.902 -20.000 -50.535 1.000 73.649 0 220 VAL AAA CA 1 ? 2 ATOM 1544 C C . VAL A 1 214 ? 24.751 -20.772 -51.180 1.000 70.810 0 220 VAL AAA C 1 ? 2 ATOM 1545 O O . VAL A 1 214 ? 24.883 -22.002 -51.322 1.000 70.767 0 220 VAL AAA O 1 ? 2 ATOM 1546 C CB . VAL A 1 214 ? 25.636 -19.727 -49.044 1.000 79.074 0 220 VAL AAA CB 1 ? 2 ATOM 1547 C CG1 . VAL A 1 214 ? 25.135 -20.968 -48.321 1.000 82.640 0 220 VAL AAA CG1 1 ? 2 ATOM 1548 C CG2 . VAL A 1 214 ? 26.870 -19.176 -48.350 1.000 82.801 0 220 VAL AAA CG2 1 ? 2 ATOM 1549 N N . ASP A 1 215 ? 23.678 -20.059 -51.551 1.000 69.946 0 221 ASP AAA N 1 ? 2 ATOM 1550 C CA . ASP A 1 215 ? 22.492 -20.605 -52.270 1.000 67.801 0 221 ASP AAA CA 1 ? 2 ATOM 1551 C C . ASP A 1 215 ? 22.956 -21.522 -53.411 1.000 66.706 0 221 ASP AAA C 1 ? 2 ATOM 1552 O O . ASP A 1 215 ? 22.407 -22.636 -53.532 1.000 69.213 0 221 ASP AAA O 1 ? 2 ATOM 1553 C CB . ASP A 1 215 ? 21.590 -19.488 -52.811 1.000 66.748 0 221 ASP AAA CB 1 ? 2 ATOM 1554 C CG . ASP A 1 215 ? 20.809 -18.740 -51.741 1.000 63.995 0 221 ASP AAA CG 1 ? 2 ATOM 1555 O OD1 . ASP A 1 215 ? 20.717 -19.270 -50.610 1.000 61.330 0 221 ASP AAA OD1 1 ? 2 ATOM 1556 O OD2 . ASP A 1 215 ? 20.288 -17.638 -52.051 1.000 58.556 0 221 ASP AAA OD2 1 ? 2 ATOM 1557 N N . LEU A 1 216 ? 23.938 -21.082 -54.201 1.000 64.389 0 222 LEU AAA N 1 ? 2 ATOM 1558 C CA . LEU A 1 216 ? 24.412 -21.812 -55.408 1.000 64.267 0 222 LEU AAA CA 1 ? 2 ATOM 1559 C C . LEU A 1 216 ? 24.931 -23.193 -54.985 1.000 63.274 0 222 LEU AAA C 1 ? 2 ATOM 1560 O O . LEU A 1 216 ? 24.546 -24.201 -55.616 1.000 60.343 0 222 LEU AAA O 1 ? 2 ATOM 1561 C CB . LEU A 1 216 ? 25.493 -20.985 -56.115 1.000 65.862 0 222 LEU AAA CB 1 ? 2 ATOM 1562 C CG . LEU A 1 216 ? 25.032 -19.953 -57.154 1.000 66.430 0 222 LEU AAA CG 1 ? 2 ATOM 1563 C CD1 . LEU A 1 216 ? 23.731 -19.265 -56.780 1.000 65.764 0 222 LEU AAA CD1 1 ? 2 ATOM 1564 C CD2 . LEU A 1 216 ? 26.110 -18.905 -57.373 1.000 69.780 0 222 LEU AAA CD2 1 ? 2 ATOM 1565 N N . TRP A 1 217 ? 25.759 -23.239 -53.942 1.000 66.072 0 223 TRP AAA N 1 ? 2 ATOM 1566 C CA . TRP A 1 217 ? 26.323 -24.507 -53.407 1.000 66.543 0 223 TRP AAA CA 1 ? 2 ATOM 1567 C C . TRP A 1 217 ? 25.156 -25.452 -53.090 1.000 62.445 0 223 TRP AAA C 1 ? 2 ATOM 1568 O O . TRP A 1 217 ? 25.118 -26.557 -53.658 1.000 64.099 0 223 TRP AAA O 1 ? 2 ATOM 1569 C CB . TRP A 1 217 ? 27.241 -24.221 -52.207 1.000 67.675 0 223 TRP AAA CB 1 ? 2 ATOM 1570 C CG . TRP A 1 217 ? 27.748 -25.418 -51.457 1.000 67.887 0 223 TRP AAA CG 1 ? 2 ATOM 1571 C CD1 . TRP A 1 217 ? 27.109 -26.069 -50.443 1.000 69.311 0 223 TRP AAA CD1 1 ? 2 ATOM 1572 C CD2 . TRP A 1 217 ? 29.027 -26.065 -51.599 1.000 68.975 0 223 TRP AAA CD2 1 ? 2 ATOM 1573 N NE1 . TRP A 1 217 ? 27.885 -27.091 -49.969 1.000 70.487 0 223 TRP AAA NE1 1 ? 2 ATOM 1574 C CE2 . TRP A 1 217 ? 29.065 -27.114 -50.658 1.000 70.785 0 223 TRP AAA CE2 1 ? 2 ATOM 1575 C CE3 . TRP A 1 217 ? 30.140 -25.871 -52.424 1.000 72.226 0 223 TRP AAA CE3 1 ? 2 ATOM 1576 C CZ2 . TRP A 1 217 ? 30.162 -27.965 -50.531 1.000 74.840 0 223 TRP AAA CZ2 1 ? 2 ATOM 1577 C CZ3 . TRP A 1 217 ? 31.225 -26.711 -52.299 1.000 72.126 0 223 TRP AAA CZ3 1 ? 2 ATOM 1578 C CH2 . TRP A 1 217 ? 31.233 -27.748 -51.367 1.000 73.769 0 223 TRP AAA CH2 1 ? 2 ATOM 1579 N N . CYS A 1 218 ? 24.190 -24.998 -52.292 1.000 58.933 0 224 CYS AAA N 1 ? 2 ATOM 1580 C CA . CYS A 1 218 ? 23.081 -25.839 -51.766 1.000 59.318 0 224 CYS AAA CA 1 ? 2 ATOM 1581 C C . CYS A 1 218 ? 22.296 -26.482 -52.915 1.000 55.663 0 224 CYS AAA C 1 ? 2 ATOM 1582 O O . CYS A 1 218 ? 21.975 -27.675 -52.816 1.000 51.828 0 224 CYS AAA O 1 ? 2 ATOM 1583 C CB . CYS A 1 218 ? 22.180 -25.026 -50.848 1.000 61.894 0 224 CYS AAA CB 1 ? 2 ATOM 1584 S SG . CYS A 1 218 ? 23.041 -24.491 -49.344 1.000 68.117 0 224 CYS AAA SG 1 ? 2 ATOM 1585 N N . ILE A 1 219 ? 22.023 -25.736 -53.982 1.000 60.037 0 225 ILE AAA N 1 ? 2 ATOM 1586 C CA . ILE A 1 219 ? 21.293 -26.254 -55.176 1.000 58.218 0 225 ILE AAA CA 1 ? 2 ATOM 1587 C C . ILE A 1 219 ? 22.080 -27.436 -55.754 1.000 58.268 0 225 ILE AAA C 1 ? 2 ATOM 1588 O O . ILE A 1 219 ? 21.440 -28.459 -56.100 1.000 60.408 0 225 ILE AAA O 1 ? 2 ATOM 1589 C CB . ILE A 1 219 ? 21.065 -25.138 -56.207 1.000 59.114 0 225 ILE AAA CB 1 ? 2 ATOM 1590 C CG1 . ILE A 1 219 ? 20.101 -24.080 -55.669 1.000 59.527 0 225 ILE AAA CG1 1 ? 2 ATOM 1591 C CG2 . ILE A 1 219 ? 20.579 -25.719 -57.526 1.000 63.062 0 225 ILE AAA CG2 1 ? 2 ATOM 1592 C CD1 . ILE A 1 219 ? 20.131 -22.789 -56.449 1.000 64.752 0 225 ILE AAA CD1 1 ? 2 ATOM 1593 N N . GLY A 1 220 ? 23.409 -27.301 -55.840 1.000 54.474 0 226 GLY AAA N 1 ? 2 ATOM 1594 C CA . GLY A 1 220 ? 24.323 -28.385 -56.248 1.000 53.901 0 226 GLY AAA CA 1 ? 2 ATOM 1595 C C . GLY A 1 220 ? 24.188 -29.606 -55.346 1.000 52.204 0 226 GLY AAA C 1 ? 2 ATOM 1596 O O . GLY A 1 220 ? 24.086 -30.742 -55.879 1.000 50.137 0 226 GLY AAA O 1 ? 2 ATOM 1597 N N . VAL A 1 221 ? 24.172 -29.388 -54.026 1.000 51.236 0 227 VAL AAA N 1 ? 2 ATOM 1598 C CA . VAL A 1 221 ? 23.999 -30.469 -53.009 1.000 52.283 0 227 VAL AAA CA 1 ? 2 ATOM 1599 C C . VAL A 1 221 ? 22.617 -31.097 -53.236 1.000 52.476 0 227 VAL AAA C 1 ? 2 ATOM 1600 O O . VAL A 1 221 ? 22.547 -32.336 -53.419 1.000 52.205 0 227 VAL AAA O 1 ? 2 ATOM 1601 C CB . VAL A 1 221 ? 24.164 -29.940 -51.569 1.000 51.927 0 227 VAL AAA CB 1 ? 2 ATOM 1602 C CG1 . VAL A 1 221 ? 24.026 -31.043 -50.527 1.000 51.369 0 227 VAL AAA CG1 1 ? 2 ATOM 1603 C CG2 . VAL A 1 221 ? 25.483 -29.208 -51.382 1.000 53.920 0 227 VAL AAA CG2 1 ? 2 ATOM 1604 N N . LEU A 1 222 ? 21.569 -30.262 -53.259 1.000 53.347 0 228 LEU AAA N 1 ? 2 ATOM 1605 C CA . LEU A 1 222 ? 20.154 -30.700 -53.406 1.000 53.704 0 228 LEU AAA CA 1 ? 2 ATOM 1606 C C . LEU A 1 222 ? 20.024 -31.556 -54.662 1.000 51.636 0 228 LEU AAA C 1 ? 2 ATOM 1607 O O . LEU A 1 222 ? 19.338 -32.593 -54.613 1.000 50.546 0 228 LEU AAA O 1 ? 2 ATOM 1608 C CB . LEU A 1 222 ? 19.210 -29.498 -53.518 1.000 53.595 0 228 LEU AAA CB 1 ? 2 ATOM 1609 C CG . LEU A 1 222 ? 17.739 -29.862 -53.734 1.000 50.592 0 228 LEU AAA CG 1 ? 2 ATOM 1610 C CD1 . LEU A 1 222 ? 17.188 -30.630 -52.538 1.000 50.589 0 228 LEU AAA CD1 1 ? 2 ATOM 1611 C CD2 . LEU A 1 222 ? 16.909 -28.623 -54.001 1.000 48.965 0 228 LEU AAA CD2 1 ? 2 ATOM 1612 N N . CYS A 1 223 ? 20.633 -31.116 -55.757 1.000 52.975 0 229 CYS AAA N 1 ? 2 ATOM 1613 C CA . CYS A 1 223 ? 20.526 -31.834 -57.046 1.000 55.748 0 229 CYS AAA CA 1 ? 2 ATOM 1614 C C . CYS A 1 223 ? 21.123 -33.234 -56.891 1.000 57.898 0 229 CYS AAA C 1 ? 2 ATOM 1615 O O . CYS A 1 223 ? 20.443 -34.209 -57.277 1.000 59.766 0 229 CYS AAA O 1 ? 2 ATOM 1616 C CB . CYS A 1 223 ? 21.186 -31.086 -58.190 1.000 57.414 0 229 CYS AAA CB 1 ? 2 ATOM 1617 S SG . CYS A 1 223 ? 20.521 -31.639 -59.777 1.000 60.261 0 229 CYS AAA SG 1 ? 2 ATOM 1618 N N . TYR A 1 224 ? 22.324 -33.335 -56.313 1.000 56.932 0 230 TYR AAA N 1 ? 2 ATOM 1619 C CA . TYR A 1 224 ? 23.001 -34.633 -56.075 1.000 57.959 0 230 TYR AAA CA 1 ? 2 ATOM 1620 C C . TYR A 1 224 ? 22.091 -35.518 -55.217 1.000 60.043 0 230 TYR AAA C 1 ? 2 ATOM 1621 O O . TYR A 1 224 ? 21.855 -36.666 -55.632 1.000 67.311 0 230 TYR AAA O 1 ? 2 ATOM 1622 C CB . TYR A 1 224 ? 24.375 -34.441 -55.436 1.000 58.918 0 230 TYR AAA CB 1 ? 2 ATOM 1623 C CG . TYR A 1 224 ? 25.164 -35.720 -55.302 1.000 61.379 0 230 TYR AAA CG 1 ? 2 ATOM 1624 C CD1 . TYR A 1 224 ? 24.896 -36.622 -54.282 1.000 60.991 0 230 TYR AAA CD1 1 ? 2 ATOM 1625 C CD2 . TYR A 1 224 ? 26.183 -36.029 -56.189 1.000 63.321 0 230 TYR AAA CD2 1 ? 2 ATOM 1626 C CE1 . TYR A 1 224 ? 25.612 -37.799 -54.148 1.000 62.907 0 230 TYR AAA CE1 1 ? 2 ATOM 1627 C CE2 . TYR A 1 224 ? 26.917 -37.198 -56.063 1.000 66.002 0 230 TYR AAA CE2 1 ? 2 ATOM 1628 C CZ . TYR A 1 224 ? 26.631 -38.086 -55.040 1.000 65.901 0 230 TYR AAA CZ 1 ? 2 ATOM 1629 O OH . TYR A 1 224 ? 27.337 -39.250 -54.931 1.000 67.864 0 230 TYR AAA OH 1 ? 2 ATOM 1630 N N . GLU A 1 225 ? 21.584 -34.992 -54.092 1.000 57.453 0 231 GLU AAA N 1 ? 2 ATOM 1631 C CA . GLU A 1 225 ? 20.746 -35.741 -53.110 1.000 56.664 0 231 GLU AAA CA 1 ? 2 ATOM 1632 C C . GLU A 1 225 ? 19.502 -36.317 -53.806 1.000 56.298 0 231 GLU AAA C 1 ? 2 ATOM 1633 O O . GLU A 1 225 ? 19.275 -37.541 -53.696 1.000 56.600 0 231 GLU AAA O 1 ? 2 ATOM 1634 C CB . GLU A 1 225 ? 20.362 -34.857 -51.918 1.000 55.741 0 231 GLU AAA CB 1 ? 2 ATOM 1635 C CG . GLU A 1 225 ? 19.636 -35.613 -50.811 1.000 58.095 0 231 GLU AAA CG 1 ? 2 ATOM 1636 C CD . GLU A 1 225 ? 19.814 -35.099 -49.386 1.000 61.340 0 231 GLU AAA CD 1 ? 2 ATOM 1637 O OE1 . GLU A 1 225 ? 20.561 -34.118 -49.186 1.000 61.693 0 231 GLU AAA OE1 1 ? 2 ATOM 1638 O OE2 . GLU A 1 225 ? 19.211 -35.695 -48.467 1.000 61.541 0 231 GLU AAA OE2 1 ? 2 ATOM 1639 N N . LEU A 1 226 ? 18.733 -35.485 -54.513 1.000 54.949 0 232 LEU AAA N 1 ? 2 ATOM 1640 C CA . LEU A 1 226 ? 17.465 -35.909 -55.169 1.000 55.630 0 232 LEU AAA CA 1 ? 2 ATOM 1641 C C . LEU A 1 226 ? 17.739 -37.075 -56.134 1.000 55.821 0 232 LEU AAA C 1 ? 2 ATOM 1642 O O . LEU A 1 226 ? 16.937 -38.027 -56.146 1.000 54.583 0 232 LEU AAA O 1 ? 2 ATOM 1643 C CB . LEU A 1 226 ? 16.829 -34.714 -55.890 1.000 54.958 0 232 LEU AAA CB 1 ? 2 ATOM 1644 C CG . LEU A 1 226 ? 16.381 -33.557 -54.994 1.000 54.588 0 232 LEU AAA CG 1 ? 2 ATOM 1645 C CD1 . LEU A 1 226 ? 16.063 -32.323 -55.818 1.000 55.440 0 232 LEU AAA CD1 1 ? 2 ATOM 1646 C CD2 . LEU A 1 226 ? 15.184 -33.937 -54.139 1.000 54.467 0 232 LEU AAA CD2 1 ? 2 ATOM 1647 N N . LEU A 1 227 ? 18.840 -37.025 -56.891 1.000 57.693 0 233 LEU AAA N 1 ? 2 ATOM 1648 C CA . LEU A 1 227 ? 19.145 -38.015 -57.963 1.000 62.038 0 233 LEU AAA CA 1 ? 2 ATOM 1649 C C . LEU A 1 227 ? 19.703 -39.315 -57.366 1.000 62.243 0 233 LEU AAA C 1 ? 2 ATOM 1650 O O . LEU A 1 227 ? 19.346 -40.390 -57.879 1.000 64.213 0 233 LEU AAA O 1 ? 2 ATOM 1651 C CB . LEU A 1 227 ? 20.127 -37.409 -58.973 1.000 64.694 0 233 LEU AAA CB 1 ? 2 ATOM 1652 C CG . LEU A 1 227 ? 19.569 -36.284 -59.848 1.000 64.055 0 233 LEU AAA CG 1 ? 2 ATOM 1653 C CD1 . LEU A 1 227 ? 20.663 -35.648 -60.692 1.000 67.015 0 233 LEU AAA CD1 1 ? 2 ATOM 1654 C CD2 . LEU A 1 227 ? 18.446 -36.785 -60.739 1.000 63.399 0 233 LEU AAA CD2 1 ? 2 ATOM 1655 N N . VAL A 1 228 ? 20.550 -39.228 -56.338 1.000 61.644 0 234 VAL AAA N 1 ? 2 ATOM 1656 C CA . VAL A 1 228 ? 21.346 -40.383 -55.819 1.000 62.290 0 234 VAL AAA CA 1 ? 2 ATOM 1657 C C . VAL A 1 228 ? 20.630 -41.026 -54.627 1.000 63.051 0 234 VAL AAA C 1 ? 2 ATOM 1658 O O . VAL A 1 228 ? 20.732 -42.262 -54.486 1.000 64.564 0 234 VAL AAA O 1 ? 2 ATOM 1659 C CB . VAL A 1 228 ? 22.774 -39.953 -55.444 1.000 64.048 0 234 VAL AAA CB 1 ? 2 ATOM 1660 C CG1 . VAL A 1 228 ? 23.618 -41.153 -55.054 1.000 67.742 0 234 VAL AAA CG1 1 ? 2 ATOM 1661 C CG2 . VAL A 1 228 ? 23.441 -39.177 -56.571 1.000 66.134 0 234 VAL AAA CG2 1 ? 2 ATOM 1662 N N . GLY A 1 229 ? 19.966 -40.217 -53.792 1.000 62.871 0 235 GLY AAA N 1 ? 2 ATOM 1663 C CA . GLY A 1 229 ? 19.218 -40.665 -52.598 1.000 60.840 0 235 GLY AAA CA 1 ? 2 ATOM 1664 C C . GLY A 1 229 ? 19.858 -40.208 -51.294 1.000 59.523 0 235 GLY AAA C 1 ? 2 ATOM 1665 O O . GLY A 1 229 ? 19.203 -40.353 -50.241 1.000 61.470 0 235 GLY AAA O 1 ? 2 ATOM 1666 N N . TYR A 1 230 ? 21.092 -39.694 -51.349 1.000 58.306 0 236 TYR AAA N 1 ? 2 ATOM 1667 C CA . TYR A 1 230 ? 21.904 -39.286 -50.173 1.000 58.941 0 236 TYR AAA CA 1 ? 2 ATOM 1668 C C . TYR A 1 230 ? 22.809 -38.114 -50.543 1.000 58.447 0 236 TYR AAA C 1 ? 2 ATOM 1669 O O . TYR A 1 230 ? 23.162 -37.948 -51.705 1.000 60.407 0 236 TYR AAA O 1 ? 2 ATOM 1670 C CB . TYR A 1 230 ? 22.703 -40.474 -49.634 1.000 61.804 0 236 TYR AAA CB 1 ? 2 ATOM 1671 C CG . TYR A 1 230 ? 23.619 -41.160 -50.620 1.000 65.114 0 236 TYR AAA CG 1 ? 2 ATOM 1672 C CD1 . TYR A 1 230 ? 24.813 -40.582 -51.022 1.000 66.337 0 236 TYR AAA CD1 1 ? 2 ATOM 1673 C CD2 . TYR A 1 230 ? 23.315 -42.417 -51.119 1.000 68.209 0 236 TYR AAA CD2 1 ? 2 ATOM 1674 C CE1 . TYR A 1 230 ? 25.666 -41.220 -51.908 1.000 68.617 0 236 TYR AAA CE1 1 ? 2 ATOM 1675 C CE2 . TYR A 1 230 ? 24.155 -43.069 -52.009 1.000 70.601 0 236 TYR AAA CE2 1 ? 2 ATOM 1676 C CZ . TYR A 1 230 ? 25.339 -42.471 -52.401 1.000 71.280 0 236 TYR AAA CZ 1 ? 2 ATOM 1677 O OH . TYR A 1 230 ? 26.168 -43.109 -53.279 1.000 74.855 0 236 TYR AAA OH 1 ? 2 ATOM 1678 N N . PRO A 1 231 ? 23.220 -37.260 -49.576 1.000 60.913 0 237 PRO AAA N 1 ? 2 ATOM 1679 C CA . PRO A 1 231 ? 24.046 -36.092 -49.883 1.000 59.710 0 237 PRO AAA CA 1 ? 2 ATOM 1680 C C . PRO A 1 231 ? 25.449 -36.511 -50.308 1.000 61.256 0 237 PRO AAA C 1 ? 2 ATOM 1681 O O . PRO A 1 231 ? 25.970 -37.508 -49.816 1.000 65.887 0 237 PRO AAA O 1 ? 2 ATOM 1682 C CB . PRO A 1 231 ? 24.085 -35.293 -48.571 1.000 60.185 0 237 PRO AAA CB 1 ? 2 ATOM 1683 C CG . PRO A 1 231 ? 23.013 -35.917 -47.689 1.000 59.847 0 237 PRO AAA CG 1 ? 2 ATOM 1684 C CD . PRO A 1 231 ? 22.915 -37.358 -48.140 1.000 60.948 0 237 PRO AAA CD 1 ? 2 ATOM 1685 N N . PRO A 1 232 ? 26.108 -35.766 -51.222 1.000 61.760 0 238 PRO AAA N 1 ? 2 ATOM 1686 C CA . PRO A 1 232 ? 27.368 -36.215 -51.815 1.000 64.334 0 238 PRO AAA CA 1 ? 2 ATOM 1687 C C . PRO A 1 232 ? 28.510 -36.421 -50.811 1.000 68.512 0 238 PRO AAA C 1 ? 2 ATOM 1688 O O . PRO A 1 232 ? 29.254 -37.366 -50.988 1.000 70.006 0 238 PRO AAA O 1 ? 2 ATOM 1689 C CB . PRO A 1 232 ? 27.734 -35.105 -52.813 1.000 64.577 0 238 PRO AAA CB 1 ? 2 ATOM 1690 C CG . PRO A 1 232 ? 26.926 -33.896 -52.370 1.000 63.340 0 238 PRO AAA CG 1 ? 2 ATOM 1691 C CD . PRO A 1 232 ? 25.675 -34.458 -51.733 1.000 61.796 0 238 PRO AAA CD 1 ? 2 ATOM 1692 N N . PHE A 1 233 ? 28.612 -35.560 -49.792 1.000 72.051 0 239 PHE AAA N 1 ? 2 ATOM 1693 C CA . PHE A 1 233 ? 29.774 -35.485 -48.865 1.000 74.967 0 239 PHE AAA CA 1 ? 2 ATOM 1694 C C . PHE A 1 233 ? 29.575 -36.369 -47.628 1.000 77.266 0 239 PHE AAA C 1 ? 2 ATOM 1695 O O . PHE A 1 233 ? 30.577 -36.582 -46.918 1.000 77.911 0 239 PHE AAA O 1 ? 2 ATOM 1696 C CB . PHE A 1 233 ? 30.050 -34.035 -48.465 1.000 73.331 0 239 PHE AAA CB 1 ? 2 ATOM 1697 C CG . PHE A 1 233 ? 30.348 -33.137 -49.637 1.000 75.073 0 239 PHE AAA CG 1 ? 2 ATOM 1698 C CD1 . PHE A 1 233 ? 31.481 -33.342 -50.411 1.000 74.500 0 239 PHE AAA CD1 1 ? 2 ATOM 1699 C CD2 . PHE A 1 233 ? 29.489 -32.103 -49.982 1.000 73.645 0 239 PHE AAA CD2 1 ? 2 ATOM 1700 C CE1 . PHE A 1 233 ? 31.760 -32.520 -51.489 1.000 72.296 0 239 PHE AAA CE1 1 ? 2 ATOM 1701 C CE2 . PHE A 1 233 ? 29.769 -31.283 -51.064 1.000 70.972 0 239 PHE AAA CE2 1 ? 2 ATOM 1702 C CZ . PHE A 1 233 ? 30.905 -31.493 -51.813 1.000 71.434 0 239 PHE AAA CZ 1 ? 2 ATOM 1703 N N . GLU A 1 234 ? 28.360 -36.873 -47.379 1.000 83.059 0 240 GLU AAA N 1 ? 2 ATOM 1704 C CA . GLU A 1 234 ? 28.037 -37.663 -46.153 1.000 96.593 0 240 GLU AAA CA 1 ? 2 ATOM 1705 C C . GLU A 1 234 ? 28.933 -38.910 -46.115 1.000 101.238 0 240 GLU AAA C 1 ? 2 ATOM 1706 O O . GLU A 1 234 ? 29.318 -39.398 -47.194 1.000 99.923 0 240 GLU AAA O 1 ? 2 ATOM 1707 C CB . GLU A 1 234 ? 26.546 -38.028 -46.078 1.000 100.293 0 240 GLU AAA CB 1 ? 2 ATOM 1708 C CG . GLU A 1 234 ? 26.159 -39.280 -46.858 1.000 95.619 0 240 GLU AAA CG 1 ? 2 ATOM 1709 C CD . GLU A 1 234 ? 24.953 -40.048 -46.337 1.000 90.269 0 240 GLU AAA CD 1 ? 2 ATOM 1710 O OE1 . GLU A 1 234 ? 24.997 -41.294 -46.357 1.000 84.978 0 240 GLU AAA OE1 1 ? 2 ATOM 1711 O OE2 . GLU A 1 234 ? 23.958 -39.404 -45.947 1.000 89.105 0 240 GLU AAA OE2 1 ? 2 ATOM 1712 N N . SER A 1 235 ? 29.259 -39.392 -44.912 1.000 105.373 0 241 SER AAA N 1 ? 2 ATOM 1713 C CA . SER A 1 235 ? 30.089 -40.604 -44.674 1.000 106.008 0 241 SER AAA CA 1 ? 2 ATOM 1714 C C . SER A 1 235 ? 29.679 -41.250 -43.344 1.000 100.575 0 241 SER AAA C 1 ? 2 ATOM 1715 O O . SER A 1 235 ? 28.515 -41.069 -42.946 1.000 101.666 0 241 SER AAA O 1 ? 2 ATOM 1716 C CB . SER A 1 235 ? 31.552 -40.254 -44.718 1.000 106.568 0 241 SER AAA CB 1 ? 2 ATOM 1717 O OG . SER A 1 235 ? 31.938 -39.563 -43.542 1.000 108.994 0 241 SER AAA OG 1 ? 2 ATOM 1718 N N . ALA A 1 236 ? 30.579 -41.995 -42.697 1.000 102.041 0 242 ALA AAA N 1 ? 2 ATOM 1719 C CA . ALA A 1 236 ? 30.393 -42.553 -41.334 1.000 105.346 0 242 ALA AAA CA 1 ? 2 ATOM 1720 C C . ALA A 1 236 ? 31.137 -41.695 -40.302 1.000 103.273 0 242 ALA AAA C 1 ? 2 ATOM 1721 O O . ALA A 1 236 ? 30.647 -41.586 -39.165 1.000 106.588 0 242 ALA AAA O 1 ? 2 ATOM 1722 C CB . ALA A 1 236 ? 30.860 -43.986 -41.288 1.000 108.925 0 242 ALA AAA CB 1 ? 2 ATOM 1723 N N . SER A 1 237 ? 32.285 -41.128 -40.685 1.000 102.294 0 243 SER AAA N 1 ? 2 ATOM 1724 C CA . SER A 1 237 ? 33.126 -40.234 -39.850 1.000 104.242 0 243 SER AAA CA 1 ? 2 ATOM 1725 C C . SER A 1 237 ? 32.737 -38.773 -40.112 1.000 103.511 0 243 SER AAA C 1 ? 2 ATOM 1726 O O . SER A 1 237 ? 32.373 -38.451 -41.258 1.000 103.844 0 243 SER AAA O 1 ? 2 ATOM 1727 C CB . SER A 1 237 ? 34.588 -40.489 -40.117 1.000 108.211 0 243 SER AAA CB 1 ? 2 ATOM 1728 O OG . SER A 1 237 ? 35.410 -39.595 -39.381 1.000 116.849 0 243 SER AAA OG 1 ? 2 ATOM 1729 N N . HIS A 1 238 ? 32.797 -37.929 -39.079 1.000 105.798 0 244 HIS AAA N 1 ? 2 ATOM 1730 C CA . HIS A 1 238 ? 32.501 -36.473 -39.152 1.000 101.780 0 244 HIS AAA CA 1 ? 2 ATOM 1731 C C . HIS A 1 238 ? 33.714 -35.748 -39.736 1.000 95.855 0 244 HIS AAA C 1 ? 2 ATOM 1732 O O . HIS A 1 238 ? 33.516 -34.858 -40.582 1.000 90.219 0 244 HIS AAA O 1 ? 2 ATOM 1733 C CB . HIS A 1 238 ? 32.102 -35.940 -37.770 1.000 105.095 0 244 HIS AAA CB 1 ? 2 ATOM 1734 C CG . HIS A 1 238 ? 30.880 -36.603 -37.239 1.000 108.666 0 244 HIS AAA CG 1 ? 2 ATOM 1735 N ND1 . HIS A 1 238 ? 29.737 -36.752 -38.001 1.000 108.461 0 244 HIS AAA ND1 1 ? 2 ATOM 1736 C CD2 . HIS A 1 238 ? 30.622 -37.181 -36.049 1.000 113.595 0 244 HIS AAA CD2 1 ? 2 ATOM 1737 C CE1 . HIS A 1 238 ? 28.821 -37.380 -37.296 1.000 106.721 0 244 HIS AAA CE1 1 ? 2 ATOM 1738 N NE2 . HIS A 1 238 ? 29.338 -37.654 -36.097 1.000 111.573 0 244 HIS AAA NE2 1 ? 2 ATOM 1739 N N . SER A 1 239 ? 34.913 -36.131 -39.285 1.000 97.974 0 245 SER AAA N 1 ? 2 ATOM 1740 C CA . SER A 1 239 ? 36.223 -35.652 -39.795 1.000 99.518 0 245 SER AAA CA 1 ? 2 ATOM 1741 C C . SER A 1 239 ? 36.330 -35.939 -41.299 1.000 99.147 0 245 SER AAA C 1 ? 2 ATOM 1742 O O . SER A 1 239 ? 36.910 -35.096 -42.013 1.000 99.397 0 245 SER AAA O 1 ? 2 ATOM 1743 C CB . SER A 1 239 ? 37.364 -36.277 -39.029 1.000 101.901 0 245 SER AAA CB 1 ? 2 ATOM 1744 O OG . SER A 1 239 ? 38.602 -36.033 -39.681 1.000 103.594 0 245 SER AAA OG 1 ? 2 ATOM 1745 N N . GLU A 1 240 ? 35.796 -37.083 -41.750 1.000 97.020 0 246 GLU AAA N 1 ? 2 ATOM 1746 C CA . GLU A 1 240 ? 35.760 -37.499 -43.181 1.000 92.208 0 246 GLU AAA CA 1 ? 2 ATOM 1747 C C . GLU A 1 240 ? 34.873 -36.518 -43.956 1.000 87.255 0 246 GLU AAA C 1 ? 2 ATOM 1748 O O . GLU A 1 240 ? 35.409 -35.840 -44.852 1.000 86.489 0 246 GLU AAA O 1 ? 2 ATOM 1749 C CB . GLU A 1 240 ? 35.267 -38.941 -43.320 1.000 92.523 0 246 GLU AAA CB 1 ? 2 ATOM 1750 C CG . GLU A 1 240 ? 35.147 -39.424 -44.761 1.000 92.648 0 246 GLU AAA CG 1 ? 2 ATOM 1751 C CD . GLU A 1 240 ? 36.431 -39.942 -45.392 1.000 93.684 0 246 GLU AAA CD 1 ? 2 ATOM 1752 O OE1 . GLU A 1 240 ? 37.105 -40.780 -44.748 1.000 98.696 0 246 GLU AAA OE1 1 ? 2 ATOM 1753 O OE2 . GLU A 1 240 ? 36.752 -39.515 -46.525 1.000 89.583 0 246 GLU AAA OE2 1 ? 2 ATOM 1754 N N . THR A 1 241 ? 33.582 -36.429 -43.606 1.000 83.188 0 247 THR AAA N 1 ? 2 ATOM 1755 C CA . THR A 1 241 ? 32.594 -35.495 -44.221 1.000 78.043 0 247 THR AAA CA 1 ? 2 ATOM 1756 C C . THR A 1 241 ? 33.211 -34.089 -44.289 1.000 76.910 0 247 THR AAA C 1 ? 2 ATOM 1757 O O . THR A 1 241 ? 33.034 -33.413 -45.307 1.000 71.547 0 247 THR AAA O 1 ? 2 ATOM 1758 C CB . THR A 1 241 ? 31.256 -35.515 -43.467 1.000 74.766 0 247 THR AAA CB 1 ? 2 ATOM 1759 O OG1 . THR A 1 241 ? 30.686 -36.821 -43.546 1.000 73.141 0 247 THR AAA OG1 1 ? 2 ATOM 1760 C CG2 . THR A 1 241 ? 30.247 -34.536 -44.024 1.000 72.963 0 247 THR AAA CG2 1 ? 2 ATOM 1761 N N . TYR A 1 242 ? 33.931 -33.690 -43.240 1.000 84.870 0 248 TYR AAA N 1 ? 2 ATOM 1762 C CA . TYR A 1 242 ? 34.619 -32.378 -43.109 1.000 90.096 0 248 TYR AAA CA 1 ? 2 ATOM 1763 C C . TYR A 1 242 ? 35.695 -32.241 -44.199 1.000 87.822 0 248 TYR AAA C 1 ? 2 ATOM 1764 O O . TYR A 1 242 ? 35.730 -31.194 -44.876 1.000 84.670 0 248 TYR AAA O 1 ? 2 ATOM 1765 C CB . TYR A 1 242 ? 35.171 -32.248 -41.685 1.000 95.794 0 248 TYR AAA CB 1 ? 2 ATOM 1766 C CG . TYR A 1 242 ? 35.635 -30.871 -41.291 1.000 101.030 0 248 TYR AAA CG 1 ? 2 ATOM 1767 C CD1 . TYR A 1 242 ? 34.746 -29.924 -40.811 1.000 100.056 0 248 TYR AAA CD1 1 ? 2 ATOM 1768 C CD2 . TYR A 1 242 ? 36.974 -30.523 -41.381 1.000 111.829 0 248 TYR AAA CD2 1 ? 2 ATOM 1769 C CE1 . TYR A 1 242 ? 35.176 -28.660 -40.438 1.000 107.520 0 248 TYR AAA CE1 1 ? 2 ATOM 1770 C CE2 . TYR A 1 242 ? 37.422 -29.266 -41.011 1.000 115.810 0 248 TYR AAA CE2 1 ? 2 ATOM 1771 C CZ . TYR A 1 242 ? 36.518 -28.330 -40.539 1.000 116.072 0 248 TYR AAA CZ 1 ? 2 ATOM 1772 O OH . TYR A 1 242 ? 36.964 -27.092 -40.177 1.000 122.196 0 248 TYR AAA OH 1 ? 2 ATOM 1773 N N . ARG A 1 243 ? 36.533 -33.270 -44.374 1.000 89.385 0 249 ARG AAA N 1 ? 2 ATOM 1774 C CA . ARG A 1 243 ? 37.657 -33.302 -45.353 1.000 93.763 0 249 ARG AAA CA 1 ? 2 ATOM 1775 C C . ARG A 1 243 ? 37.103 -33.231 -46.785 1.000 88.488 0 249 ARG AAA C 1 ? 2 ATOM 1776 O O . ARG A 1 243 ? 37.603 -32.401 -47.562 1.000 86.796 0 249 ARG AAA O 1 ? 2 ATOM 1777 C CB . ARG A 1 243 ? 38.508 -34.561 -45.137 1.000 100.685 0 249 ARG AAA CB 1 ? 2 ATOM 1778 C CG . ARG A 1 243 ? 39.747 -34.656 -46.019 1.000 108.096 0 249 ARG AAA CG 1 ? 2 ATOM 1779 C CD . ARG A 1 243 ? 40.312 -36.066 -46.082 1.000 114.931 0 249 ARG AAA CD 1 ? 2 ATOM 1780 N NE . ARG A 1 243 ? 39.323 -37.022 -46.569 1.000 118.644 0 249 ARG AAA NE 1 ? 2 ATOM 1781 C CZ . ARG A 1 243 ? 39.072 -37.294 -47.850 1.000 118.899 0 249 ARG AAA CZ 1 ? 2 ATOM 1782 N NH1 . ARG A 1 243 ? 39.745 -36.686 -48.815 1.000 124.639 0 249 ARG AAA NH1 1 ? 2 ATOM 1783 N NH2 . ARG A 1 243 ? 38.137 -38.177 -48.163 1.000 114.362 0 249 ARG AAA NH2 1 ? 2 ATOM 1784 N N . ARG A 1 244 ? 36.104 -34.062 -47.104 1.000 85.910 0 250 ARG AAA N 1 ? 2 ATOM 1785 C CA . ARG A 1 244 ? 35.494 -34.202 -48.458 1.000 83.170 0 250 ARG AAA CA 1 ? 2 ATOM 1786 C C . ARG A 1 244 ? 34.891 -32.865 -48.911 1.000 79.189 0 250 ARG AAA C 1 ? 2 ATOM 1787 O O . ARG A 1 244 ? 34.983 -32.564 -50.127 1.000 77.362 0 250 ARG AAA O 1 ? 2 ATOM 1788 C CB . ARG A 1 244 ? 34.425 -35.303 -48.474 1.000 83.372 0 250 ARG AAA CB 1 ? 2 ATOM 1789 C CG . ARG A 1 244 ? 34.969 -36.704 -48.227 1.000 88.918 0 250 ARG AAA CG 1 ? 2 ATOM 1790 C CD . ARG A 1 244 ? 34.008 -37.805 -48.633 1.000 90.877 0 250 ARG AAA CD 1 ? 2 ATOM 1791 N NE . ARG A 1 244 ? 33.890 -37.880 -50.082 1.000 96.738 0 250 ARG AAA NE 1 ? 2 ATOM 1792 C CZ . ARG A 1 244 ? 32.902 -38.480 -50.743 1.000 101.373 0 250 ARG AAA CZ 1 ? 2 ATOM 1793 N NH1 . ARG A 1 244 ? 31.920 -39.082 -50.092 1.000 102.957 0 250 ARG AAA NH1 1 ? 2 ATOM 1794 N NH2 . ARG A 1 244 ? 32.893 -38.472 -52.065 1.000 103.103 0 250 ARG AAA NH2 1 ? 2 ATOM 1795 N N . ILE A 1 245 ? 34.288 -32.099 -47.992 1.000 73.844 0 251 ILE AAA N 1 ? 2 ATOM 1796 C CA . ILE A 1 245 ? 33.656 -30.785 -48.318 1.000 72.274 0 251 ILE AAA CA 1 ? 2 ATOM 1797 C C . ILE A 1 245 ? 34.755 -29.803 -48.741 1.000 75.180 0 251 ILE AAA C 1 ? 2 ATOM 1798 O O . ILE A 1 245 ? 34.651 -29.235 -49.842 1.000 76.696 0 251 ILE AAA O 1 ? 2 ATOM 1799 C CB . ILE A 1 245 ? 32.811 -30.248 -47.147 1.000 70.540 0 251 ILE AAA CB 1 ? 2 ATOM 1800 C CG1 . ILE A 1 245 ? 31.562 -31.100 -46.918 1.000 70.420 0 251 ILE AAA CG1 1 ? 2 ATOM 1801 C CG2 . ILE A 1 245 ? 32.440 -28.789 -47.364 1.000 70.413 0 251 ILE AAA CG2 1 ? 2 ATOM 1802 C CD1 . ILE A 1 245 ? 30.987 -30.968 -45.520 1.000 70.129 0 251 ILE AAA CD1 1 ? 2 ATOM 1803 N N . LEU A 1 246 ? 35.783 -29.635 -47.911 1.000 78.156 0 252 LEU AAA N 1 ? 2 ATOM 1804 C CA . LEU A 1 246 ? 36.849 -28.616 -48.107 1.000 81.966 0 252 LEU AAA CA 1 ? 2 ATOM 1805 C C . LEU A 1 246 ? 37.696 -28.949 -49.343 1.000 83.622 0 252 LEU AAA C 1 ? 2 ATOM 1806 O O . LEU A 1 246 ? 38.212 -28.001 -49.959 1.000 84.105 0 252 LEU AAA O 1 ? 2 ATOM 1807 C CB . LEU A 1 246 ? 37.700 -28.538 -46.835 1.000 83.898 0 252 LEU AAA CB 1 ? 2 ATOM 1808 C CG . LEU A 1 246 ? 36.968 -28.034 -45.591 1.000 82.687 0 252 LEU AAA CG 1 ? 2 ATOM 1809 C CD1 . LEU A 1 246 ? 37.940 -27.854 -44.436 1.000 87.275 0 252 LEU AAA CD1 1 ? 2 ATOM 1810 C CD2 . LEU A 1 246 ? 36.227 -26.732 -45.866 1.000 80.849 0 252 LEU AAA CD2 1 ? 2 ATOM 1811 N N . LYS A 1 247 ? 37.824 -30.232 -49.702 1.000 84.765 0 253 LYS AAA N 1 ? 2 ATOM 1812 C CA . LYS A 1 247 ? 38.557 -30.692 -50.916 1.000 88.237 0 253 LYS AAA CA 1 ? 2 ATOM 1813 C C . LYS A 1 247 ? 37.573 -30.825 -52.089 1.000 85.158 0 253 LYS AAA C 1 ? 2 ATOM 1814 O O . LYS A 1 247 ? 38.030 -31.209 -53.184 1.000 82.684 0 253 LYS AAA O 1 ? 2 ATOM 1815 C CB . LYS A 1 247 ? 39.265 -32.026 -50.649 1.000 92.307 0 253 LYS AAA CB 1 ? 2 ATOM 1816 C CG . LYS A 1 247 ? 40.255 -32.038 -49.490 1.000 97.655 0 253 LYS AAA CG 1 ? 2 ATOM 1817 C CD . LYS A 1 247 ? 41.714 -32.054 -49.912 1.000 104.467 0 253 LYS AAA CD 1 ? 2 ATOM 1818 C CE . LYS A 1 247 ? 42.197 -30.725 -50.456 1.000 108.806 0 253 LYS AAA CE 1 ? 2 ATOM 1819 N NZ . LYS A 1 247 ? 42.290 -29.690 -49.397 1.000 110.057 0 253 LYS AAA NZ 1 ? 2 ATOM 1820 N N . VAL A 1 248 ? 36.292 -30.488 -51.860 1.000 83.196 0 254 VAL AAA N 1 ? 2 ATOM 1821 C CA . VAL A 1 248 ? 35.117 -30.693 -52.766 1.000 81.460 0 254 VAL AAA CA 1 ? 2 ATOM 1822 C C . VAL A 1 248 ? 35.215 -32.069 -53.443 1.000 84.143 0 254 VAL AAA C 1 ? 2 ATOM 1823 O O . VAL A 1 248 ? 34.984 -32.142 -54.666 1.000 86.556 0 254 VAL AAA O 1 ? 2 ATOM 1824 C CB . VAL A 1 248 ? 34.953 -29.554 -53.797 1.000 81.453 0 254 VAL AAA CB 1 ? 2 ATOM 1825 C CG1 . VAL A 1 248 ? 34.458 -28.274 -53.149 1.000 79.040 0 254 VAL AAA CG1 1 ? 2 ATOM 1826 C CG2 . VAL A 1 248 ? 36.222 -29.281 -54.593 1.000 89.749 0 254 VAL AAA CG2 1 ? 2 ATOM 1827 N N . ASP A 1 249 ? 35.490 -33.119 -52.658 1.000 84.328 0 255 ASP AAA N 1 ? 2 ATOM 1828 C CA . ASP A 1 249 ? 35.681 -34.526 -53.113 1.000 84.173 0 255 ASP AAA CA 1 ? 2 ATOM 1829 C C . ASP A 1 249 ? 34.313 -35.143 -53.447 1.000 81.235 0 255 ASP AAA C 1 ? 2 ATOM 1830 O O . ASP A 1 249 ? 33.857 -36.028 -52.705 1.000 86.844 0 255 ASP AAA O 1 ? 2 ATOM 1831 C CB . ASP A 1 249 ? 36.460 -35.311 -52.048 1.000 87.587 0 255 ASP AAA CB 1 ? 2 ATOM 1832 C CG . ASP A 1 249 ? 36.849 -36.737 -52.411 1.000 88.403 0 255 ASP AAA CG 1 ? 2 ATOM 1833 O OD1 . ASP A 1 249 ? 36.429 -37.215 -53.482 1.000 86.057 0 255 ASP AAA OD1 1 ? 2 ATOM 1834 O OD2 . ASP A 1 249 ? 37.575 -37.359 -51.605 1.000 89.556 0 255 ASP AAA OD2 1 ? 2 ATOM 1835 N N . VAL A 1 250 ? 33.693 -34.697 -54.542 1.000 78.918 0 256 VAL AAA N 1 ? 2 ATOM 1836 C CA . VAL A 1 250 ? 32.395 -35.216 -55.064 1.000 78.691 0 256 VAL AAA CA 1 ? 2 ATOM 1837 C C . VAL A 1 250 ? 32.687 -36.487 -55.868 1.000 82.889 0 256 VAL AAA C 1 ? 2 ATOM 1838 O O . VAL A 1 250 ? 33.604 -36.444 -56.714 1.000 81.772 0 256 VAL AAA O 1 ? 2 ATOM 1839 C CB . VAL A 1 250 ? 31.681 -34.160 -55.932 1.000 79.050 0 256 VAL AAA CB 1 ? 2 ATOM 1840 C CG1 . VAL A 1 250 ? 30.319 -34.650 -56.398 1.000 78.041 0 256 VAL AAA CG1 1 ? 2 ATOM 1841 C CG2 . VAL A 1 250 ? 31.553 -32.819 -55.217 1.000 77.909 0 256 VAL AAA CG2 1 ? 2 ATOM 1842 N N . ARG A 1 251 ? 31.949 -37.571 -55.607 1.000 87.536 0 257 ARG AAA N 1 ? 2 ATOM 1843 C CA . ARG A 1 251 ? 32.114 -38.878 -56.303 1.000 95.602 0 257 ARG AAA CA 1 ? 2 ATOM 1844 C C . ARG A 1 251 ? 30.759 -39.343 -56.842 1.000 96.904 0 257 ARG AAA C 1 ? 2 ATOM 1845 O O . ARG A 1 251 ? 29.900 -39.720 -56.018 1.000 100.163 0 257 ARG AAA O 1 ? 2 ATOM 1846 C CB . ARG A 1 251 ? 32.703 -39.926 -55.355 1.000 102.573 0 257 ARG AAA CB 1 ? 2 ATOM 1847 C CG . ARG A 1 251 ? 34.153 -39.669 -54.971 1.000 109.333 0 257 ARG AAA CG 1 ? 2 ATOM 1848 C CD . ARG A 1 251 ? 34.734 -40.798 -54.141 1.000 113.891 0 257 ARG AAA CD 1 ? 2 ATOM 1849 N NE . ARG A 1 251 ? 35.563 -40.299 -53.050 1.000 119.284 0 257 ARG AAA NE 1 ? 2 ATOM 1850 C CZ . ARG A 1 251 ? 35.670 -40.856 -51.843 1.000 123.710 0 257 ARG AAA CZ 1 ? 2 ATOM 1851 N NH1 . ARG A 1 251 ? 34.989 -41.948 -51.536 1.000 128.681 0 257 ARG AAA NH1 1 ? 2 ATOM 1852 N NH2 . ARG A 1 251 ? 36.457 -40.306 -50.935 1.000 124.082 0 257 ARG AAA NH2 1 ? 2 ATOM 1853 N N . PHE A 1 252 ? 30.597 -39.318 -58.171 1.000 94.396 0 258 PHE AAA N 1 ? 2 ATOM 1854 C CA . PHE A 1 252 ? 29.326 -39.583 -58.899 1.000 87.318 0 258 PHE AAA CA 1 ? 2 ATOM 1855 C C . PHE A 1 252 ? 29.225 -41.064 -59.252 1.000 86.020 0 258 PHE AAA C 1 ? 2 ATOM 1856 O O . PHE A 1 252 ? 30.185 -41.640 -59.760 1.000 89.398 0 258 PHE AAA O 1 ? 2 ATOM 1857 C CB . PHE A 1 252 ? 29.250 -38.745 -60.178 1.000 85.251 0 258 PHE AAA CB 1 ? 2 ATOM 1858 C CG . PHE A 1 252 ? 29.423 -37.259 -59.980 1.000 82.144 0 258 PHE AAA CG 1 ? 2 ATOM 1859 C CD1 . PHE A 1 252 ? 28.338 -36.454 -59.665 1.000 76.335 0 258 PHE AAA CD1 1 ? 2 ATOM 1860 C CD2 . PHE A 1 252 ? 30.668 -36.661 -60.115 1.000 82.742 0 258 PHE AAA CD2 1 ? 2 ATOM 1861 C CE1 . PHE A 1 252 ? 28.498 -35.088 -59.490 1.000 74.832 0 258 PHE AAA CE1 1 ? 2 ATOM 1862 C CE2 . PHE A 1 252 ? 30.825 -35.294 -59.940 1.000 79.461 0 258 PHE AAA CE2 1 ? 2 ATOM 1863 C CZ . PHE A 1 252 ? 29.740 -34.509 -59.632 1.000 74.944 0 258 PHE AAA CZ 1 ? 2 ATOM 1864 N N . PRO A 1 253 ? 28.066 -41.725 -59.017 1.000 83.686 0 259 PRO AAA N 1 ? 2 ATOM 1865 C CA . PRO A 1 253 ? 27.891 -43.118 -59.419 1.000 87.056 0 259 PRO AAA CA 1 ? 2 ATOM 1866 C C . PRO A 1 253 ? 27.815 -43.172 -60.949 1.000 92.749 0 259 PRO AAA C 1 ? 2 ATOM 1867 O O . PRO A 1 253 ? 27.220 -42.287 -61.531 1.000 92.934 0 259 PRO AAA O 1 ? 2 ATOM 1868 C CB . PRO A 1 253 ? 26.582 -43.549 -58.745 1.000 83.285 0 259 PRO AAA CB 1 ? 2 ATOM 1869 C CG . PRO A 1 253 ? 25.811 -42.256 -58.571 1.000 80.506 0 259 PRO AAA CG 1 ? 2 ATOM 1870 C CD . PRO A 1 253 ? 26.856 -41.172 -58.386 1.000 81.736 0 259 PRO AAA CD 1 ? 2 ATOM 1871 N N . LEU A 1 254 ? 28.424 -44.192 -61.556 1.000 97.287 0 260 LEU AAA N 1 ? 2 ATOM 1872 C CA . LEU A 1 254 ? 28.592 -44.280 -63.029 1.000 102.452 0 260 LEU AAA CA 1 ? 2 ATOM 1873 C C . LEU A 1 254 ? 27.215 -44.310 -63.705 1.000 101.086 0 260 LEU AAA C 1 ? 2 ATOM 1874 O O . LEU A 1 254 ? 27.154 -43.980 -64.891 1.000 102.624 0 260 LEU AAA O 1 ? 2 ATOM 1875 C CB . LEU A 1 254 ? 29.442 -45.509 -63.370 1.000 110.385 0 260 LEU AAA CB 1 ? 2 ATOM 1876 C CG . LEU A 1 254 ? 30.958 -45.329 -63.243 1.000 114.865 0 260 LEU AAA CG 1 ? 2 ATOM 1877 C CD1 . LEU A 1 254 ? 31.463 -44.258 -64.200 1.000 111.636 0 260 LEU AAA CD1 1 ? 2 ATOM 1878 C CD2 . LEU A 1 254 ? 31.377 -45.008 -61.809 1.000 116.663 0 260 LEU AAA CD2 1 ? 2 ATOM 1879 N N . SER A 1 255 ? 26.151 -44.650 -62.975 1.000 101.172 0 261 SER AAA N 1 ? 2 ATOM 1880 C CA . SER A 1 255 ? 24.748 -44.609 -63.472 1.000 99.559 0 261 SER AAA CA 1 ? 2 ATOM 1881 C C . SER A 1 255 ? 24.249 -43.161 -63.606 1.000 97.018 0 261 SER AAA C 1 ? 2 ATOM 1882 O O . SER A 1 255 ? 23.184 -42.972 -64.226 1.000 93.540 0 261 SER AAA O 1 ? 2 ATOM 1883 C CB . SER A 1 255 ? 23.830 -45.416 -62.591 1.000 99.711 0 261 SER AAA CB 1 ? 2 ATOM 1884 O OG . SER A 1 255 ? 23.864 -44.939 -61.255 1.000 99.546 0 261 SER AAA OG 1 ? 2 ATOM 1885 N N . MET A 1 256 ? 24.978 -42.181 -63.055 1.000 98.843 0 262 MET AAA N 1 ? 2 ATOM 1886 C CA . MET A 1 256 ? 24.596 -40.737 -63.046 1.000 95.486 0 262 MET AAA CA 1 ? 2 ATOM 1887 C C . MET A 1 256 ? 24.529 -40.211 -64.482 1.000 87.272 0 262 MET AAA C 1 ? 2 ATOM 1888 O O . MET A 1 256 ? 25.461 -40.396 -65.259 1.000 83.217 0 262 MET AAA O 1 ? 2 ATOM 1889 C CB . MET A 1 256 ? 25.604 -39.899 -62.245 1.000 97.812 0 262 MET AAA CB 1 ? 2 ATOM 1890 C CG . MET A 1 256 ? 25.348 -38.387 -62.280 1.000 97.491 0 262 MET AAA CG 1 ? 2 ATOM 1891 S SD . MET A 1 256 ? 24.869 -37.637 -60.699 1.000 104.581 0 262 MET AAA SD 1 ? 2 ATOM 1892 C CE . MET A 1 256 ? 23.416 -38.608 -60.299 1.000 104.512 0 262 MET AAA CE 1 ? 2 ATOM 1893 N N . PRO A 1 257 ? 23.415 -39.552 -64.878 1.000 81.243 0 263 PRO AAA N 1 ? 2 ATOM 1894 C CA . PRO A 1 257 ? 23.359 -38.793 -66.130 1.000 80.162 0 263 PRO AAA CA 1 ? 2 ATOM 1895 C C . PRO A 1 257 ? 24.428 -37.694 -66.247 1.000 78.394 0 263 PRO AAA C 1 ? 2 ATOM 1896 O O . PRO A 1 257 ? 24.625 -36.971 -65.288 1.000 75.304 0 263 PRO AAA O 1 ? 2 ATOM 1897 C CB . PRO A 1 257 ? 21.964 -38.158 -66.096 1.000 77.933 0 263 PRO AAA CB 1 ? 2 ATOM 1898 C CG . PRO A 1 257 ? 21.158 -39.111 -65.247 1.000 79.918 0 263 PRO AAA CG 1 ? 2 ATOM 1899 C CD . PRO A 1 257 ? 22.122 -39.571 -64.176 1.000 81.292 0 263 PRO AAA CD 1 ? 2 ATOM 1900 N N . LEU A 1 258 ? 25.053 -37.582 -67.427 1.000 79.740 0 264 LEU AAA N 1 ? 2 ATOM 1901 C CA . LEU A 1 258 ? 26.215 -36.693 -67.700 1.000 78.397 0 264 LEU AAA CA 1 ? 2 ATOM 1902 C C . LEU A 1 258 ? 25.808 -35.227 -67.513 1.000 75.236 0 264 LEU AAA C 1 ? 2 ATOM 1903 O O . LEU A 1 258 ? 26.529 -34.502 -66.799 1.000 74.194 0 264 LEU AAA O 1 ? 2 ATOM 1904 C CB . LEU A 1 258 ? 26.726 -36.949 -69.119 1.000 82.409 0 264 LEU AAA CB 1 ? 2 ATOM 1905 C CG . LEU A 1 258 ? 28.130 -36.417 -69.400 1.000 87.789 0 264 LEU AAA CG 1 ? 2 ATOM 1906 C CD1 . LEU A 1 258 ? 29.182 -37.298 -68.739 1.000 91.171 0 264 LEU AAA CD1 1 ? 2 ATOM 1907 C CD2 . LEU A 1 258 ? 28.385 -36.301 -70.896 1.000 89.708 0 264 LEU AAA CD2 1 ? 2 ATOM 1908 N N . GLY A 1 259 ? 24.692 -34.811 -68.120 1.000 74.690 0 265 GLY AAA N 1 ? 2 ATOM 1909 C CA . GLY A 1 259 ? 24.121 -33.458 -67.955 1.000 73.352 0 265 GLY AAA CA 1 ? 2 ATOM 1910 C C . GLY A 1 259 ? 24.084 -33.017 -66.496 1.000 70.508 0 265 GLY AAA C 1 ? 2 ATOM 1911 O O . GLY A 1 259 ? 24.510 -31.885 -66.225 1.000 69.829 0 265 GLY AAA O 1 ? 2 ATOM 1912 N N . ALA A 1 260 ? 23.604 -33.879 -65.588 1.000 68.862 0 266 ALA AAA N 1 ? 2 ATOM 1913 C CA . ALA A 1 260 ? 23.463 -33.606 -64.134 1.000 68.031 0 266 ALA AAA CA 1 ? 2 ATOM 1914 C C . ALA A 1 260 ? 24.843 -33.477 -63.477 1.000 67.898 0 266 ALA AAA C 1 ? 2 ATOM 1915 O O . ALA A 1 260 ? 25.074 -32.460 -62.792 1.000 63.474 0 266 ALA AAA O 1 ? 2 ATOM 1916 C CB . ALA A 1 260 ? 22.648 -34.687 -63.464 1.000 66.669 0 266 ALA AAA CB 1 ? 2 ATOM 1917 N N . ARG A 1 261 ? 25.716 -34.472 -63.672 1.000 70.705 0 267 ARG AAA N 1 ? 2 ATOM 1918 C CA . ARG A 1 261 ? 27.124 -34.461 -63.187 1.000 74.002 0 267 ARG AAA CA 1 ? 2 ATOM 1919 C C . ARG A 1 261 ? 27.756 -33.100 -63.512 1.000 73.443 0 267 ARG AAA C 1 ? 2 ATOM 1920 O O . ARG A 1 261 ? 28.436 -32.540 -62.633 1.000 74.571 0 267 ARG AAA O 1 ? 2 ATOM 1921 C CB . ARG A 1 261 ? 27.931 -35.605 -63.813 1.000 79.883 0 267 ARG AAA CB 1 ? 2 ATOM 1922 C CG . ARG A 1 261 ? 29.415 -35.600 -63.465 1.000 87.092 0 267 ARG AAA CG 1 ? 2 ATOM 1923 C CD . ARG A 1 261 ? 30.286 -36.338 -64.468 1.000 98.099 0 267 ARG AAA CD 1 ? 2 ATOM 1924 N NE . ARG A 1 261 ? 29.960 -37.759 -64.533 1.000 105.274 0 267 ARG AAA NE 1 ? 2 ATOM 1925 C CZ . ARG A 1 261 ? 30.611 -38.737 -63.902 1.000 105.955 0 267 ARG AAA CZ 1 ? 2 ATOM 1926 N NH1 . ARG A 1 261 ? 30.207 -39.990 -64.045 1.000 105.563 0 267 ARG AAA NH1 1 ? 2 ATOM 1927 N NH2 . ARG A 1 261 ? 31.662 -38.476 -63.142 1.000 104.021 0 267 ARG AAA NH2 1 ? 2 ATOM 1928 N N . ASP A 1 262 ? 27.533 -32.588 -64.727 1.000 72.126 0 268 ASP AAA N 1 ? 2 ATOM 1929 C CA . ASP A 1 262 ? 28.097 -31.299 -65.211 1.000 70.258 0 268 ASP AAA CA 1 ? 2 ATOM 1930 C C . ASP A 1 262 ? 27.607 -30.159 -64.312 1.000 67.939 0 268 ASP AAA C 1 ? 2 ATOM 1931 O O . ASP A 1 262 ? 28.459 -29.420 -63.798 1.000 70.814 0 268 ASP AAA O 1 ? 2 ATOM 1932 C CB . ASP A 1 262 ? 27.735 -31.044 -66.678 1.000 68.563 0 268 ASP AAA CB 1 ? 2 ATOM 1933 C CG . ASP A 1 262 ? 28.467 -29.862 -67.294 1.000 68.265 0 268 ASP AAA CG 1 ? 2 ATOM 1934 O OD1 . ASP A 1 262 ? 27.983 -28.728 -67.137 1.000 65.439 0 268 ASP AAA OD1 1 ? 2 ATOM 1935 O OD2 . ASP A 1 262 ? 29.527 -30.088 -67.916 1.000 70.065 0 268 ASP AAA OD2 1 ? 2 ATOM 1936 N N . LEU A 1 263 ? 26.290 -30.026 -64.142 1.000 65.184 0 269 LEU AAA N 1 ? 2 ATOM 1937 C CA . LEU A 1 263 ? 25.650 -28.915 -63.386 1.000 66.180 0 269 LEU AAA CA 1 ? 2 ATOM 1938 C C . LEU A 1 263 ? 26.190 -28.896 -61.944 1.000 66.963 0 269 LEU AAA C 1 ? 2 ATOM 1939 O O . LEU A 1 263 ? 26.560 -27.803 -61.456 1.000 64.244 0 269 LEU AAA O 1 ? 2 ATOM 1940 C CB . LEU A 1 263 ? 24.127 -29.099 -63.431 1.000 64.600 0 269 LEU AAA CB 1 ? 2 ATOM 1941 C CG . LEU A 1 263 ? 23.298 -28.090 -62.628 1.000 63.955 0 269 LEU AAA CG 1 ? 2 ATOM 1942 C CD1 . LEU A 1 263 ? 23.603 -26.656 -63.047 1.000 64.803 0 269 LEU AAA CD1 1 ? 2 ATOM 1943 C CD2 . LEU A 1 263 ? 21.812 -28.376 -62.772 1.000 62.638 0 269 LEU AAA CD2 1 ? 2 ATOM 1944 N N . ILE A 1 264 ? 26.256 -30.065 -61.297 1.000 68.692 0 270 ILE AAA N 1 ? 2 ATOM 1945 C CA . ILE A 1 264 ? 26.692 -30.231 -59.876 1.000 65.839 0 270 ILE AAA CA 1 ? 2 ATOM 1946 C C . ILE A 1 264 ? 28.181 -29.881 -59.770 1.000 70.799 0 270 ILE AAA C 1 ? 2 ATOM 1947 O O . ILE A 1 264 ? 28.568 -29.282 -58.747 1.000 69.643 0 270 ILE AAA O 1 ? 2 ATOM 1948 C CB . ILE A 1 264 ? 26.377 -31.659 -59.385 1.000 60.918 0 270 ILE AAA CB 1 ? 2 ATOM 1949 C CG1 . ILE A 1 264 ? 24.867 -31.888 -59.295 1.000 57.843 0 270 ILE AAA CG1 1 ? 2 ATOM 1950 C CG2 . ILE A 1 264 ? 27.067 -31.962 -58.068 1.000 60.819 0 270 ILE AAA CG2 1 ? 2 ATOM 1951 C CD1 . ILE A 1 264 ? 24.451 -33.328 -59.499 1.000 58.569 0 270 ILE AAA CD1 1 ? 2 ATOM 1952 N N . SER A 1 265 ? 28.973 -30.220 -60.794 1.000 74.533 0 271 SER AAA N 1 ? 2 ATOM 1953 C CA . SER A 1 265 ? 30.427 -29.915 -60.874 1.000 80.320 0 271 SER AAA CA 1 ? 2 ATOM 1954 C C . SER A 1 265 ? 30.643 -28.398 -60.915 1.000 82.131 0 271 SER AAA C 1 ? 2 ATOM 1955 O O . SER A 1 265 ? 31.657 -27.929 -60.359 1.000 88.153 0 271 SER AAA O 1 ? 2 ATOM 1956 C CB . SER A 1 265 ? 31.069 -30.592 -62.059 1.000 83.556 0 271 SER AAA CB 1 ? 2 ATOM 1957 O OG . SER A 1 265 ? 31.072 -32.001 -61.884 1.000 86.084 0 271 SER AAA OG 1 ? 2 ATOM 1958 N N . ARG A 1 266 ? 29.721 -27.665 -61.544 1.000 78.848 0 272 ARG AAA N 1 ? 2 ATOM 1959 C CA . ARG A 1 266 ? 29.842 -26.203 -61.801 1.000 81.073 0 272 ARG AAA CA 1 ? 2 ATOM 1960 C C . ARG A 1 266 ? 29.288 -25.400 -60.615 1.000 75.340 0 272 ARG AAA C 1 ? 2 ATOM 1961 O O . ARG A 1 266 ? 29.648 -24.205 -60.505 1.000 74.875 0 272 ARG AAA O 1 ? 2 ATOM 1962 C CB . ARG A 1 266 ? 29.104 -25.827 -63.087 1.000 85.248 0 272 ARG AAA CB 1 ? 2 ATOM 1963 C CG . ARG A 1 266 ? 29.547 -26.618 -64.306 1.000 89.121 0 272 ARG AAA CG 1 ? 2 ATOM 1964 C CD . ARG A 1 266 ? 28.953 -26.082 -65.585 1.000 99.103 0 272 ARG AAA CD 1 ? 2 ATOM 1965 N NE . ARG A 1 266 ? 29.845 -25.106 -66.188 1.000 109.231 0 272 ARG AAA NE 1 ? 2 ATOM 1966 C CZ . ARG A 1 266 ? 30.930 -25.405 -66.899 1.000 120.641 0 272 ARG AAA CZ 1 ? 2 ATOM 1967 N NH1 . ARG A 1 266 ? 31.272 -26.666 -67.117 1.000 119.734 0 272 ARG AAA NH1 1 ? 2 ATOM 1968 N NH2 . ARG A 1 266 ? 31.677 -24.433 -67.391 1.000 133.119 0 272 ARG AAA NH2 1 ? 2 ATOM 1969 N N . LEU A 1 267 ? 28.440 -26.025 -59.786 1.000 69.783 0 273 LEU AAA N 1 ? 2 ATOM 1970 C CA . LEU A 1 267 ? 27.820 -25.411 -58.578 1.000 64.797 0 273 LEU AAA CA 1 ? 2 ATOM 1971 C C . LEU A 1 267 ? 28.696 -25.688 -57.349 1.000 64.684 0 273 LEU AAA C 1 ? 2 ATOM 1972 O O . LEU A 1 267 ? 29.031 -24.712 -56.652 1.000 63.980 0 273 LEU AAA O 1 ? 2 ATOM 1973 C CB . LEU A 1 267 ? 26.407 -25.972 -58.385 1.000 60.394 0 273 LEU AAA CB 1 ? 2 ATOM 1974 C CG . LEU A 1 267 ? 25.345 -25.468 -59.359 1.000 57.297 0 273 LEU AAA CG 1 ? 2 ATOM 1975 C CD1 . LEU A 1 267 ? 24.079 -26.302 -59.244 1.000 55.494 0 273 LEU AAA CD1 1 ? 2 ATOM 1976 C CD2 . LEU A 1 267 ? 25.039 -23.998 -59.127 1.000 56.075 0 273 LEU AAA CD2 1 ? 2 ATOM 1977 N N . LEU A 1 268 ? 29.044 -26.961 -57.100 1.000 65.314 0 274 LEU AAA N 1 ? 2 ATOM 1978 C CA . LEU A 1 268 ? 29.915 -27.413 -55.973 1.000 64.877 0 274 LEU AAA CA 1 ? 2 ATOM 1979 C C . LEU A 1 268 ? 31.384 -27.105 -56.288 1.000 68.193 0 274 LEU AAA C 1 ? 2 ATOM 1980 O O . LEU A 1 268 ? 32.145 -28.039 -56.621 1.000 69.252 0 274 LEU AAA O 1 ? 2 ATOM 1981 C CB . LEU A 1 268 ? 29.735 -28.916 -55.736 1.000 62.372 0 274 LEU AAA CB 1 ? 2 ATOM 1982 C CG . LEU A 1 268 ? 28.328 -29.366 -55.360 1.000 59.720 0 274 LEU AAA CG 1 ? 2 ATOM 1983 C CD1 . LEU A 1 268 ? 28.314 -30.851 -55.042 1.000 59.355 0 274 LEU AAA CD1 1 ? 2 ATOM 1984 C CD2 . LEU A 1 268 ? 27.794 -28.569 -54.184 1.000 61.433 0 274 LEU AAA CD2 1 ? 2 ATOM 1985 N N . ARG A 1 269 ? 31.770 -25.836 -56.175 1.000 69.671 0 275 ARG AAA N 1 ? 2 ATOM 1986 C CA . ARG A 1 269 ? 33.165 -25.377 -56.360 1.000 77.968 0 275 ARG AAA CA 1 ? 2 ATOM 1987 C C . ARG A 1 269 ? 33.579 -24.634 -55.088 1.000 81.316 0 275 ARG AAA C 1 ? 2 ATOM 1988 O O . ARG A 1 269 ? 32.738 -23.898 -54.532 1.000 78.508 0 275 ARG AAA O 1 ? 2 ATOM 1989 C CB . ARG A 1 269 ? 33.249 -24.528 -57.630 1.000 83.210 0 275 ARG AAA CB 1 ? 2 ATOM 1990 C CG . ARG A 1 269 ? 32.990 -25.319 -58.905 1.000 86.800 0 275 ARG AAA CG 1 ? 2 ATOM 1991 C CD . ARG A 1 269 ? 34.210 -26.090 -59.371 1.000 94.959 0 275 ARG AAA CD 1 ? 2 ATOM 1992 N NE . ARG A 1 269 ? 35.260 -25.187 -59.826 1.000 102.964 0 275 ARG AAA NE 1 ? 2 ATOM 1993 C CZ . ARG A 1 269 ? 36.547 -25.503 -59.960 1.000 107.934 0 275 ARG AAA CZ 1 ? 2 ATOM 1994 N NH1 . ARG A 1 269 ? 36.982 -26.719 -59.672 1.000 108.147 0 275 ARG AAA NH1 1 ? 2 ATOM 1995 N NH2 . ARG A 1 269 ? 37.403 -24.592 -60.392 1.000 113.331 0 275 ARG AAA NH2 1 ? 2 ATOM 1996 N N . TYR A 1 270 ? 34.812 -24.854 -54.627 1.000 84.195 0 276 TYR AAA N 1 ? 2 ATOM 1997 C CA . TYR A 1 270 ? 35.375 -24.232 -53.401 1.000 84.896 0 276 TYR AAA CA 1 ? 2 ATOM 1998 C C . TYR A 1 270 ? 35.187 -22.711 -53.474 1.000 85.940 0 276 TYR AAA C 1 ? 2 ATOM 1999 O O . TYR A 1 270 ? 34.594 -22.120 -52.551 1.000 84.579 0 276 TYR AAA O 1 ? 2 ATOM 2000 C CB . TYR A 1 270 ? 36.854 -24.588 -53.235 1.000 87.125 0 276 TYR AAA CB 1 ? 2 ATOM 2001 C CG . TYR A 1 270 ? 37.431 -24.129 -51.924 1.000 88.121 0 276 TYR AAA CG 1 ? 2 ATOM 2002 C CD1 . TYR A 1 270 ? 37.847 -22.820 -51.746 1.000 90.671 0 276 TYR AAA CD1 1 ? 2 ATOM 2003 C CD2 . TYR A 1 270 ? 37.519 -24.992 -50.846 1.000 89.081 0 276 TYR AAA CD2 1 ? 2 ATOM 2004 C CE1 . TYR A 1 270 ? 38.357 -22.382 -50.536 1.000 92.185 0 276 TYR AAA CE1 1 ? 2 ATOM 2005 C CE2 . TYR A 1 270 ? 38.031 -24.573 -49.629 1.000 91.227 0 276 TYR AAA CE2 1 ? 2 ATOM 2006 C CZ . TYR A 1 270 ? 38.453 -23.264 -49.475 1.000 93.442 0 276 TYR AAA CZ 1 ? 2 ATOM 2007 O OH . TYR A 1 270 ? 38.951 -22.845 -48.279 1.000 98.569 0 276 TYR AAA OH 1 ? 2 ATOM 2008 N N . GLN A 1 271 ? 35.682 -22.106 -54.556 1.000 89.652 0 277 GLN AAA N 1 ? 2 ATOM 2009 C CA . GLN A 1 271 ? 35.620 -20.642 -54.801 1.000 92.199 0 277 GLN AAA CA 1 ? 2 ATOM 2010 C C . GLN A 1 271 ? 34.165 -20.233 -55.022 1.000 87.943 0 277 GLN AAA C 1 ? 2 ATOM 2011 O O . GLN A 1 271 ? 33.526 -20.709 -55.959 1.000 82.843 0 277 GLN AAA O 1 ? 2 ATOM 2012 C CB . GLN A 1 271 ? 36.496 -20.260 -55.998 1.000 96.271 0 277 GLN AAA CB 1 ? 2 ATOM 2013 C CG . GLN A 1 271 ? 37.864 -19.731 -55.611 1.000 103.993 0 277 GLN AAA CG 1 ? 2 ATOM 2014 C CD . GLN A 1 271 ? 37.736 -18.606 -54.613 1.000 109.028 0 277 GLN AAA CD 1 ? 2 ATOM 2015 O OE1 . GLN A 1 271 ? 36.849 -17.759 -54.718 1.000 110.938 0 277 GLN AAA OE1 1 ? 2 ATOM 2016 N NE2 . GLN A 1 271 ? 38.625 -18.592 -53.630 1.000 108.272 0 277 GLN AAA NE2 1 ? 2 ATOM 2017 N N . PRO A 1 272 ? 33.588 -19.360 -54.161 1.000 86.269 0 278 PRO AAA N 1 ? 2 ATOM 2018 C CA . PRO A 1 272 ? 32.229 -18.857 -54.367 1.000 83.111 0 278 PRO AAA CA 1 ? 2 ATOM 2019 C C . PRO A 1 272 ? 32.048 -18.087 -55.685 1.000 83.117 0 278 PRO AAA C 1 ? 2 ATOM 2020 O O . PRO A 1 272 ? 31.011 -18.241 -56.297 1.000 83.161 0 278 PRO AAA O 1 ? 2 ATOM 2021 C CB . PRO A 1 272 ? 31.992 -17.908 -53.179 1.000 82.921 0 278 PRO AAA CB 1 ? 2 ATOM 2022 C CG . PRO A 1 272 ? 32.991 -18.357 -52.137 1.000 84.829 0 278 PRO AAA CG 1 ? 2 ATOM 2023 C CD . PRO A 1 272 ? 34.193 -18.834 -52.928 1.000 87.832 0 278 PRO AAA CD 1 ? 2 ATOM 2024 N N . LEU A 1 273 ? 33.045 -17.290 -56.087 1.000 86.585 0 279 LEU AAA N 1 ? 2 ATOM 2025 C CA . LEU A 1 273 ? 32.929 -16.310 -57.207 1.000 86.136 0 279 LEU AAA CA 1 ? 2 ATOM 2026 C C . LEU A 1 273 ? 32.959 -17.026 -58.564 1.000 83.540 0 279 LEU AAA C 1 ? 2 ATOM 2027 O O . LEU A 1 273 ? 32.720 -16.334 -59.569 1.000 84.769 0 279 LEU AAA O 1 ? 2 ATOM 2028 C CB . LEU A 1 273 ? 34.042 -15.261 -57.111 1.000 92.588 0 279 LEU AAA CB 1 ? 2 ATOM 2029 C CG . LEU A 1 273 ? 33.654 -13.942 -56.440 1.000 97.016 0 279 LEU AAA CG 1 ? 2 ATOM 2030 C CD1 . LEU A 1 273 ? 33.228 -14.162 -54.995 1.000 101.067 0 279 LEU AAA CD1 1 ? 2 ATOM 2031 C CD2 . LEU A 1 273 ? 34.805 -12.952 -56.507 1.000 100.106 0 279 LEU AAA CD2 1 ? 2 ATOM 2032 N N . GLU A 1 274 ? 33.226 -18.338 -58.606 1.000 81.802 0 280 GLU AAA N 1 ? 2 ATOM 2033 C CA . GLU A 1 274 ? 33.202 -19.131 -59.870 1.000 84.253 0 280 GLU AAA CA 1 ? 2 ATOM 2034 C C . GLU A 1 274 ? 32.154 -20.250 -59.771 1.000 82.622 0 280 GLU AAA C 1 ? 2 ATOM 2035 O O . GLU A 1 274 ? 32.387 -21.332 -60.335 1.000 82.509 0 280 GLU AAA O 1 ? 2 ATOM 2036 C CB . GLU A 1 274 ? 34.608 -19.636 -60.220 1.000 87.284 0 280 GLU AAA CB 1 ? 2 ATOM 2037 C CG . GLU A 1 274 ? 35.157 -20.718 -59.305 1.000 87.255 0 280 GLU AAA CG 1 ? 2 ATOM 2038 C CD . GLU A 1 274 ? 36.655 -20.982 -59.442 1.000 91.125 0 280 GLU AAA CD 1 ? 2 ATOM 2039 O OE1 . GLU A 1 274 ? 37.422 -20.013 -59.639 1.000 92.578 0 280 GLU AAA OE1 1 ? 2 ATOM 2040 O OE2 . GLU A 1 274 ? 37.059 -22.153 -59.325 1.000 92.268 0 280 GLU AAA OE2 1 ? 2 ATOM 2041 N N . ARG A 1 275 ? 31.017 -19.974 -59.125 1.000 82.657 0 281 ARG AAA N 1 ? 2 ATOM 2042 C CA . ARG A 1 275 ? 29.873 -20.917 -58.995 1.000 81.199 0 281 ARG AAA CA 1 ? 2 ATOM 2043 C C . ARG A 1 275 ? 28.781 -20.519 -59.989 1.000 81.171 0 281 ARG AAA C 1 ? 2 ATOM 2044 O O . ARG A 1 275 ? 28.373 -19.341 -59.962 1.000 81.117 0 281 ARG AAA O 1 ? 2 ATOM 2045 C CB . ARG A 1 275 ? 29.305 -20.897 -57.574 1.000 79.715 0 281 ARG AAA CB 1 ? 2 ATOM 2046 C CG . ARG A 1 275 ? 30.180 -21.589 -56.542 1.000 79.678 0 281 ARG AAA CG 1 ? 2 ATOM 2047 C CD . ARG A 1 275 ? 29.399 -21.991 -55.308 1.000 74.539 0 281 ARG AAA CD 1 ? 2 ATOM 2048 N NE . ARG A 1 275 ? 30.286 -22.599 -54.329 1.000 75.260 0 281 ARG AAA NE 1 ? 2 ATOM 2049 C CZ . ARG A 1 275 ? 30.532 -22.131 -53.107 1.000 76.572 0 281 ARG AAA CZ 1 ? 2 ATOM 2050 N NH1 . ARG A 1 275 ? 31.382 -22.779 -52.326 1.000 78.099 0 281 ARG AAA NH1 1 ? 2 ATOM 2051 N NH2 . ARG A 1 275 ? 29.931 -21.041 -52.657 1.000 74.974 0 281 ARG AAA NH2 1 ? 2 ATOM 2052 N N . LEU A 1 276 ? 28.316 -21.468 -60.810 1.000 80.217 0 282 LEU AAA N 1 ? 2 ATOM 2053 C CA . LEU A 1 276 ? 27.352 -21.215 -61.914 1.000 79.520 0 282 LEU AAA CA 1 ? 2 ATOM 2054 C C . LEU A 1 276 ? 26.214 -20.349 -61.375 1.000 77.772 0 282 LEU AAA C 1 ? 2 ATOM 2055 O O . LEU A 1 276 ? 25.444 -20.806 -60.533 1.000 77.449 0 282 LEU AAA O 1 ? 2 ATOM 2056 C CB . LEU A 1 276 ? 26.845 -22.556 -62.457 1.000 78.881 0 282 LEU AAA CB 1 ? 2 ATOM 2057 C CG . LEU A 1 276 ? 26.196 -22.515 -63.841 1.000 79.158 0 282 LEU AAA CG 1 ? 2 ATOM 2058 C CD1 . LEU A 1 276 ? 27.224 -22.245 -64.927 1.000 79.941 0 282 LEU AAA CD1 1 ? 2 ATOM 2059 C CD2 . LEU A 1 276 ? 25.461 -23.816 -64.130 1.000 78.152 0 282 LEU AAA CD2 1 ? 2 ATOM 2060 N N . PRO A 1 277 ? 26.114 -19.061 -61.790 1.000 77.105 0 283 PRO AAA N 1 ? 2 ATOM 2061 C CA . PRO A 1 277 ? 25.042 -18.168 -61.339 1.000 72.879 0 283 PRO AAA CA 1 ? 2 ATOM 2062 C C . PRO A 1 277 ? 23.628 -18.659 -61.676 1.000 68.266 0 283 PRO AAA C 1 ? 2 ATOM 2063 O O . PRO A 1 277 ? 23.494 -19.496 -62.562 1.000 62.640 0 283 PRO AAA O 1 ? 2 ATOM 2064 C CB . PRO A 1 277 ? 25.282 -16.860 -62.105 1.000 76.962 0 283 PRO AAA CB 1 ? 2 ATOM 2065 C CG . PRO A 1 277 ? 26.751 -16.905 -62.476 1.000 80.066 0 283 PRO AAA CG 1 ? 2 ATOM 2066 C CD . PRO A 1 277 ? 27.066 -18.374 -62.677 1.000 79.232 0 283 PRO AAA CD 1 ? 2 ATOM 2067 N N . LEU A 1 278 ? 22.629 -18.105 -60.976 1.000 69.781 0 284 LEU AAA N 1 ? 2 ATOM 2068 C CA . LEU A 1 278 ? 21.193 -18.481 -61.098 1.000 68.871 0 284 LEU AAA CA 1 ? 2 ATOM 2069 C C . LEU A 1 278 ? 20.770 -18.370 -62.564 1.000 72.128 0 284 LEU AAA C 1 ? 2 ATOM 2070 O O . LEU A 1 278 ? 20.211 -19.357 -63.092 1.000 73.089 0 284 LEU AAA O 1 ? 2 ATOM 2071 C CB . LEU A 1 278 ? 20.325 -17.555 -60.239 1.000 68.534 0 284 LEU AAA CB 1 ? 2 ATOM 2072 C CG . LEU A 1 278 ? 20.477 -17.676 -58.724 1.000 66.825 0 284 LEU AAA CG 1 ? 2 ATOM 2073 C CD1 . LEU A 1 278 ? 19.664 -16.596 -58.032 1.000 64.946 0 284 LEU AAA CD1 1 ? 2 ATOM 2074 C CD2 . LEU A 1 278 ? 20.062 -19.052 -58.231 1.000 64.746 0 284 LEU AAA CD2 1 ? 2 ATOM 2075 N N . ALA A 1 279 ? 21.033 -17.216 -63.187 1.000 73.625 0 285 ALA AAA N 1 ? 2 ATOM 2076 C CA . ALA A 1 279 ? 20.678 -16.923 -64.597 1.000 75.686 0 285 ALA AAA CA 1 ? 2 ATOM 2077 C C . ALA A 1 279 ? 21.085 -18.093 -65.509 1.000 75.220 0 285 ALA AAA C 1 ? 2 ATOM 2078 O O . ALA A 1 279 ? 20.311 -18.387 -66.447 1.000 73.284 0 285 ALA AAA O 1 ? 2 ATOM 2079 C CB . ALA A 1 279 ? 21.313 -15.628 -65.028 1.000 77.910 0 285 ALA AAA CB 1 ? 2 ATOM 2080 N N . GLN A 1 280 ? 22.222 -18.751 -65.226 1.000 75.462 0 286 GLN AAA N 1 ? 2 ATOM 2081 C CA . GLN A 1 280 ? 22.808 -19.845 -66.057 1.000 77.292 0 286 GLN AAA CA 1 ? 2 ATOM 2082 C C . GLN A 1 280 ? 22.380 -21.241 -65.575 1.000 73.320 0 286 GLN AAA C 1 ? 2 ATOM 2083 O O . GLN A 1 280 ? 22.565 -22.192 -66.354 1.000 71.090 0 286 GLN AAA O 1 ? 2 ATOM 2084 C CB . GLN A 1 280 ? 24.337 -19.766 -66.081 1.000 82.883 0 286 GLN AAA CB 1 ? 2 ATOM 2085 C CG . GLN A 1 280 ? 24.875 -18.782 -67.111 1.000 89.738 0 286 GLN AAA CG 1 ? 2 ATOM 2086 C CD . GLN A 1 280 ? 25.656 -17.664 -66.468 1.000 94.623 0 286 GLN AAA CD 1 ? 2 ATOM 2087 O OE1 . GLN A 1 280 ? 26.831 -17.822 -66.143 1.000 95.274 0 286 GLN AAA OE1 1 ? 2 ATOM 2088 N NE2 . GLN A 1 280 ? 25.005 -16.526 -66.278 1.000 94.964 0 286 GLN AAA NE2 1 ? 2 ATOM 2089 N N . ILE A 1 281 ? 21.867 -21.392 -64.351 1.000 73.171 0 287 ILE AAA N 1 ? 2 ATOM 2090 C CA . ILE A 1 281 ? 21.251 -22.681 -63.906 1.000 69.908 0 287 ILE AAA CA 1 ? 2 ATOM 2091 C C . ILE A 1 281 ? 19.986 -22.892 -64.740 1.000 69.134 0 287 ILE AAA C 1 ? 2 ATOM 2092 O O . ILE A 1 281 ? 19.770 -24.025 -65.211 1.000 70.547 0 287 ILE AAA O 1 ? 2 ATOM 2093 C CB . ILE A 1 281 ? 20.933 -22.714 -62.399 1.000 64.821 0 287 ILE AAA CB 1 ? 2 ATOM 2094 C CG1 . ILE A 1 281 ? 22.189 -22.557 -61.538 1.000 64.607 0 287 ILE AAA CG1 1 ? 2 ATOM 2095 C CG2 . ILE A 1 281 ? 20.176 -23.991 -62.058 1.000 61.224 0 287 ILE AAA CG2 1 ? 2 ATOM 2096 C CD1 . ILE A 1 281 ? 21.897 -22.207 -60.099 1.000 63.055 0 287 ILE AAA CD1 1 ? 2 ATOM 2097 N N . LEU A 1 282 ? 19.198 -21.825 -64.905 1.000 68.620 0 288 LEU AAA N 1 ? 2 ATOM 2098 C CA . LEU A 1 282 ? 17.983 -21.783 -65.762 1.000 69.347 0 288 LEU AAA CA 1 ? 2 ATOM 2099 C C . LEU A 1 282 ? 18.365 -22.194 -67.190 1.000 74.063 0 288 LEU AAA C 1 ? 2 ATOM 2100 O O . LEU A 1 282 ? 17.650 -23.034 -67.768 1.000 75.176 0 288 LEU AAA O 1 ? 2 ATOM 2101 C CB . LEU A 1 282 ? 17.388 -20.370 -65.725 1.000 68.033 0 288 LEU AAA CB 1 ? 2 ATOM 2102 C CG . LEU A 1 282 ? 16.897 -19.897 -64.355 1.000 64.553 0 288 LEU AAA CG 1 ? 2 ATOM 2103 C CD1 . LEU A 1 282 ? 16.582 -18.408 -64.365 1.000 64.817 0 288 LEU AAA CD1 1 ? 2 ATOM 2104 C CD2 . LEU A 1 282 ? 15.683 -20.696 -63.909 1.000 61.050 0 288 LEU AAA CD2 1 ? 2 ATOM 2105 N N . LYS A 1 283 ? 19.474 -21.652 -67.708 1.000 75.425 0 289 LYS AAA N 1 ? 2 ATOM 2106 C CA . LYS A 1 283 ? 19.919 -21.796 -69.122 1.000 72.100 0 289 LYS AAA CA 1 ? 2 ATOM 2107 C C . LYS A 1 283 ? 20.708 -23.093 -69.316 1.000 68.684 0 289 LYS AAA C 1 ? 2 ATOM 2108 O O . LYS A 1 283 ? 21.047 -23.393 -70.467 1.000 70.383 0 289 LYS AAA O 1 ? 2 ATOM 2109 C CB . LYS A 1 283 ? 20.785 -20.602 -69.536 1.000 74.516 0 289 LYS AAA CB 1 ? 2 ATOM 2110 C CG . LYS A 1 283 ? 20.034 -19.288 -69.681 1.000 77.406 0 289 LYS AAA CG 1 ? 2 ATOM 2111 C CD . LYS A 1 283 ? 20.931 -18.112 -69.987 1.000 82.099 0 289 LYS AAA CD 1 ? 2 ATOM 2112 C CE . LYS A 1 283 ? 20.148 -16.875 -70.380 1.000 86.299 0 289 LYS AAA CE 1 ? 2 ATOM 2113 N NZ . LYS A 1 283 ? 20.996 -15.896 -71.100 1.000 89.327 0 289 LYS AAA NZ 1 ? 2 ATOM 2114 N N . HIS A 1 284 ? 21.002 -23.836 -68.250 1.000 68.403 0 290 HIS AAA N 1 ? 2 ATOM 2115 C CA . HIS A 1 284 ? 21.897 -25.019 -68.341 1.000 69.915 0 290 HIS AAA CA 1 ? 2 ATOM 2116 C C . HIS A 1 284 ? 21.238 -26.086 -69.209 1.000 68.273 0 290 HIS AAA C 1 ? 2 ATOM 2117 O O . HIS A 1 284 ? 20.083 -26.437 -68.974 1.000 65.963 0 290 HIS AAA O 1 ? 2 ATOM 2118 C CB . HIS A 1 284 ? 22.279 -25.595 -66.976 1.000 68.938 0 290 HIS AAA CB 1 ? 2 ATOM 2119 C CG . HIS A 1 284 ? 23.305 -26.673 -67.131 1.000 69.072 0 290 HIS AAA CG 1 ? 2 ATOM 2120 N ND1 . HIS A 1 284 ? 22.965 -27.998 -67.335 1.000 67.832 0 290 HIS AAA ND1 1 ? 2 ATOM 2121 C CD2 . HIS A 1 284 ? 24.658 -26.622 -67.206 1.000 70.665 0 290 HIS AAA CD2 1 ? 2 ATOM 2122 C CE1 . HIS A 1 284 ? 24.063 -28.722 -67.475 1.000 68.798 0 290 HIS AAA CE1 1 ? 2 ATOM 2123 N NE2 . HIS A 1 284 ? 25.118 -27.903 -67.400 1.000 70.586 0 290 HIS AAA NE2 1 ? 2 ATOM 2124 N N . PRO A 1 285 ? 21.969 -26.651 -70.202 1.000 65.696 0 291 PRO AAA N 1 ? 2 ATOM 2125 C CA . PRO A 1 285 ? 21.407 -27.621 -71.138 1.000 63.584 0 291 PRO AAA CA 1 ? 2 ATOM 2126 C C . PRO A 1 285 ? 20.547 -28.712 -70.481 1.000 61.808 0 291 PRO AAA C 1 ? 2 ATOM 2127 O O . PRO A 1 285 ? 19.441 -28.911 -70.936 1.000 61.978 0 291 PRO AAA O 1 ? 2 ATOM 2128 C CB . PRO A 1 285 ? 22.640 -28.250 -71.815 1.000 65.763 0 291 PRO AAA CB 1 ? 2 ATOM 2129 C CG . PRO A 1 285 ? 23.831 -27.782 -71.004 1.000 67.359 0 291 PRO AAA CG 1 ? 2 ATOM 2130 C CD . PRO A 1 285 ? 23.406 -26.445 -70.439 1.000 67.475 0 291 PRO AAA CD 1 ? 2 ATOM 2131 N N . TRP A 1 286 ? 21.060 -29.368 -69.433 1.000 63.415 0 292 TRP AAA N 1 ? 2 ATOM 2132 C CA . TRP A 1 286 ? 20.422 -30.527 -68.742 1.000 62.486 0 292 TRP AAA CA 1 ? 2 ATOM 2133 C C . TRP A 1 286 ? 19.044 -30.153 -68.182 1.000 60.206 0 292 TRP AAA C 1 ? 2 ATOM 2134 O O . TRP A 1 286 ? 18.103 -30.966 -68.342 1.000 56.699 0 292 TRP AAA O 1 ? 2 ATOM 2135 C CB . TRP A 1 286 ? 21.309 -31.087 -67.625 1.000 61.120 0 292 TRP AAA CB 1 ? 2 ATOM 2136 C CG . TRP A 1 286 ? 20.668 -32.262 -66.959 1.000 59.465 0 292 TRP AAA CG 1 ? 2 ATOM 2137 C CD1 . TRP A 1 286 ? 20.508 -33.511 -67.483 1.000 60.754 0 292 TRP AAA CD1 1 ? 2 ATOM 2138 C CD2 . TRP A 1 286 ? 20.031 -32.283 -65.673 1.000 58.684 0 292 TRP AAA CD2 1 ? 2 ATOM 2139 N NE1 . TRP A 1 286 ? 19.840 -34.315 -66.603 1.000 60.396 0 292 TRP AAA NE1 1 ? 2 ATOM 2140 C CE2 . TRP A 1 286 ? 19.536 -33.590 -65.481 1.000 58.790 0 292 TRP AAA CE2 1 ? 2 ATOM 2141 C CE3 . TRP A 1 286 ? 19.846 -31.336 -64.659 1.000 59.288 0 292 TRP AAA CE3 1 ? 2 ATOM 2142 C CZ2 . TRP A 1 286 ? 18.870 -33.966 -64.316 1.000 57.902 0 292 TRP AAA CZ2 1 ? 2 ATOM 2143 C CZ3 . TRP A 1 286 ? 19.195 -31.711 -63.503 1.000 57.473 0 292 TRP AAA CZ3 1 ? 2 ATOM 2144 C CH2 . TRP A 1 286 ? 18.708 -33.007 -63.341 1.000 57.834 0 292 TRP AAA CH2 1 ? 2 ATOM 2145 N N . VAL A 1 287 ? 18.947 -28.997 -67.516 1.000 60.726 0 293 VAL AAA N 1 ? 2 ATOM 2146 C CA . VAL A 1 287 ? 17.670 -28.441 -66.975 1.000 61.261 0 293 VAL AAA CA 1 ? 2 ATOM 2147 C C . VAL A 1 287 ? 16.690 -28.323 -68.139 1.000 62.055 0 293 VAL AAA C 1 ? 2 ATOM 2148 O O . VAL A 1 287 ? 15.625 -28.959 -68.095 1.000 62.735 0 293 VAL AAA O 1 ? 2 ATOM 2149 C CB . VAL A 1 287 ? 17.889 -27.077 -66.289 1.000 64.878 0 293 VAL AAA CB 1 ? 2 ATOM 2150 C CG1 . VAL A 1 287 ? 16.582 -26.319 -66.100 1.000 66.080 0 293 VAL AAA CG1 1 ? 2 ATOM 2151 C CG2 . VAL A 1 287 ? 18.623 -27.220 -64.957 1.000 63.461 0 293 VAL AAA CG2 1 ? 2 ATOM 2152 N N . GLN A 1 288 ? 17.085 -27.548 -69.149 1.000 65.725 0 294 GLN AAA N 1 ? 2 ATOM 2153 C CA . GLN A 1 288 ? 16.323 -27.290 -70.394 1.000 63.166 0 294 GLN AAA CA 1 ? 2 ATOM 2154 C C . GLN A 1 288 ? 15.723 -28.614 -70.886 1.000 62.339 0 294 GLN AAA C 1 ? 2 ATOM 2155 O O . GLN A 1 288 ? 14.521 -28.634 -71.243 1.000 64.164 0 294 GLN AAA O 1 ? 2 ATOM 2156 C CB . GLN A 1 288 ? 17.262 -26.631 -71.412 1.000 68.033 0 294 GLN AAA CB 1 ? 2 ATOM 2157 C CG . GLN A 1 288 ? 16.675 -25.414 -72.111 1.000 73.871 0 294 GLN AAA CG 1 ? 2 ATOM 2158 C CD . GLN A 1 288 ? 16.380 -24.297 -71.140 1.000 74.143 0 294 GLN AAA CD 1 ? 2 ATOM 2159 O OE1 . GLN A 1 288 ? 17.096 -24.097 -70.161 1.000 72.336 0 294 GLN AAA OE1 1 ? 2 ATOM 2160 N NE2 . GLN A 1 288 ? 15.311 -23.563 -71.402 1.000 74.336 0 294 GLN AAA NE2 1 ? 2 ATOM 2161 N N . ALA A 1 289 ? 16.525 -29.683 -70.886 1.000 62.438 0 295 ALA AAA N 1 ? 2 ATOM 2162 C CA . ALA A 1 289 ? 16.221 -30.964 -71.566 1.000 64.798 0 295 ALA AAA CA 1 ? 2 ATOM 2163 C C . ALA A 1 289 ? 15.199 -31.790 -70.768 1.000 64.659 0 295 ALA AAA C 1 ? 2 ATOM 2164 O O . ALA A 1 289 ? 14.559 -32.664 -71.394 1.000 65.783 0 295 ALA AAA O 1 ? 2 ATOM 2165 C CB . ALA A 1 289 ? 17.499 -31.739 -71.796 1.000 64.360 0 295 ALA AAA CB 1 ? 2 ATOM 2166 N N . HIS A 1 290 ? 15.058 -31.550 -69.454 1.000 60.795 0 296 HIS AAA N 1 ? 2 ATOM 2167 C CA . HIS A 1 290 ? 14.327 -32.454 -68.514 1.000 58.189 0 296 HIS AAA CA 1 ? 2 ATOM 2168 C C . HIS A 1 290 ? 13.301 -31.728 -67.626 1.000 56.284 0 296 HIS AAA C 1 ? 2 ATOM 2169 O O . HIS A 1 290 ? 12.421 -32.421 -67.051 1.000 55.313 0 296 HIS AAA O 1 ? 2 ATOM 2170 C CB . HIS A 1 290 ? 15.320 -33.224 -67.642 1.000 57.548 0 296 HIS AAA CB 1 ? 2 ATOM 2171 C CG . HIS A 1 290 ? 16.183 -34.154 -68.421 1.000 60.021 0 296 HIS AAA CG 1 ? 2 ATOM 2172 N ND1 . HIS A 1 290 ? 17.412 -33.775 -68.914 1.000 60.704 0 296 HIS AAA ND1 1 ? 2 ATOM 2173 C CD2 . HIS A 1 290 ? 15.996 -35.438 -68.795 1.000 62.276 0 296 HIS AAA CD2 1 ? 2 ATOM 2174 C CE1 . HIS A 1 290 ? 17.945 -34.788 -69.567 1.000 65.409 0 296 HIS AAA CE1 1 ? 2 ATOM 2175 N NE2 . HIS A 1 290 ? 17.094 -35.820 -69.512 1.000 64.307 0 296 HIS AAA NE2 1 ? 2 ATOM 2176 N N . SER A 1 291 ? 13.398 -30.407 -67.474 1.000 56.685 0 297 SER AAA N 1 ? 2 ATOM 2177 C CA . SER A 1 291 ? 12.425 -29.610 -66.685 1.000 57.218 0 297 SER AAA CA 1 ? 2 ATOM 2178 C C . SER A 1 291 ? 11.056 -29.661 -67.379 1.000 59.883 0 297 SER AAA C 1 ? 2 ATOM 2179 O O . SER A 1 291 ? 11.022 -29.529 -68.628 1.000 60.530 0 297 SER AAA O 1 ? 2 ATOM 2180 C CB . SER A 1 291 ? 12.912 -28.193 -66.482 1.000 56.817 0 297 SER AAA CB 1 ? 2 ATOM 2181 O OG . SER A 1 291 ? 11.986 -27.439 -65.703 1.000 54.243 0 297 SER AAA OG 1 ? 2 ATOM 2182 N N . ARG A 1 292 ? 9.987 -29.897 -66.606 1.000 58.497 0 298 ARG AAA N 1 ? 2 ATOM 2183 C CA . ARG A 1 292 ? 8.574 -29.830 -67.073 1.000 61.529 0 298 ARG AAA CA 1 ? 2 ATOM 2184 C C . ARG A 1 292 ? 7.825 -28.807 -66.211 1.000 58.638 0 298 ARG AAA C 1 ? 2 ATOM 2185 O O . ARG A 1 292 ? 6.654 -29.074 -65.865 1.000 60.951 0 298 ARG AAA O 1 ? 2 ATOM 2186 C CB . ARG A 1 292 ? 7.889 -31.202 -66.998 1.000 66.373 0 298 ARG AAA CB 1 ? 2 ATOM 2187 C CG . ARG A 1 292 ? 8.635 -32.338 -67.688 1.000 75.155 0 298 ARG AAA CG 1 ? 2 ATOM 2188 C CD . ARG A 1 292 ? 8.518 -32.290 -69.194 1.000 84.689 0 298 ARG AAA CD 1 ? 2 ATOM 2189 N NE . ARG A 1 292 ? 9.033 -33.497 -69.837 1.000 94.280 0 298 ARG AAA NE 1 ? 2 ATOM 2190 C CZ . ARG A 1 292 ? 8.293 -34.529 -70.247 1.000 100.383 0 298 ARG AAA CZ 1 ? 2 ATOM 2191 N NH1 . ARG A 1 292 ? 6.979 -34.533 -70.080 1.000 102.620 0 298 ARG AAA NH1 1 ? 2 ATOM 2192 N NH2 . ARG A 1 292 ? 8.874 -35.565 -70.831 1.000 97.515 0 298 ARG AAA NH2 1 ? 2 ATOM 2193 N N . ARG A 1 293 ? 8.471 -27.684 -65.883 1.000 56.750 0 299 ARG AAA N 1 ? 2 ATOM 2194 C CA . ARG A 1 293 ? 7.903 -26.635 -64.992 1.000 59.527 0 299 ARG AAA CA 1 ? 2 ATOM 2195 C C . ARG A 1 293 ? 6.685 -25.997 -65.660 1.000 62.280 0 299 ARG AAA C 1 ? 2 ATOM 2196 O O . ARG A 1 293 ? 6.781 -25.608 -66.854 1.000 66.395 0 299 ARG AAA O 1 ? 2 ATOM 2197 C CB . ARG A 1 293 ? 8.925 -25.547 -64.652 1.000 62.003 0 299 ARG AAA CB 1 ? 2 ATOM 2198 C CG . ARG A 1 293 ? 8.318 -24.293 -64.033 1.000 63.984 0 299 ARG AAA CG 1 ? 2 ATOM 2199 C CD . ARG A 1 293 ? 9.388 -23.340 -63.543 1.000 71.729 0 299 ARG AAA CD 1 ? 2 ATOM 2200 N NE . ARG A 1 293 ? 9.042 -21.928 -63.674 1.000 77.774 0 299 ARG AAA NE 1 ? 2 ATOM 2201 C CZ . ARG A 1 293 ? 8.444 -21.180 -62.743 1.000 84.030 0 299 ARG AAA CZ 1 ? 2 ATOM 2202 N NH1 . ARG A 1 293 ? 8.070 -21.692 -61.579 1.000 76.461 0 299 ARG AAA NH1 1 ? 2 ATOM 2203 N NH2 . ARG A 1 293 ? 8.212 -19.904 -62.995 1.000 93.771 0 299 ARG AAA NH2 1 ? 2 ATOM 2204 N N . VAL A 1 294 ? 5.597 -25.865 -64.898 1.000 59.468 0 300 VAL AAA N 1 ? 2 ATOM 2205 C CA . VAL A 1 294 ? 4.353 -25.179 -65.347 1.000 60.097 0 300 VAL AAA CA 1 ? 2 ATOM 2206 C C . VAL A 1 294 ? 3.718 -24.486 -64.135 1.000 53.148 0 300 VAL AAA C 1 ? 2 ATOM 2207 O O . VAL A 1 294 ? 3.496 -25.153 -63.118 1.000 52.058 0 300 VAL AAA O 1 ? 2 ATOM 2208 C CB . VAL A 1 294 ? 3.402 -26.166 -66.051 1.000 64.255 0 300 VAL AAA CB 1 ? 2 ATOM 2209 C CG1 . VAL A 1 294 ? 3.125 -27.392 -65.196 1.000 67.248 0 300 VAL AAA CG1 1 ? 2 ATOM 2210 C CG2 . VAL A 1 294 ? 2.106 -25.496 -66.488 1.000 67.108 0 300 VAL AAA CG2 1 ? 2 ATOM 2211 N N . LEU A 1 295 ? 3.487 -23.176 -64.254 1.000 51.261 0 301 LEU AAA N 1 ? 2 ATOM 2212 C CA . LEU A 1 295 ? 2.804 -22.326 -63.246 1.000 50.542 0 301 LEU AAA CA 1 ? 2 ATOM 2213 C C . LEU A 1 295 ? 1.480 -22.976 -62.865 1.000 49.226 0 301 LEU AAA C 1 ? 2 ATOM 2214 O O . LEU A 1 295 ? 0.753 -23.473 -63.721 1.000 48.397 0 301 LEU AAA O 1 ? 2 ATOM 2215 C CB . LEU A 1 295 ? 2.534 -20.923 -63.805 1.000 52.539 0 301 LEU AAA CB 1 ? 2 ATOM 2216 C CG . LEU A 1 295 ? 3.719 -20.145 -64.376 1.000 53.614 0 301 LEU AAA CG 1 ? 2 ATOM 2217 C CD1 . LEU A 1 295 ? 3.385 -18.664 -64.460 1.000 55.657 0 301 LEU AAA CD1 1 ? 2 ATOM 2218 C CD2 . LEU A 1 295 ? 4.976 -20.354 -63.553 1.000 53.668 0 301 LEU AAA CD2 1 ? 2 ATOM 2219 N N . PRO A 1 296 ? 1.123 -22.980 -61.565 1.000 49.274 0 302 PRO AAA N 1 ? 2 ATOM 2220 C CA . PRO A 1 296 ? -0.205 -23.426 -61.148 1.000 50.008 0 302 PRO AAA CA 1 ? 2 ATOM 2221 C C . PRO A 1 296 ? -1.267 -22.380 -61.488 1.000 51.808 0 302 PRO AAA C 1 ? 2 ATOM 2222 O O . PRO A 1 296 ? -0.962 -21.196 -61.599 1.000 54.555 0 302 PRO AAA O 1 ? 2 ATOM 2223 C CB . PRO A 1 296 ? -0.027 -23.624 -59.643 1.000 50.008 0 302 PRO AAA CB 1 ? 2 ATOM 2224 C CG . PRO A 1 296 ? 1.033 -22.608 -59.260 1.000 50.455 0 302 PRO AAA CG 1 ? 2 ATOM 2225 C CD . PRO A 1 296 ? 1.975 -22.556 -60.443 1.000 47.916 0 302 PRO AAA CD 1 ? 2 ATOM 2226 N N . PRO A 1 297 ? -2.540 -22.784 -61.700 1.000 50.946 0 303 PRO AAA N 1 ? 2 ATOM 2227 C CA . PRO A 1 297 ? -3.611 -21.839 -62.026 1.000 53.650 0 303 PRO AAA CA 1 ? 2 ATOM 2228 C C . PRO A 1 297 ? -3.810 -20.699 -61.016 1.000 57.403 0 303 PRO AAA C 1 ? 2 ATOM 2229 O O . PRO A 1 297 ? -3.836 -20.980 -59.834 1.000 63.345 0 303 PRO AAA O 1 ? 2 ATOM 2230 C CB . PRO A 1 297 ? -4.874 -22.710 -62.024 1.000 53.361 0 303 PRO AAA CB 1 ? 2 ATOM 2231 C CG . PRO A 1 297 ? -4.372 -24.105 -62.322 1.000 52.012 0 303 PRO AAA CG 1 ? 2 ATOM 2232 C CD . PRO A 1 297 ? -3.000 -24.179 -61.690 1.000 50.151 0 303 PRO AAA CD 1 ? 2 ATOM 2233 N N . CYS A 1 298 ? -3.936 -19.462 -61.508 1.000 60.791 0 304 CYS AAA N 1 ? 2 ATOM 2234 C CA . CYS A 1 298 ? -4.383 -18.259 -60.751 1.000 65.786 0 304 CYS AAA CA 1 ? 2 ATOM 2235 C C . CYS A 1 298 ? -5.779 -17.851 -61.224 1.000 74.381 0 304 CYS AAA C 1 ? 2 ATOM 2236 O O . CYS A 1 298 ? -6.264 -18.429 -62.215 1.000 79.968 0 304 CYS AAA O 1 ? 2 ATOM 2237 C CB . CYS A 1 298 ? -3.457 -17.068 -60.965 1.000 65.969 0 304 CYS AAA CB 1 ? 2 ATOM 2238 S SG . CYS A 1 298 ? -1.700 -17.493 -60.916 1.000 65.852 0 304 CYS AAA SG 1 ? 2 ATOM 2239 N N . ALA A 1 299 ? -6.383 -16.867 -60.555 1.000 80.323 0 305 ALA AAA N 1 ? 2 ATOM 2240 C CA . ALA A 1 299 ? -7.656 -16.227 -60.954 1.000 87.021 0 305 ALA AAA CA 1 ? 2 ATOM 2241 C C . ALA A 1 299 ? -7.355 -14.799 -61.416 1.000 94.910 0 305 ALA AAA C 1 ? 2 ATOM 2242 O O . ALA A 1 299 ? -6.199 -14.367 -61.241 1.000 90.261 0 305 ALA AAA O 1 ? 2 ATOM 2243 C CB . ALA A 1 299 ? -8.627 -16.252 -59.797 1.000 87.503 0 305 ALA AAA CB 1 ? 2 ATOM 2244 N N . GLN A 1 300 ? -8.349 -14.130 -62.017 1.000 107.916 0 306 GLN AAA N 1 ? 2 ATOM 2245 C CA . GLN A 1 300 ? -8.401 -12.658 -62.262 1.000 114.323 0 306 GLN AAA CA 1 ? 2 ATOM 2246 C C . GLN A 1 300 ? -9.692 -12.317 -63.021 1.000 119.568 0 306 GLN AAA C 1 ? 2 ATOM 2247 O O . GLN A 1 300 ? -10.196 -13.079 -63.850 1.000 122.971 0 306 GLN AAA O 1 ? 2 ATOM 2248 C CB . GLN A 1 300 ? -7.174 -12.136 -63.028 1.000 113.314 0 306 GLN AAA CB 1 ? 2 ATOM 2249 C CG . GLN A 1 300 ? -6.056 -11.572 -62.147 1.000 109.738 0 306 GLN AAA CG 1 ? 2 ATOM 2250 C CD . GLN A 1 300 ? -6.331 -10.212 -61.546 1.000 106.309 0 306 GLN AAA CD 1 ? 2 ATOM 2251 O OE1 . GLN A 1 300 ? -6.111 -9.984 -60.358 1.000 99.966 0 306 GLN AAA OE1 1 ? 2 ATOM 2252 N NE2 . GLN A 1 300 ? -6.793 -9.283 -62.368 1.000 109.269 0 306 GLN AAA NE2 1 ? 2 ATOM 2253 N N . SER B 1 26 ? -30.373 17.983 -18.203 1.000 121.300 0 32 SER BBB N 1 ? 3 ATOM 2254 C CA . SER B 1 26 ? -30.769 16.566 -18.469 1.000 116.257 0 32 SER BBB CA 1 ? 3 ATOM 2255 C C . SER B 1 26 ? -32.143 16.275 -17.862 1.000 124.111 0 32 SER BBB C 1 ? 3 ATOM 2256 O O . SER B 1 26 ? -32.239 15.928 -16.688 1.000 123.129 0 32 SER BBB O 1 ? 3 ATOM 2257 C CB . SER B 1 26 ? -29.716 15.615 -17.948 1.000 108.394 0 32 SER BBB CB 1 ? 3 ATOM 2258 O OG . SER B 1 26 ? -28.728 15.355 -18.935 1.000 106.219 0 32 SER BBB OG 1 ? 3 ATOM 2259 N N . PRO B 1 27 ? -33.258 16.420 -18.621 1.000 134.841 0 33 PRO BBB N 1 ? 3 ATOM 2260 C CA . PRO B 1 27 ? -34.583 16.029 -18.131 1.000 138.557 0 33 PRO BBB CA 1 ? 3 ATOM 2261 C C . PRO B 1 27 ? -34.730 14.496 -18.039 1.000 137.502 0 33 PRO BBB C 1 ? 3 ATOM 2262 O O . PRO B 1 27 ? -34.392 13.945 -17.010 1.000 135.479 0 33 PRO BBB O 1 ? 3 ATOM 2263 C CB . PRO B 1 27 ? -35.568 16.693 -19.120 1.000 138.726 0 33 PRO BBB CB 1 ? 3 ATOM 2264 C CG . PRO B 1 27 ? -34.721 17.627 -19.969 1.000 140.706 0 33 PRO BBB CG 1 ? 3 ATOM 2265 C CD . PRO B 1 27 ? -33.327 17.032 -19.955 1.000 139.412 0 33 PRO BBB CD 1 ? 3 ATOM 2266 N N . ALA B 1 28 ? -35.248 13.846 -19.087 1.000 137.935 0 34 ALA BBB N 1 ? 3 ATOM 2267 C CA . ALA B 1 28 ? -35.407 12.377 -19.180 1.000 134.296 0 34 ALA BBB CA 1 ? 3 ATOM 2268 C C . ALA B 1 28 ? -35.359 11.945 -20.652 1.000 139.649 0 34 ALA BBB C 1 ? 3 ATOM 2269 O O . ALA B 1 28 ? -36.072 10.990 -20.997 1.000 144.599 0 34 ALA BBB O 1 ? 3 ATOM 2270 C CB . ALA B 1 28 ? -36.696 11.955 -18.511 1.000 132.336 0 34 ALA BBB CB 1 ? 3 ATOM 2271 N N . MET B 1 29 ? -34.525 12.603 -21.468 1.000 141.198 0 35 MET BBB N 1 ? 3 ATOM 2272 C CA . MET B 1 29 ? -34.319 12.285 -22.909 1.000 140.928 0 35 MET BBB CA 1 ? 3 ATOM 2273 C C . MET B 1 29 ? -32.877 11.792 -23.099 1.000 136.082 0 35 MET BBB C 1 ? 3 ATOM 2274 O O . MET B 1 29 ? -32.721 10.618 -23.469 1.000 154.377 0 35 MET BBB O 1 ? 3 ATOM 2275 C CB . MET B 1 29 ? -34.620 13.473 -23.831 1.000 149.199 0 35 MET BBB CB 1 ? 3 ATOM 2276 C CG . MET B 1 29 ? -34.476 14.840 -23.193 1.000 157.765 0 35 MET BBB CG 1 ? 3 ATOM 2277 S SD . MET B 1 29 ? -32.820 15.522 -23.417 1.000 159.572 0 35 MET BBB SD 1 ? 3 ATOM 2278 C CE . MET B 1 29 ? -33.192 17.273 -23.324 1.000 155.635 0 35 MET BBB CE 1 ? 3 ATOM 2279 N N . ARG B 1 30 ? -31.875 12.638 -22.826 1.000 120.419 0 36 ARG BBB N 1 ? 3 ATOM 2280 C CA . ARG B 1 30 ? -30.453 12.234 -22.589 1.000 105.307 0 36 ARG BBB CA 1 ? 3 ATOM 2281 C C . ARG B 1 30 ? -29.968 11.250 -23.670 1.000 98.019 0 36 ARG BBB C 1 ? 3 ATOM 2282 O O . ARG B 1 30 ? -29.204 10.321 -23.328 1.000 99.468 0 36 ARG BBB O 1 ? 3 ATOM 2283 C CB . ARG B 1 30 ? -30.295 11.609 -21.195 1.000 95.707 0 36 ARG BBB CB 1 ? 3 ATOM 2284 C CG . ARG B 1 30 ? -30.967 12.390 -20.071 1.000 99.671 0 36 ARG BBB CG 1 ? 3 ATOM 2285 C CD . ARG B 1 30 ? -30.570 11.930 -18.677 1.000 98.028 0 36 ARG BBB CD 1 ? 3 ATOM 2286 N NE . ARG B 1 30 ? -31.635 11.292 -17.897 1.000 99.260 0 36 ARG BBB NE 1 ? 3 ATOM 2287 C CZ . ARG B 1 30 ? -32.142 11.745 -16.747 1.000 99.413 0 36 ARG BBB CZ 1 ? 3 ATOM 2288 N NH1 . ARG B 1 30 ? -33.093 11.057 -16.136 1.000 98.941 0 36 ARG BBB NH1 1 ? 3 ATOM 2289 N NH2 . ARG B 1 30 ? -31.709 12.872 -16.209 1.000 98.219 0 36 ARG BBB NH2 1 ? 3 ATOM 2290 N N . ARG B 1 31 ? -30.384 11.448 -24.925 1.000 91.014 0 37 ARG BBB N 1 ? 3 ATOM 2291 C CA . ARG B 1 31 ? -29.962 10.630 -26.091 1.000 88.143 0 37 ARG BBB CA 1 ? 3 ATOM 2292 C C . ARG B 1 31 ? -28.586 11.132 -26.530 1.000 83.923 0 37 ARG BBB C 1 ? 3 ATOM 2293 O O . ARG B 1 31 ? -28.479 12.321 -26.856 1.000 89.663 0 37 ARG BBB O 1 ? 3 ATOM 2294 C CB . ARG B 1 31 ? -30.978 10.749 -27.232 1.000 95.249 0 37 ARG BBB CB 1 ? 3 ATOM 2295 C CG . ARG B 1 31 ? -31.308 9.432 -27.918 1.000 98.844 0 37 ARG BBB CG 1 ? 3 ATOM 2296 C CD . ARG B 1 31 ? -32.194 9.639 -29.129 1.000 102.664 0 37 ARG BBB CD 1 ? 3 ATOM 2297 N NE . ARG B 1 31 ? -33.519 10.122 -28.752 1.000 110.183 0 37 ARG BBB NE 1 ? 3 ATOM 2298 C CZ . ARG B 1 31 ? -34.005 11.346 -28.972 1.000 113.414 0 37 ARG BBB CZ 1 ? 3 ATOM 2299 N NH1 . ARG B 1 31 ? -33.292 12.270 -29.597 1.000 117.266 0 37 ARG BBB NH1 1 ? 3 ATOM 2300 N NH2 . ARG B 1 31 ? -35.231 11.639 -28.572 1.000 111.386 0 37 ARG BBB NH2 1 ? 3 ATOM 2301 N N . LEU B 1 32 ? -27.572 10.269 -26.521 1.000 76.509 0 38 LEU BBB N 1 ? 3 ATOM 2302 C CA . LEU B 1 32 ? -26.165 10.662 -26.799 1.000 73.362 0 38 LEU BBB CA 1 ? 3 ATOM 2303 C C . LEU B 1 32 ? -25.806 10.324 -28.251 1.000 73.900 0 38 LEU BBB C 1 ? 3 ATOM 2304 O O . LEU B 1 32 ? -26.457 9.448 -28.847 1.000 78.371 0 38 LEU BBB O 1 ? 3 ATOM 2305 C CB . LEU B 1 32 ? -25.242 9.948 -25.805 1.000 73.235 0 38 LEU BBB CB 1 ? 3 ATOM 2306 C CG . LEU B 1 32 ? -24.817 10.757 -24.575 1.000 72.217 0 38 LEU BBB CG 1 ? 3 ATOM 2307 C CD1 . LEU B 1 32 ? -26.016 11.331 -23.830 1.000 77.528 0 38 LEU BBB CD1 1 ? 3 ATOM 2308 C CD2 . LEU B 1 32 ? -23.978 9.897 -23.646 1.000 66.207 0 38 LEU BBB CD2 1 ? 3 ATOM 2309 N N . THR B 1 33 ? -24.818 11.040 -28.792 1.000 73.998 0 39 THR BBB N 1 ? 3 ATOM 2310 C CA . THR B 1 33 ? -24.195 10.801 -30.121 1.000 72.911 0 39 THR BBB CA 1 ? 3 ATOM 2311 C C . THR B 1 33 ? -22.677 10.871 -29.942 1.000 71.885 0 39 THR BBB C 1 ? 3 ATOM 2312 O O . THR B 1 33 ? -22.239 11.216 -28.823 1.000 74.119 0 39 THR BBB O 1 ? 3 ATOM 2313 C CB . THR B 1 33 ? -24.671 11.806 -31.180 1.000 76.507 0 39 THR BBB CB 1 ? 3 ATOM 2314 O OG1 . THR B 1 33 ? -23.788 12.929 -31.166 1.000 78.778 0 39 THR BBB OG1 1 ? 3 ATOM 2315 C CG2 . THR B 1 33 ? -26.100 12.264 -30.980 1.000 77.040 0 39 THR BBB CG2 1 ? 3 ATOM 2316 N N . VAL B 1 34 ? -21.916 10.575 -31.000 1.000 68.395 0 40 VAL BBB N 1 ? 3 ATOM 2317 C CA . VAL B 1 34 ? -20.425 10.615 -30.988 1.000 65.590 0 40 VAL BBB CA 1 ? 3 ATOM 2318 C C . VAL B 1 34 ? -19.973 12.064 -30.765 1.000 67.072 0 40 VAL BBB C 1 ? 3 ATOM 2319 O O . VAL B 1 34 ? -18.867 12.250 -30.231 1.000 70.183 0 40 VAL BBB O 1 ? 3 ATOM 2320 C CB . VAL B 1 34 ? -19.826 10.014 -32.274 1.000 66.941 0 40 VAL BBB CB 1 ? 3 ATOM 2321 C CG1 . VAL B 1 34 ? -20.128 10.862 -33.497 1.000 74.097 0 40 VAL BBB CG1 1 ? 3 ATOM 2322 C CG2 . VAL B 1 34 ? -18.330 9.781 -32.149 1.000 64.947 0 40 VAL BBB CG2 1 ? 3 ATOM 2323 N N . ASP B 1 35 ? -20.805 13.049 -31.118 1.000 68.186 0 41 ASP BBB N 1 ? 3 ATOM 2324 C CA . ASP B 1 35 ? -20.482 14.494 -30.956 1.000 73.944 0 41 ASP BBB CA 1 ? 3 ATOM 2325 C C . ASP B 1 35 ? -20.436 14.863 -29.463 1.000 74.162 0 41 ASP BBB C 1 ? 3 ATOM 2326 O O . ASP B 1 35 ? -19.895 15.941 -29.146 1.000 75.268 0 41 ASP BBB O 1 ? 3 ATOM 2327 C CB . ASP B 1 35 ? -21.469 15.374 -31.727 1.000 80.829 0 41 ASP BBB CB 1 ? 3 ATOM 2328 C CG . ASP B 1 35 ? -21.390 15.223 -33.240 1.000 87.940 0 41 ASP BBB CG 1 ? 3 ATOM 2329 O OD1 . ASP B 1 35 ? -20.640 14.345 -33.711 1.000 86.832 0 41 ASP BBB OD1 1 ? 3 ATOM 2330 O OD2 . ASP B 1 35 ? -22.090 15.980 -33.938 1.000 96.327 0 41 ASP BBB OD2 1 ? 3 ATOM 2331 N N . ASP B 1 36 ? -20.972 14.006 -28.583 1.000 72.565 0 42 ASP BBB N 1 ? 3 ATOM 2332 C CA . ASP B 1 36 ? -21.026 14.216 -27.111 1.000 70.290 0 42 ASP BBB CA 1 ? 3 ATOM 2333 C C . ASP B 1 36 ? -19.756 13.685 -26.433 1.000 66.543 0 42 ASP BBB C 1 ? 3 ATOM 2334 O O . ASP B 1 36 ? -19.615 13.928 -25.221 1.000 64.753 0 42 ASP BBB O 1 ? 3 ATOM 2335 C CB . ASP B 1 36 ? -22.268 13.556 -26.505 1.000 71.135 0 42 ASP BBB CB 1 ? 3 ATOM 2336 C CG . ASP B 1 36 ? -23.558 14.270 -26.862 1.000 76.239 0 42 ASP BBB CG 1 ? 3 ATOM 2337 O OD1 . ASP B 1 36 ? -23.649 15.473 -26.566 1.000 79.683 0 42 ASP BBB OD1 1 ? 3 ATOM 2338 O OD2 . ASP B 1 36 ? -24.458 13.619 -27.435 1.000 76.311 0 42 ASP BBB OD2 1 ? 3 ATOM 2339 N N . PHE B 1 37 ? -18.875 12.991 -27.169 1.000 67.448 0 43 PHE BBB N 1 ? 3 ATOM 2340 C CA . PHE B 1 37 ? -17.630 12.366 -26.638 1.000 65.568 0 43 PHE BBB CA 1 ? 3 ATOM 2341 C C . PHE B 1 37 ? -16.383 13.042 -27.227 1.000 66.656 0 43 PHE BBB C 1 ? 3 ATOM 2342 O O . PHE B 1 37 ? -16.436 13.481 -28.386 1.000 73.126 0 43 PHE BBB O 1 ? 3 ATOM 2343 C CB . PHE B 1 37 ? -17.632 10.864 -26.929 1.000 62.830 0 43 PHE BBB CB 1 ? 3 ATOM 2344 C CG . PHE B 1 37 ? -18.721 10.108 -26.215 1.000 60.168 0 43 PHE BBB CG 1 ? 3 ATOM 2345 C CD1 . PHE B 1 37 ? -19.985 9.994 -26.770 1.000 62.138 0 43 PHE BBB CD1 1 ? 3 ATOM 2346 C CD2 . PHE B 1 37 ? -18.488 9.528 -24.982 1.000 59.411 0 43 PHE BBB CD2 1 ? 3 ATOM 2347 C CE1 . PHE B 1 37 ? -20.989 9.300 -26.113 1.000 59.956 0 43 PHE BBB CE1 1 ? 3 ATOM 2348 C CE2 . PHE B 1 37 ? -19.493 8.839 -24.323 1.000 59.518 0 43 PHE BBB CE2 1 ? 3 ATOM 2349 C CZ . PHE B 1 37 ? -20.741 8.728 -24.889 1.000 59.667 0 43 PHE BBB CZ 1 ? 3 ATOM 2350 N N . GLU B 1 38 ? -15.318 13.158 -26.424 1.000 64.746 0 44 GLU BBB N 1 ? 3 ATOM 2351 C CA . GLU B 1 38 ? -13.922 13.425 -26.873 1.000 67.450 0 44 GLU BBB CA 1 ? 3 ATOM 2352 C C . GLU B 1 38 ? -13.169 12.093 -26.844 1.000 65.736 0 44 GLU BBB C 1 ? 3 ATOM 2353 O O . GLU B 1 38 ? -13.214 11.432 -25.790 1.000 63.306 0 44 GLU BBB O 1 ? 3 ATOM 2354 C CB . GLU B 1 38 ? -13.194 14.429 -25.973 1.000 70.917 0 44 GLU BBB CB 1 ? 3 ATOM 2355 C CG . GLU B 1 38 ? -13.855 15.793 -25.893 1.000 78.521 0 44 GLU BBB CG 1 ? 3 ATOM 2356 C CD . GLU B 1 38 ? -13.242 16.740 -24.872 1.000 85.835 0 44 GLU BBB CD 1 ? 3 ATOM 2357 O OE1 . GLU B 1 38 ? -12.167 17.293 -25.163 1.000 92.396 0 44 GLU BBB OE1 1 ? 3 ATOM 2358 O OE2 . GLU B 1 38 ? -13.836 16.919 -23.784 1.000 84.602 0 44 GLU BBB OE2 1 ? 3 ATOM 2359 N N . ILE B 1 39 ? -12.504 11.725 -27.944 1.000 65.629 0 45 ILE BBB N 1 ? 3 ATOM 2360 C CA . ILE B 1 39 ? -11.799 10.416 -28.088 1.000 61.572 0 45 ILE BBB CA 1 ? 3 ATOM 2361 C C . ILE B 1 39 ? -10.337 10.578 -27.653 1.000 60.886 0 45 ILE BBB C 1 ? 3 ATOM 2362 O O . ILE B 1 39 ? -9.714 11.617 -27.975 1.000 60.566 0 45 ILE BBB O 1 ? 3 ATOM 2363 C CB . ILE B 1 39 ? -11.922 9.871 -29.523 1.000 62.000 0 45 ILE BBB CB 1 ? 3 ATOM 2364 C CG1 . ILE B 1 39 ? -13.361 9.956 -30.043 1.000 66.648 0 45 ILE BBB CG1 1 ? 3 ATOM 2365 C CG2 . ILE B 1 39 ? -11.358 8.459 -29.619 1.000 57.493 0 45 ILE BBB CG2 1 ? 3 ATOM 2366 C CD1 . ILE B 1 39 ? -14.408 9.369 -29.117 1.000 66.520 0 45 ILE BBB CD1 1 ? 3 ATOM 2367 N N . GLY B 1 40 ? -9.826 9.570 -26.942 1.000 59.010 0 46 GLY BBB N 1 ? 3 ATOM 2368 C CA . GLY B 1 40 ? -8.524 9.599 -26.257 1.000 61.438 0 46 GLY BBB CA 1 ? 3 ATOM 2369 C C . GLY B 1 40 ? -7.484 8.759 -26.968 1.000 61.628 0 46 GLY BBB C 1 ? 3 ATOM 2370 O O . GLY B 1 40 ? -6.497 9.351 -27.440 1.000 65.706 0 46 GLY BBB O 1 ? 3 ATOM 2371 N N . ARG B 1 41 ? -7.690 7.438 -27.020 1.000 60.949 0 47 ARG BBB N 1 ? 3 ATOM 2372 C CA . ARG B 1 41 ? -6.689 6.456 -27.519 1.000 67.113 0 47 ARG BBB CA 1 ? 3 ATOM 2373 C C . ARG B 1 41 ? -7.348 5.092 -27.729 1.000 67.699 0 47 ARG BBB C 1 ? 3 ATOM 2374 O O . ARG B 1 41 ? -8.290 4.732 -27.021 1.000 65.359 0 47 ARG BBB O 1 ? 3 ATOM 2375 C CB . ARG B 1 41 ? -5.516 6.355 -26.533 1.000 71.357 0 47 ARG BBB CB 1 ? 3 ATOM 2376 C CG . ARG B 1 41 ? -5.816 5.555 -25.276 1.000 74.072 0 47 ARG BBB CG 1 ? 3 ATOM 2377 C CD . ARG B 1 41 ? -4.545 5.074 -24.603 1.000 83.690 0 47 ARG BBB CD 1 ? 3 ATOM 2378 N NE . ARG B 1 41 ? -3.779 6.165 -24.020 1.000 92.347 0 47 ARG BBB NE 1 ? 3 ATOM 2379 C CZ . ARG B 1 41 ? -2.634 6.017 -23.355 1.000 96.269 0 47 ARG BBB CZ 1 ? 3 ATOM 2380 N NH1 . ARG B 1 41 ? -2.106 4.816 -23.195 1.000 98.755 0 47 ARG BBB NH1 1 ? 3 ATOM 2381 N NH2 . ARG B 1 41 ? -2.018 7.074 -22.851 1.000 100.061 0 47 ARG BBB NH2 1 ? 3 ATOM 2382 N N . PRO B 1 42 ? -6.891 4.297 -28.727 1.000 72.958 0 48 PRO BBB N 1 ? 3 ATOM 2383 C CA . PRO B 1 42 ? -7.342 2.912 -28.890 1.000 73.472 0 48 PRO BBB CA 1 ? 3 ATOM 2384 C C . PRO B 1 42 ? -7.003 1.998 -27.699 1.000 72.962 0 48 PRO BBB C 1 ? 3 ATOM 2385 O O . PRO B 1 42 ? -5.834 1.861 -27.395 1.000 85.161 0 48 PRO BBB O 1 ? 3 ATOM 2386 C CB . PRO B 1 42 ? -6.565 2.413 -30.122 1.000 71.687 0 48 PRO BBB CB 1 ? 3 ATOM 2387 C CG . PRO B 1 42 ? -6.153 3.666 -30.854 1.000 72.729 0 48 PRO BBB CG 1 ? 3 ATOM 2388 C CD . PRO B 1 42 ? -5.945 4.704 -29.777 1.000 72.976 0 48 PRO BBB CD 1 ? 3 ATOM 2389 N N . LEU B 1 43 ? -8.010 1.374 -27.080 1.000 64.997 0 49 LEU BBB N 1 ? 3 ATOM 2390 C CA . LEU B 1 43 ? -7.824 0.436 -25.936 1.000 67.177 0 49 LEU BBB CA 1 ? 3 ATOM 2391 C C . LEU B 1 43 ? -7.670 -1.009 -26.424 1.000 70.325 0 49 LEU BBB C 1 ? 3 ATOM 2392 O O . LEU B 1 43 ? -7.231 -1.842 -25.612 1.000 77.102 0 49 LEU BBB O 1 ? 3 ATOM 2393 C CB . LEU B 1 43 ? -9.008 0.531 -24.967 1.000 64.878 0 49 LEU BBB CB 1 ? 3 ATOM 2394 C CG . LEU B 1 43 ? -8.963 1.670 -23.956 1.000 60.441 0 49 LEU BBB CG 1 ? 3 ATOM 2395 C CD1 . LEU B 1 43 ? -10.296 1.771 -23.240 1.000 60.105 0 49 LEU BBB CD1 1 ? 3 ATOM 2396 C CD2 . LEU B 1 43 ? -7.822 1.488 -22.966 1.000 60.918 0 49 LEU BBB CD2 1 ? 3 ATOM 2397 N N . GLY B 1 44 ? -8.058 -1.322 -27.661 1.000 72.696 0 50 GLY BBB N 1 ? 3 ATOM 2398 C CA . GLY B 1 44 ? -7.870 -2.675 -28.218 1.000 77.848 0 50 GLY BBB CA 1 ? 3 ATOM 2399 C C . GLY B 1 44 ? -8.877 -3.018 -29.298 1.000 80.194 0 50 GLY BBB C 1 ? 3 ATOM 2400 O O . GLY B 1 44 ? -9.756 -2.176 -29.592 1.000 73.987 0 50 GLY BBB O 1 ? 3 ATOM 2401 N N . LYS B 1 45 ? -8.752 -4.230 -29.838 1.000 88.340 0 51 LYS BBB N 1 ? 3 ATOM 2402 C CA . LYS B 1 45 ? -9.511 -4.723 -31.013 1.000 94.937 0 51 LYS BBB CA 1 ? 3 ATOM 2403 C C . LYS B 1 45 ? -10.347 -5.925 -30.558 1.000 100.478 0 51 LYS BBB C 1 ? 3 ATOM 2404 O O . LYS B 1 45 ? -9.749 -6.907 -30.086 1.000 100.207 0 51 LYS BBB O 1 ? 3 ATOM 2405 C CB . LYS B 1 45 ? -8.568 -5.094 -32.171 1.000 101.026 0 51 LYS BBB CB 1 ? 3 ATOM 2406 C CG . LYS B 1 45 ? -7.135 -4.554 -32.123 1.000 112.028 0 51 LYS BBB CG 1 ? 3 ATOM 2407 C CD . LYS B 1 45 ? -6.868 -3.326 -32.981 1.000 119.255 0 51 LYS BBB CD 1 ? 3 ATOM 2408 C CE . LYS B 1 45 ? -6.937 -2.026 -32.207 1.000 122.335 0 51 LYS BBB CE 1 ? 3 ATOM 2409 N NZ . LYS B 1 45 ? -6.761 -0.853 -33.096 1.000 127.839 0 51 LYS BBB NZ 1 ? 3 ATOM 2410 N N . GLY B 1 46 ? -11.677 -5.830 -30.659 1.000 111.576 0 52 GLY BBB N 1 ? 3 ATOM 2411 C CA . GLY B 1 46 ? -12.601 -6.971 -30.504 1.000 112.159 0 52 GLY BBB CA 1 ? 3 ATOM 2412 C C . GLY B 1 46 ? -12.812 -7.671 -31.835 1.000 110.146 0 52 GLY BBB C 1 ? 3 ATOM 2413 O O . GLY B 1 46 ? -12.279 -7.178 -32.850 1.000 99.399 0 52 GLY BBB O 1 ? 3 ATOM 2414 N N . LYS B 1 47 ? -13.569 -8.770 -31.841 1.000 113.369 0 53 LYS BBB N 1 ? 3 ATOM 2415 C CA . LYS B 1 47 ? -13.926 -9.516 -33.078 1.000 124.827 0 53 LYS BBB CA 1 ? 3 ATOM 2416 C C . LYS B 1 47 ? -14.720 -8.582 -34.002 1.000 121.296 0 53 LYS BBB C 1 ? 3 ATOM 2417 O O . LYS B 1 47 ? -14.392 -8.511 -35.208 1.000 107.619 0 53 LYS BBB O 1 ? 3 ATOM 2418 C CB . LYS B 1 47 ? -14.746 -10.771 -32.759 1.000 135.289 0 53 LYS BBB CB 1 ? 3 ATOM 2419 C CG . LYS B 1 47 ? -14.105 -11.788 -31.822 1.000 141.762 0 53 LYS BBB CG 1 ? 3 ATOM 2420 C CD . LYS B 1 47 ? -15.080 -12.845 -31.325 1.000 144.659 0 53 LYS BBB CD 1 ? 3 ATOM 2421 C CE . LYS B 1 47 ? -14.936 -14.184 -32.021 1.000 149.870 0 53 LYS BBB CE 1 ? 3 ATOM 2422 N NZ . LYS B 1 47 ? -13.837 -14.986 -31.433 1.000 152.046 0 53 LYS BBB NZ 1 ? 3 ATOM 2423 N N . PHE B 1 48 ? -15.701 -7.866 -33.442 1.000 125.797 0 54 PHE BBB N 1 ? 3 ATOM 2424 C CA . PHE B 1 48 ? -16.734 -7.097 -34.186 1.000 132.573 0 54 PHE BBB CA 1 ? 3 ATOM 2425 C C . PHE B 1 48 ? -16.259 -5.656 -34.410 1.000 127.981 0 54 PHE BBB C 1 ? 3 ATOM 2426 O O . PHE B 1 48 ? -16.567 -5.089 -35.479 1.000 122.020 0 54 PHE BBB O 1 ? 3 ATOM 2427 C CB . PHE B 1 48 ? -18.076 -7.203 -33.452 1.000 123.824 0 54 PHE BBB CB 1 ? 3 ATOM 2428 C CG . PHE B 1 48 ? -18.600 -8.617 -33.400 1.000 113.684 0 54 PHE BBB CG 1 ? 3 ATOM 2429 C CD1 . PHE B 1 48 ? -18.207 -9.484 -32.395 1.000 98.369 0 54 PHE BBB CD1 1 ? 3 ATOM 2430 C CD2 . PHE B 1 48 ? -19.437 -9.102 -34.394 1.000 112.193 0 54 PHE BBB CD2 1 ? 3 ATOM 2431 C CE1 . PHE B 1 48 ? -18.658 -10.794 -32.373 1.000 97.086 0 54 PHE BBB CE1 1 ? 3 ATOM 2432 C CE2 . PHE B 1 48 ? -19.890 -10.412 -34.367 1.000 107.532 0 54 PHE BBB CE2 1 ? 3 ATOM 2433 C CZ . PHE B 1 48 ? -19.502 -11.256 -33.353 1.000 101.764 0 54 PHE BBB CZ 1 ? 3 ATOM 2434 N N . GLY B 1 49 ? -15.523 -5.085 -33.452 1.000 119.178 0 55 GLY BBB N 1 ? 3 ATOM 2435 C CA . GLY B 1 49 ? -14.944 -3.736 -33.598 1.000 106.693 0 55 GLY BBB CA 1 ? 3 ATOM 2436 C C . GLY B 1 49 ? -14.088 -3.314 -32.418 1.000 91.263 0 55 GLY BBB C 1 ? 3 ATOM 2437 O O . GLY B 1 49 ? -14.106 -4.009 -31.372 1.000 84.627 0 55 GLY BBB O 1 ? 3 ATOM 2438 N N . ASN B 1 50 ? -13.414 -2.173 -32.593 1.000 83.110 0 56 ASN BBB N 1 ? 3 ATOM 2439 C CA . ASN B 1 50 ? -12.402 -1.571 -31.681 1.000 81.253 0 56 ASN BBB CA 1 ? 3 ATOM 2440 C C . ASN B 1 50 ? -13.069 -0.961 -30.440 1.000 68.506 0 56 ASN BBB C 1 ? 3 ATOM 2441 O O . ASN B 1 50 ? -14.258 -0.608 -30.524 1.000 62.550 0 56 ASN BBB O 1 ? 3 ATOM 2442 C CB . ASN B 1 50 ? -11.605 -0.473 -32.393 1.000 84.858 0 56 ASN BBB CB 1 ? 3 ATOM 2443 C CG . ASN B 1 50 ? -10.975 -0.945 -33.684 1.000 89.977 0 56 ASN BBB CG 1 ? 3 ATOM 2444 O OD1 . ASN B 1 50 ? -11.175 -0.344 -34.736 1.000 102.528 0 56 ASN BBB OD1 1 ? 3 ATOM 2445 N ND2 . ASN B 1 50 ? -10.243 -2.042 -33.614 1.000 91.953 0 56 ASN BBB ND2 1 ? 3 ATOM 2446 N N . VAL B 1 51 ? -12.310 -0.833 -29.342 1.000 66.406 0 57 VAL BBB N 1 ? 3 ATOM 2447 C CA . VAL B 1 51 ? -12.705 -0.109 -28.092 1.000 65.224 0 57 VAL BBB CA 1 ? 3 ATOM 2448 C C . VAL B 1 51 ? -11.769 1.091 -27.887 1.000 62.464 0 57 VAL BBB C 1 ? 3 ATOM 2449 O O . VAL B 1 51 ? -10.542 0.891 -27.837 1.000 63.645 0 57 VAL BBB O 1 ? 3 ATOM 2450 C CB . VAL B 1 51 ? -12.681 -1.030 -26.858 1.000 65.722 0 57 VAL BBB CB 1 ? 3 ATOM 2451 C CG1 . VAL B 1 51 ? -13.002 -0.266 -25.585 1.000 70.968 0 57 VAL BBB CG1 1 ? 3 ATOM 2452 C CG2 . VAL B 1 51 ? -13.610 -2.222 -27.012 1.000 66.004 0 57 VAL BBB CG2 1 ? 3 ATOM 2453 N N . TYR B 1 52 ? -12.332 2.292 -27.756 1.000 59.905 0 58 TYR BBB N 1 ? 3 ATOM 2454 C CA . TYR B 1 52 ? -11.574 3.552 -27.559 1.000 62.438 0 58 TYR BBB CA 1 ? 3 ATOM 2455 C C . TYR B 1 52 ? -11.852 4.104 -26.161 1.000 62.841 0 58 TYR BBB C 1 ? 3 ATOM 2456 O O . TYR B 1 52 ? -13.027 4.167 -25.740 1.000 69.212 0 58 TYR BBB O 1 ? 3 ATOM 2457 C CB . TYR B 1 52 ? -11.959 4.586 -28.618 1.000 66.885 0 58 TYR BBB CB 1 ? 3 ATOM 2458 C CG . TYR B 1 52 ? -11.648 4.202 -30.044 1.000 72.260 0 58 TYR BBB CG 1 ? 3 ATOM 2459 C CD1 . TYR B 1 52 ? -12.491 3.356 -30.743 1.000 73.701 0 58 TYR BBB CD1 1 ? 3 ATOM 2460 C CD2 . TYR B 1 52 ? -10.540 4.710 -30.708 1.000 71.168 0 58 TYR BBB CD2 1 ? 3 ATOM 2461 C CE1 . TYR B 1 52 ? -12.242 3.013 -32.060 1.000 77.699 0 58 TYR BBB CE1 1 ? 3 ATOM 2462 C CE2 . TYR B 1 52 ? -10.275 4.375 -32.024 1.000 76.404 0 58 TYR BBB CE2 1 ? 3 ATOM 2463 C CZ . TYR B 1 52 ? -11.129 3.522 -32.702 1.000 80.906 0 58 TYR BBB CZ 1 ? 3 ATOM 2464 O OH . TYR B 1 52 ? -10.896 3.170 -33.998 1.000 84.933 0 58 TYR BBB OH 1 ? 3 ATOM 2465 N N . LEU B 1 53 ? -10.796 4.493 -25.455 1.000 56.379 0 59 LEU BBB N 1 ? 3 ATOM 2466 C CA . LEU B 1 53 ? -10.919 5.387 -24.283 1.000 53.788 0 59 LEU BBB CA 1 ? 3 ATOM 2467 C C . LEU B 1 53 ? -11.512 6.702 -24.782 1.000 53.631 0 59 LEU BBB C 1 ? 3 ATOM 2468 O O . LEU B 1 53 ? -10.955 7.260 -25.743 1.000 53.154 0 59 LEU BBB O 1 ? 3 ATOM 2469 C CB . LEU B 1 53 ? -9.544 5.618 -23.660 1.000 56.124 0 59 LEU BBB CB 1 ? 3 ATOM 2470 C CG . LEU B 1 53 ? -9.557 6.456 -22.389 1.000 58.049 0 59 LEU BBB CG 1 ? 3 ATOM 2471 C CD1 . LEU B 1 53 ? -10.203 5.683 -21.250 1.000 59.843 0 59 LEU BBB CD1 1 ? 3 ATOM 2472 C CD2 . LEU B 1 53 ? -8.146 6.880 -22.018 1.000 61.177 0 59 LEU BBB CD2 1 ? 3 ATOM 2473 N N . ALA B 1 54 ? -12.605 7.154 -24.168 1.000 53.406 0 60 ALA BBB N 1 ? 3 ATOM 2474 C CA . ALA B 1 54 ? -13.282 8.433 -24.478 1.000 55.625 0 60 ALA BBB CA 1 ? 3 ATOM 2475 C C . ALA B 1 54 ? -13.833 9.034 -23.186 1.000 58.429 0 60 ALA BBB C 1 ? 3 ATOM 2476 O O . ALA B 1 54 ? -13.882 8.304 -22.183 1.000 64.201 0 60 ALA BBB O 1 ? 3 ATOM 2477 C CB . ALA B 1 54 ? -14.379 8.198 -25.484 1.000 56.489 0 60 ALA BBB CB 1 ? 3 ATOM 2478 N N . ARG B 1 55 ? -14.228 10.310 -23.222 1.000 58.128 0 61 ARG BBB N 1 ? 3 ATOM 2479 C CA . ARG B 1 55 ? -14.900 11.007 -22.096 1.000 56.066 0 61 ARG BBB CA 1 ? 3 ATOM 2480 C C . ARG B 1 55 ? -16.007 11.923 -22.628 1.000 56.442 0 61 ARG BBB C 1 ? 3 ATOM 2481 O O . ARG B 1 55 ? -15.835 12.494 -23.709 1.000 58.607 0 61 ARG BBB O 1 ? 3 ATOM 2482 C CB . ARG B 1 55 ? -13.863 11.769 -21.270 1.000 59.665 0 61 ARG BBB CB 1 ? 3 ATOM 2483 C CG . ARG B 1 55 ? -13.235 12.973 -21.956 1.000 63.576 0 61 ARG BBB CG 1 ? 3 ATOM 2484 C CD . ARG B 1 55 ? -12.305 13.710 -21.002 1.000 66.131 0 61 ARG BBB CD 1 ? 3 ATOM 2485 N NE . ARG B 1 55 ? -11.816 14.958 -21.576 1.000 71.950 0 61 ARG BBB NE 1 ? 3 ATOM 2486 C CZ . ARG B 1 55 ? -11.193 15.923 -20.903 1.000 72.225 0 61 ARG BBB CZ 1 ? 3 ATOM 2487 N NH1 . ARG B 1 55 ? -10.958 15.798 -19.609 1.000 71.617 0 61 ARG BBB NH1 1 ? 3 ATOM 2488 N NH2 . ARG B 1 55 ? -10.806 17.017 -21.534 1.000 73.290 0 61 ARG BBB NH2 1 ? 3 ATOM 2489 N N . LEU B 1 56 ? -17.112 12.041 -21.889 1.000 55.409 0 62 LEU BBB N 1 ? 3 ATOM 2490 C CA . LEU B 1 56 ? -18.216 12.991 -22.187 1.000 56.840 0 62 LEU BBB CA 1 ? 3 ATOM 2491 C C . LEU B 1 56 ? -17.667 14.420 -22.152 1.000 62.575 0 62 LEU BBB C 1 ? 3 ATOM 2492 O O . LEU B 1 56 ? -16.916 14.732 -21.215 1.000 68.282 0 62 LEU BBB O 1 ? 3 ATOM 2493 C CB . LEU B 1 56 ? -19.330 12.792 -21.158 1.000 54.790 0 62 LEU BBB CB 1 ? 3 ATOM 2494 C CG . LEU B 1 56 ? -20.174 11.538 -21.362 1.000 52.864 0 62 LEU BBB CG 1 ? 3 ATOM 2495 C CD1 . LEU B 1 56 ? -20.787 11.082 -20.052 1.000 54.969 0 62 LEU BBB CD1 1 ? 3 ATOM 2496 C CD2 . LEU B 1 56 ? -21.263 11.776 -22.393 1.000 55.190 0 62 LEU BBB CD2 1 ? 3 ATOM 2497 N N . LYS B 1 57 ? -18.004 15.240 -23.149 1.000 66.498 0 63 LYS BBB N 1 ? 3 ATOM 2498 C CA . LYS B 1 57 ? -17.507 16.638 -23.269 1.000 74.009 0 63 LYS BBB CA 1 ? 3 ATOM 2499 C C . LYS B 1 57 ? -17.925 17.427 -22.026 1.000 78.218 0 63 LYS BBB C 1 ? 3 ATOM 2500 O O . LYS B 1 57 ? -17.060 18.114 -21.450 1.000 79.750 0 63 LYS BBB O 1 ? 3 ATOM 2501 C CB . LYS B 1 57 ? -18.063 17.321 -24.522 1.000 81.038 0 63 LYS BBB CB 1 ? 3 ATOM 2502 C CG . LYS B 1 57 ? -17.400 16.926 -25.834 1.000 86.133 0 63 LYS BBB CG 1 ? 3 ATOM 2503 C CD . LYS B 1 57 ? -18.026 17.581 -27.050 1.000 94.423 0 63 LYS BBB CD 1 ? 3 ATOM 2504 C CE . LYS B 1 57 ? -17.332 17.226 -28.349 1.000 94.794 0 63 LYS BBB CE 1 ? 3 ATOM 2505 N NZ . LYS B 1 57 ? -18.006 17.850 -29.512 1.000 96.975 0 63 LYS BBB NZ 1 ? 3 ATOM 2506 N N . GLU B 1 58 ? -19.201 17.315 -21.643 1.000 81.860 0 64 GLU BBB N 1 ? 3 ATOM 2507 C CA . GLU B 1 58 ? -19.860 18.167 -20.615 1.000 86.553 0 64 GLU BBB CA 1 ? 3 ATOM 2508 C C . GLU B 1 58 ? -19.336 17.809 -19.220 1.000 80.834 0 64 GLU BBB C 1 ? 3 ATOM 2509 O O . GLU B 1 58 ? -18.830 18.720 -18.536 1.000 83.385 0 64 GLU BBB O 1 ? 3 ATOM 2510 C CB . GLU B 1 58 ? -21.385 18.019 -20.664 1.000 92.391 0 64 GLU BBB CB 1 ? 3 ATOM 2511 C CG . GLU B 1 58 ? -22.085 19.058 -21.526 1.000 98.514 0 64 GLU BBB CG 1 ? 3 ATOM 2512 C CD . GLU B 1 58 ? -23.512 19.378 -21.108 1.000 107.384 0 64 GLU BBB CD 1 ? 3 ATOM 2513 O OE1 . GLU B 1 58 ? -23.895 19.015 -19.980 1.000 108.361 0 64 GLU BBB OE1 1 ? 3 ATOM 2514 O OE2 . GLU B 1 58 ? -24.232 20.001 -21.908 1.000 119.037 0 64 GLU BBB OE2 1 ? 3 ATOM 2515 N N . SER B 1 59 ? -19.453 16.536 -18.827 1.000 72.601 0 65 SER BBB N 1 ? 3 ATOM 2516 C CA . SER B 1 59 ? -19.182 16.039 -17.451 1.000 67.582 0 65 SER BBB CA 1 ? 3 ATOM 2517 C C . SER B 1 59 ? -17.720 15.609 -17.291 1.000 65.379 0 65 SER BBB C 1 ? 3 ATOM 2518 O O . SER B 1 59 ? -17.273 15.547 -16.142 1.000 66.775 0 65 SER BBB O 1 ? 3 ATOM 2519 C CB . SER B 1 59 ? -20.098 14.904 -17.101 1.000 64.738 0 65 SER BBB CB 1 ? 3 ATOM 2520 O OG . SER B 1 59 ? -19.536 13.662 -17.500 1.000 61.717 0 65 SER BBB OG 1 ? 3 ATOM 2521 N N . HIS B 1 60 ? -17.020 15.297 -18.389 1.000 64.639 0 66 HIS BBB N 1 ? 3 ATOM 2522 C CA . HIS B 1 60 ? -15.622 14.775 -18.413 1.000 61.958 0 66 HIS BBB CA 1 ? 3 ATOM 2523 C C . HIS B 1 60 ? -15.548 13.369 -17.791 1.000 56.095 0 66 HIS BBB C 1 ? 3 ATOM 2524 O O . HIS B 1 60 ? -14.444 12.989 -17.327 1.000 54.135 0 66 HIS BBB O 1 ? 3 ATOM 2525 C CB . HIS B 1 60 ? -14.648 15.744 -17.717 1.000 64.509 0 66 HIS BBB CB 1 ? 3 ATOM 2526 C CG . HIS B 1 60 ? -14.198 16.891 -18.557 1.000 65.907 0 66 HIS BBB CG 1 ? 3 ATOM 2527 N ND1 . HIS B 1 60 ? -13.638 18.030 -18.000 1.000 70.807 0 66 HIS BBB ND1 1 ? 3 ATOM 2528 C CD2 . HIS B 1 60 ? -14.205 17.084 -19.891 1.000 64.963 0 66 HIS BBB CD2 1 ? 3 ATOM 2529 C CE1 . HIS B 1 60 ? -13.321 18.875 -18.957 1.000 72.050 0 66 HIS BBB CE1 1 ? 3 ATOM 2530 N NE2 . HIS B 1 60 ? -13.660 18.318 -20.127 1.000 70.079 0 66 HIS BBB NE2 1 ? 3 ATOM 2531 N N . PHE B 1 61 ? -16.646 12.605 -17.826 1.000 52.990 0 67 PHE BBB N 1 ? 3 ATOM 2532 C CA . PHE B 1 61 ? -16.728 11.231 -17.265 1.000 53.345 0 67 PHE BBB CA 1 ? 3 ATOM 2533 C C . PHE B 1 61 ? -16.109 10.243 -18.255 1.000 51.176 0 67 PHE BBB C 1 ? 3 ATOM 2534 O O . PHE B 1 61 ? -16.712 10.019 -19.302 1.000 58.061 0 67 PHE BBB O 1 ? 3 ATOM 2535 C CB . PHE B 1 61 ? -18.179 10.850 -16.953 1.000 55.169 0 67 PHE BBB CB 1 ? 3 ATOM 2536 C CG . PHE B 1 61 ? -18.349 9.497 -16.307 1.000 54.653 0 67 PHE BBB CG 1 ? 3 ATOM 2537 C CD1 . PHE B 1 61 ? -18.128 9.328 -14.945 1.000 55.329 0 67 PHE BBB CD1 1 ? 3 ATOM 2538 C CD2 . PHE B 1 61 ? -18.730 8.394 -17.056 1.000 52.578 0 67 PHE BBB CD2 1 ? 3 ATOM 2539 C CE1 . PHE B 1 61 ? -18.291 8.086 -14.350 1.000 53.494 0 67 PHE BBB CE1 1 ? 3 ATOM 2540 C CE2 . PHE B 1 61 ? -18.882 7.148 -16.463 1.000 51.919 0 67 PHE BBB CE2 1 ? 3 ATOM 2541 C CZ . PHE B 1 61 ? -18.666 6.998 -15.111 1.000 53.297 0 67 PHE BBB CZ 1 ? 3 ATOM 2542 N N . ILE B 1 62 ? -14.962 9.651 -17.911 1.000 49.739 0 68 ILE BBB N 1 ? 3 ATOM 2543 C CA . ILE B 1 62 ? -14.228 8.653 -18.750 1.000 47.683 0 68 ILE BBB CA 1 ? 3 ATOM 2544 C C . ILE B 1 62 ? -15.072 7.377 -18.876 1.000 47.886 0 68 ILE BBB C 1 ? 3 ATOM 2545 O O . ILE B 1 62 ? -15.512 6.840 -17.836 1.000 53.068 0 68 ILE BBB O 1 ? 3 ATOM 2546 C CB . ILE B 1 62 ? -12.829 8.350 -18.164 1.000 47.881 0 68 ILE BBB CB 1 ? 3 ATOM 2547 C CG1 . ILE B 1 62 ? -11.827 9.481 -18.431 1.000 49.065 0 68 ILE BBB CG1 1 ? 3 ATOM 2548 C CG2 . ILE B 1 62 ? -12.308 6.999 -18.653 1.000 46.132 0 68 ILE BBB CG2 1 ? 3 ATOM 2549 C CD1 . ILE B 1 62 ? -11.598 10.415 -17.254 1.000 50.636 0 68 ILE BBB CD1 1 ? 3 ATOM 2550 N N . VAL B 1 63 ? -15.250 6.896 -20.109 1.000 47.746 0 69 VAL BBB N 1 ? 3 ATOM 2551 C CA . VAL B 1 63 ? -15.889 5.588 -20.442 1.000 47.140 0 69 VAL BBB CA 1 ? 3 ATOM 2552 C C . VAL B 1 63 ? -14.970 4.814 -21.400 1.000 47.827 0 69 VAL BBB C 1 ? 3 ATOM 2553 O O . VAL B 1 63 ? -14.000 5.416 -21.913 1.000 46.400 0 69 VAL BBB O 1 ? 3 ATOM 2554 C CB . VAL B 1 63 ? -17.277 5.812 -21.063 1.000 47.510 0 69 VAL BBB CB 1 ? 3 ATOM 2555 C CG1 . VAL B 1 63 ? -18.213 6.546 -20.109 1.000 44.166 0 69 VAL BBB CG1 1 ? 3 ATOM 2556 C CG2 . VAL B 1 63 ? -17.169 6.546 -22.399 1.000 49.170 0 69 VAL BBB CG2 1 ? 3 ATOM 2557 N N . ALA B 1 64 ? -15.259 3.525 -21.617 1.000 51.065 0 70 ALA BBB N 1 ? 3 ATOM 2558 C CA . ALA B 1 64 ? -14.701 2.693 -22.715 1.000 55.366 0 70 ALA BBB CA 1 ? 3 ATOM 2559 C C . ALA B 1 64 ? -15.751 2.576 -23.826 1.000 49.939 0 70 ALA BBB C 1 ? 3 ATOM 2560 O O . ALA B 1 64 ? -16.784 1.920 -23.608 1.000 49.623 0 70 ALA BBB O 1 ? 3 ATOM 2561 C CB . ALA B 1 64 ? -14.297 1.329 -22.204 1.000 58.104 0 70 ALA BBB CB 1 ? 3 ATOM 2562 N N . LEU B 1 65 ? -15.506 3.216 -24.965 1.000 49.427 0 71 LEU BBB N 1 ? 3 ATOM 2563 C CA . LEU B 1 65 ? -16.461 3.267 -26.105 1.000 50.642 0 71 LEU BBB CA 1 ? 3 ATOM 2564 C C . LEU B 1 65 ? -16.167 2.103 -27.053 1.000 47.521 0 71 LEU BBB C 1 ? 3 ATOM 2565 O O . LEU B 1 65 ? -15.031 2.057 -27.571 1.000 46.167 0 71 LEU BBB O 1 ? 3 ATOM 2566 C CB . LEU B 1 65 ? -16.293 4.617 -26.804 1.000 54.157 0 71 LEU BBB CB 1 ? 3 ATOM 2567 C CG . LEU B 1 65 ? -17.489 5.101 -27.613 1.000 60.704 0 71 LEU BBB CG 1 ? 3 ATOM 2568 C CD1 . LEU B 1 65 ? -18.798 4.818 -26.894 1.000 61.177 0 71 LEU BBB CD1 1 ? 3 ATOM 2569 C CD2 . LEU B 1 65 ? -17.355 6.588 -27.909 1.000 65.007 0 71 LEU BBB CD2 1 ? 3 ATOM 2570 N N . LYS B 1 66 ? -17.122 1.183 -27.233 1.000 46.526 0 72 LYS BBB N 1 ? 3 ATOM 2571 C CA . LYS B 1 66 ? -16.977 0.031 -28.169 1.000 50.890 0 72 LYS BBB CA 1 ? 3 ATOM 2572 C C . LYS B 1 66 ? -17.799 0.306 -29.430 1.000 50.898 0 72 LYS BBB C 1 ? 3 ATOM 2573 O O . LYS B 1 66 ? -19.037 0.423 -29.318 1.000 48.874 0 72 LYS BBB O 1 ? 3 ATOM 2574 C CB . LYS B 1 66 ? -17.411 -1.301 -27.558 1.000 56.002 0 72 LYS BBB CB 1 ? 3 ATOM 2575 C CG . LYS B 1 66 ? -17.023 -2.529 -28.381 1.000 60.315 0 72 LYS BBB CG 1 ? 3 ATOM 2576 C CD . LYS B 1 66 ? -17.512 -3.836 -27.792 1.000 63.455 0 72 LYS BBB CD 1 ? 3 ATOM 2577 C CE . LYS B 1 66 ? -16.691 -5.041 -28.203 1.000 67.978 0 72 LYS BBB CE 1 ? 3 ATOM 2578 N NZ . LYS B 1 66 ? -17.303 -6.305 -27.725 1.000 68.405 0 72 LYS BBB NZ 1 ? 3 ATOM 2579 N N . VAL B 1 67 ? -17.101 0.400 -30.565 1.000 52.860 0 73 VAL BBB N 1 ? 3 ATOM 2580 C CA . VAL B 1 67 ? -17.647 0.687 -31.924 1.000 58.328 0 73 VAL BBB CA 1 ? 3 ATOM 2581 C C . VAL B 1 67 ? -17.844 -0.641 -32.658 1.000 56.610 0 73 VAL BBB C 1 ? 3 ATOM 2582 O O . VAL B 1 67 ? -16.836 -1.224 -33.079 1.000 57.507 0 73 VAL BBB O 1 ? 3 ATOM 2583 C CB . VAL B 1 67 ? -16.693 1.610 -32.705 1.000 63.386 0 73 VAL BBB CB 1 ? 3 ATOM 2584 C CG1 . VAL B 1 67 ? -17.262 1.984 -34.057 1.000 66.347 0 73 VAL BBB CG1 1 ? 3 ATOM 2585 C CG2 . VAL B 1 67 ? -16.331 2.860 -31.915 1.000 64.136 0 73 VAL BBB CG2 1 ? 3 ATOM 2586 N N . LEU B 1 68 ? -19.092 -1.089 -32.796 1.000 58.126 0 74 LEU BBB N 1 ? 3 ATOM 2587 C CA . LEU B 1 68 ? -19.480 -2.291 -33.585 1.000 65.189 0 74 LEU BBB CA 1 ? 3 ATOM 2588 C C . LEU B 1 68 ? -19.783 -1.894 -35.034 1.000 70.383 0 74 LEU BBB C 1 ? 3 ATOM 2589 O O . LEU B 1 68 ? -20.473 -0.875 -35.214 1.000 74.122 0 74 LEU BBB O 1 ? 3 ATOM 2590 C CB . LEU B 1 68 ? -20.735 -2.900 -32.965 1.000 63.908 0 74 LEU BBB CB 1 ? 3 ATOM 2591 C CG . LEU B 1 68 ? -20.618 -3.322 -31.509 1.000 62.942 0 74 LEU BBB CG 1 ? 3 ATOM 2592 C CD1 . LEU B 1 68 ? -21.998 -3.640 -30.951 1.000 68.393 0 74 LEU BBB CD1 1 ? 3 ATOM 2593 C CD2 . LEU B 1 68 ? -19.675 -4.505 -31.371 1.000 62.426 0 74 LEU BBB CD2 1 ? 3 ATOM 2594 N N . PHE B 1 69 ? -19.327 -2.685 -36.014 1.000 71.036 0 75 PHE BBB N 1 ? 3 ATOM 2595 C CA . PHE B 1 69 ? -19.753 -2.584 -37.435 1.000 75.210 0 75 PHE BBB CA 1 ? 3 ATOM 2596 C C . PHE B 1 69 ? -21.107 -3.283 -37.583 1.000 72.921 0 75 PHE BBB C 1 ? 3 ATOM 2597 O O . PHE B 1 69 ? -21.191 -4.482 -37.275 1.000 70.172 0 75 PHE BBB O 1 ? 3 ATOM 2598 C CB . PHE B 1 69 ? -18.741 -3.215 -38.395 1.000 83.665 0 75 PHE BBB CB 1 ? 3 ATOM 2599 C CG . PHE B 1 69 ? -17.321 -2.715 -38.281 1.000 91.234 0 75 PHE BBB CG 1 ? 3 ATOM 2600 C CD1 . PHE B 1 69 ? -17.042 -1.366 -38.109 1.000 92.576 0 75 PHE BBB CD1 1 ? 3 ATOM 2601 C CD2 . PHE B 1 69 ? -16.254 -3.599 -38.373 1.000 98.187 0 75 PHE BBB CD2 1 ? 3 ATOM 2602 C CE1 . PHE B 1 69 ? -15.732 -0.918 -38.008 1.000 94.973 0 75 PHE BBB CE1 1 ? 3 ATOM 2603 C CE2 . PHE B 1 69 ? -14.946 -3.150 -38.273 1.000 99.001 0 75 PHE BBB CE2 1 ? 3 ATOM 2604 C CZ . PHE B 1 69 ? -14.687 -1.810 -38.091 1.000 96.836 0 75 PHE BBB CZ 1 ? 3 ATOM 2605 N N . LYS B 1 70 ? -22.132 -2.555 -38.036 1.000 74.319 0 76 LYS BBB N 1 ? 3 ATOM 2606 C CA . LYS B 1 70 ? -23.512 -3.087 -38.197 1.000 76.340 0 76 LYS BBB CA 1 ? 3 ATOM 2607 C C . LYS B 1 70 ? -23.471 -4.347 -39.071 1.000 81.528 0 76 LYS BBB C 1 ? 3 ATOM 2608 O O . LYS B 1 70 ? -24.127 -5.342 -38.690 1.000 85.736 0 76 LYS BBB O 1 ? 3 ATOM 2609 C CB . LYS B 1 70 ? -24.436 -2.024 -38.793 1.000 77.812 0 76 LYS BBB CB 1 ? 3 ATOM 2610 C CG . LYS B 1 70 ? -24.965 -1.012 -37.788 1.000 77.174 0 76 LYS BBB CG 1 ? 3 ATOM 2611 C CD . LYS B 1 70 ? -26.010 -0.071 -38.356 1.000 80.763 0 76 LYS BBB CD 1 ? 3 ATOM 2612 C CE . LYS B 1 70 ? -26.887 0.546 -37.283 1.000 77.963 0 76 LYS BBB CE 1 ? 3 ATOM 2613 N NZ . LYS B 1 70 ? -27.830 1.550 -37.828 1.000 78.745 0 76 LYS BBB NZ 1 ? 3 ATOM 2614 N N . SER B 1 71 ? -22.704 -4.302 -40.170 1.000 80.651 0 77 SER BBB N 1 ? 3 ATOM 2615 C CA . SER B 1 71 ? -22.543 -5.382 -41.184 1.000 84.739 0 77 SER BBB CA 1 ? 3 ATOM 2616 C C . SER B 1 71 ? -22.030 -6.682 -40.547 1.000 82.489 0 77 SER BBB C 1 ? 3 ATOM 2617 O O . SER B 1 71 ? -22.373 -7.761 -41.065 1.000 81.131 0 77 SER BBB O 1 ? 3 ATOM 2618 C CB . SER B 1 71 ? -21.626 -4.941 -42.304 1.000 88.737 0 77 SER BBB CB 1 ? 3 ATOM 2619 O OG . SER B 1 71 ? -20.278 -4.850 -41.857 1.000 85.658 0 77 SER BBB OG 1 ? 3 ATOM 2620 N N . GLN B 1 72 ? -21.226 -6.583 -39.481 1.000 82.720 0 78 GLN BBB N 1 ? 3 ATOM 2621 C CA . GLN B 1 72 ? -20.596 -7.750 -38.801 1.000 82.541 0 78 GLN BBB CA 1 ? 3 ATOM 2622 C C . GLN B 1 72 ? -21.622 -8.459 -37.912 1.000 79.299 0 78 GLN BBB C 1 ? 3 ATOM 2623 O O . GLN B 1 72 ? -21.576 -9.705 -37.873 1.000 78.631 0 78 GLN BBB O 1 ? 3 ATOM 2624 C CB . GLN B 1 72 ? -19.363 -7.331 -37.995 1.000 82.845 0 78 GLN BBB CB 1 ? 3 ATOM 2625 C CG . GLN B 1 72 ? -18.112 -7.129 -38.840 1.000 90.936 0 78 GLN BBB CG 1 ? 3 ATOM 2626 C CD . GLN B 1 72 ? -17.726 -8.357 -39.631 1.000 101.023 0 78 GLN BBB CD 1 ? 3 ATOM 2627 O OE1 . GLN B 1 72 ? -17.311 -8.270 -40.785 1.000 106.683 0 78 GLN BBB OE1 1 ? 3 ATOM 2628 N NE2 . GLN B 1 72 ? -17.878 -9.521 -39.019 1.000 103.469 0 78 GLN BBB NE2 1 ? 3 ATOM 2629 N N . ILE B 1 73 ? -22.502 -7.709 -37.232 1.000 77.882 0 79 ILE BBB N 1 ? 3 ATOM 2630 C CA . ILE B 1 73 ? -23.539 -8.260 -36.303 1.000 82.997 0 79 ILE BBB CA 1 ? 3 ATOM 2631 C C . ILE B 1 73 ? -24.607 -8.959 -37.152 1.000 86.388 0 79 ILE BBB C 1 ? 3 ATOM 2632 O O . ILE B 1 73 ? -25.108 -10.032 -36.729 1.000 87.719 0 79 ILE BBB O 1 ? 3 ATOM 2633 C CB . ILE B 1 73 ? -24.148 -7.151 -35.408 1.000 83.227 0 79 ILE BBB CB 1 ? 3 ATOM 2634 C CG1 . ILE B 1 73 ? -23.236 -6.778 -34.238 1.000 84.853 0 79 ILE BBB CG1 1 ? 3 ATOM 2635 C CG2 . ILE B 1 73 ? -25.535 -7.526 -34.904 1.000 82.432 0 79 ILE BBB CG2 1 ? 3 ATOM 2636 C CD1 . ILE B 1 73 ? -22.170 -5.779 -34.591 1.000 89.244 0 79 ILE BBB CD1 1 ? 3 ATOM 2637 N N . GLU B 1 74 ? -24.929 -8.361 -38.303 1.000 87.694 0 80 GLU BBB N 1 ? 3 ATOM 2638 C CA . GLU B 1 74 ? -25.888 -8.895 -39.309 1.000 92.500 0 80 GLU BBB CA 1 ? 3 ATOM 2639 C C . GLU B 1 74 ? -25.356 -10.214 -39.881 1.000 89.082 0 80 GLU BBB C 1 ? 3 ATOM 2640 O O . GLU B 1 74 ? -26.116 -11.202 -39.891 1.000 89.777 0 80 GLU BBB O 1 ? 3 ATOM 2641 C CB . GLU B 1 74 ? -26.115 -7.870 -40.424 1.000 100.354 0 80 GLU BBB CB 1 ? 3 ATOM 2642 C CG . GLU B 1 74 ? -27.081 -6.763 -40.034 1.000 106.213 0 80 GLU BBB CG 1 ? 3 ATOM 2643 C CD . GLU B 1 74 ? -27.164 -5.582 -40.988 1.000 111.344 0 80 GLU BBB CD 1 ? 3 ATOM 2644 O OE1 . GLU B 1 74 ? -26.120 -5.199 -41.558 1.000 116.969 0 80 GLU BBB OE1 1 ? 3 ATOM 2645 O OE2 . GLU B 1 74 ? -28.272 -5.040 -41.146 1.000 113.838 0 80 GLU BBB OE2 1 ? 3 ATOM 2646 N N . LYS B 1 75 ? -24.102 -10.214 -40.341 1.000 85.775 0 81 LYS BBB N 1 ? 3 ATOM 2647 C CA . LYS B 1 75 ? -23.416 -11.390 -40.935 1.000 87.629 0 81 LYS BBB CA 1 ? 3 ATOM 2648 C C . LYS B 1 75 ? -23.562 -12.589 -39.995 1.000 84.958 0 81 LYS BBB C 1 ? 3 ATOM 2649 O O . LYS B 1 75 ? -23.956 -13.660 -40.461 1.000 85.658 0 81 LYS BBB O 1 ? 3 ATOM 2650 C CB . LYS B 1 75 ? -21.940 -11.062 -41.187 1.000 90.017 0 81 LYS BBB CB 1 ? 3 ATOM 2651 C CG . LYS B 1 75 ? -21.174 -12.086 -42.016 1.000 98.125 0 81 LYS BBB CG 1 ? 3 ATOM 2652 C CD . LYS B 1 75 ? -20.169 -11.474 -42.985 1.000 102.006 0 81 LYS BBB CD 1 ? 3 ATOM 2653 C CE . LYS B 1 75 ? -19.655 -12.456 -44.016 1.000 107.835 0 81 LYS BBB CE 1 ? 3 ATOM 2654 N NZ . LYS B 1 75 ? -18.652 -13.385 -43.441 1.000 110.399 0 81 LYS BBB NZ 1 ? 3 ATOM 2655 N N . GLU B 1 76 ? -23.276 -12.390 -38.708 1.000 83.951 0 82 GLU BBB N 1 ? 3 ATOM 2656 C CA . GLU B 1 76 ? -23.168 -13.471 -37.692 1.000 84.829 0 82 GLU BBB CA 1 ? 3 ATOM 2657 C C . GLU B 1 76 ? -24.551 -13.833 -37.136 1.000 84.723 0 82 GLU BBB C 1 ? 3 ATOM 2658 O O . GLU B 1 76 ? -24.621 -14.818 -36.369 1.000 83.448 0 82 GLU BBB O 1 ? 3 ATOM 2659 C CB . GLU B 1 76 ? -22.214 -13.034 -36.579 1.000 82.915 0 82 GLU BBB CB 1 ? 3 ATOM 2660 C CG . GLU B 1 76 ? -20.781 -12.858 -37.046 1.000 84.921 0 82 GLU BBB CG 1 ? 3 ATOM 2661 C CD . GLU B 1 76 ? -20.175 -14.144 -37.579 1.000 92.592 0 82 GLU BBB CD 1 ? 3 ATOM 2662 O OE1 . GLU B 1 76 ? -20.087 -15.120 -36.804 1.000 95.185 0 82 GLU BBB OE1 1 ? 3 ATOM 2663 O OE2 . GLU B 1 76 ? -19.814 -14.177 -38.771 1.000 99.184 0 82 GLU BBB OE2 1 ? 3 ATOM 2664 N N . GLY B 1 77 ? -25.592 -13.067 -37.489 1.000 85.462 0 83 GLY BBB N 1 ? 3 ATOM 2665 C CA . GLY B 1 77 ? -26.988 -13.301 -37.062 1.000 87.032 0 83 GLY BBB CA 1 ? 3 ATOM 2666 C C . GLY B 1 77 ? -27.169 -13.127 -35.560 1.000 84.113 0 83 GLY BBB C 1 ? 3 ATOM 2667 O O . GLY B 1 77 ? -27.908 -13.937 -34.955 1.000 83.518 0 83 GLY BBB O 1 ? 3 ATOM 2668 N N . LEU B 1 78 ? -26.525 -12.106 -34.978 1.000 81.199 0 84 LEU BBB N 1 ? 3 ATOM 2669 C CA . LEU B 1 78 ? -26.532 -11.831 -33.516 1.000 78.162 0 84 LEU BBB CA 1 ? 3 ATOM 2670 C C . LEU B 1 78 ? -27.399 -10.604 -33.213 1.000 76.256 0 84 LEU BBB C 1 ? 3 ATOM 2671 O O . LEU B 1 78 ? -27.074 -9.889 -32.250 1.000 74.706 0 84 LEU BBB O 1 ? 3 ATOM 2672 C CB . LEU B 1 78 ? -25.095 -11.610 -33.029 1.000 77.137 0 84 LEU BBB CB 1 ? 3 ATOM 2673 C CG . LEU B 1 78 ? -24.122 -12.773 -33.237 1.000 80.704 0 84 LEU BBB CG 1 ? 3 ATOM 2674 C CD1 . LEU B 1 78 ? -22.792 -12.505 -32.544 1.000 74.474 0 84 LEU BBB CD1 1 ? 3 ATOM 2675 C CD2 . LEU B 1 78 ? -24.712 -14.089 -32.749 1.000 84.922 0 84 LEU BBB CD2 1 ? 3 ATOM 2676 N N . GLU B 1 79 ? -28.472 -10.380 -33.977 1.000 77.601 0 85 GLU BBB N 1 ? 3 ATOM 2677 C CA . GLU B 1 79 ? -29.390 -9.230 -33.767 1.000 78.402 0 85 GLU BBB CA 1 ? 3 ATOM 2678 C C . GLU B 1 79 ? -30.118 -9.424 -32.429 1.000 76.057 0 85 GLU BBB C 1 ? 3 ATOM 2679 O O . GLU B 1 79 ? -30.103 -8.484 -31.607 1.000 73.109 0 85 GLU BBB O 1 ? 3 ATOM 2680 C CB . GLU B 1 79 ? -30.378 -9.086 -34.928 1.000 87.741 0 85 GLU BBB CB 1 ? 3 ATOM 2681 C CG . GLU B 1 79 ? -29.751 -8.635 -36.241 1.000 94.209 0 85 GLU BBB CG 1 ? 3 ATOM 2682 C CD . GLU B 1 79 ? -29.202 -9.755 -37.116 1.000 100.366 0 85 GLU BBB CD 1 ? 3 ATOM 2683 O OE1 . GLU B 1 79 ? -28.374 -10.536 -36.610 1.000 104.364 0 85 GLU BBB OE1 1 ? 3 ATOM 2684 O OE2 . GLU B 1 79 ? -29.601 -9.849 -38.297 1.000 100.096 0 85 GLU BBB OE2 1 ? 3 ATOM 2685 N N . HIS B 1 80 ? -30.717 -10.603 -32.218 1.000 77.714 0 86 HIS BBB N 1 ? 3 ATOM 2686 C CA . HIS B 1 80 ? -31.472 -10.984 -30.989 1.000 77.367 0 86 HIS BBB CA 1 ? 3 ATOM 2687 C C . HIS B 1 80 ? -30.531 -10.958 -29.780 1.000 73.604 0 86 HIS BBB C 1 ? 3 ATOM 2688 O O . HIS B 1 80 ? -30.860 -10.288 -28.784 1.000 73.845 0 86 HIS BBB O 1 ? 3 ATOM 2689 C CB . HIS B 1 80 ? -32.125 -12.369 -31.138 1.000 81.134 0 86 HIS BBB CB 1 ? 3 ATOM 2690 C CG . HIS B 1 80 ? -33.302 -12.422 -32.053 1.000 84.299 0 86 HIS BBB CG 1 ? 3 ATOM 2691 N ND1 . HIS B 1 80 ? -34.133 -13.528 -32.108 1.000 89.526 0 86 HIS BBB ND1 1 ? 3 ATOM 2692 C CD2 . HIS B 1 80 ? -33.799 -11.529 -32.937 1.000 83.323 0 86 HIS BBB CD2 1 ? 3 ATOM 2693 C CE1 . HIS B 1 80 ? -35.085 -13.320 -32.996 1.000 91.360 0 86 HIS BBB CE1 1 ? 3 ATOM 2694 N NE2 . HIS B 1 80 ? -34.902 -12.098 -33.514 1.000 89.005 0 86 HIS BBB NE2 1 ? 3 ATOM 2695 N N . GLN B 1 81 ? -29.400 -11.657 -29.882 1.000 72.230 0 87 GLN BBB N 1 ? 3 ATOM 2696 C CA . GLN B 1 81 ? -28.370 -11.767 -28.816 1.000 71.806 0 87 GLN BBB CA 1 ? 3 ATOM 2697 C C . GLN B 1 81 ? -28.038 -10.369 -28.277 1.000 69.078 0 87 GLN BBB C 1 ? 3 ATOM 2698 O O . GLN B 1 81 ? -28.070 -10.188 -27.041 1.000 66.195 0 87 GLN BBB O 1 ? 3 ATOM 2699 C CB . GLN B 1 81 ? -27.117 -12.461 -29.351 1.000 72.452 0 87 GLN BBB CB 1 ? 3 ATOM 2700 C CG . GLN B 1 81 ? -27.261 -13.971 -29.501 1.000 77.948 0 87 GLN BBB CG 1 ? 3 ATOM 2701 C CD . GLN B 1 81 ? -27.888 -14.408 -30.806 1.000 83.426 0 87 GLN BBB CD 1 ? 3 ATOM 2702 O OE1 . GLN B 1 81 ? -28.373 -13.598 -31.594 1.000 87.041 0 87 GLN BBB OE1 1 ? 3 ATOM 2703 N NE2 . GLN B 1 81 ? -27.893 -15.711 -31.041 1.000 85.510 0 87 GLN BBB NE2 1 ? 3 ATOM 2704 N N . LEU B 1 82 ? -27.747 -9.425 -29.176 1.000 69.880 0 88 LEU BBB N 1 ? 3 ATOM 2705 C CA . LEU B 1 82 ? -27.376 -8.024 -28.829 1.000 68.279 0 88 LEU BBB CA 1 ? 3 ATOM 2706 C C . LEU B 1 82 ? -28.562 -7.365 -28.118 1.000 68.236 0 88 LEU BBB C 1 ? 3 ATOM 2707 O O . LEU B 1 82 ? -28.323 -6.720 -27.086 1.000 65.587 0 88 LEU BBB O 1 ? 3 ATOM 2708 C CB . LEU B 1 82 ? -26.985 -7.245 -30.093 1.000 68.141 0 88 LEU BBB CB 1 ? 3 ATOM 2709 C CG . LEU B 1 82 ? -25.935 -6.143 -29.914 1.000 65.952 0 88 LEU BBB CG 1 ? 3 ATOM 2710 C CD1 . LEU B 1 82 ? -25.850 -5.274 -31.156 1.000 66.282 0 88 LEU BBB CD1 1 ? 3 ATOM 2711 C CD2 . LEU B 1 82 ? -26.212 -5.275 -28.699 1.000 66.582 0 88 LEU BBB CD2 1 ? 3 ATOM 2712 N N . ARG B 1 83 ? -29.782 -7.527 -28.648 1.000 73.173 0 89 ARG BBB N 1 ? 3 ATOM 2713 C CA . ARG B 1 83 ? -31.032 -7.008 -28.025 1.000 76.827 0 89 ARG BBB CA 1 ? 3 ATOM 2714 C C . ARG B 1 83 ? -31.091 -7.478 -26.564 1.000 75.245 0 89 ARG BBB C 1 ? 3 ATOM 2715 O O . ARG B 1 83 ? -31.341 -6.634 -25.672 1.000 70.011 0 89 ARG BBB O 1 ? 3 ATOM 2716 C CB . ARG B 1 83 ? -32.293 -7.485 -28.761 1.000 82.973 0 89 ARG BBB CB 1 ? 3 ATOM 2717 C CG . ARG B 1 83 ? -33.551 -6.717 -28.370 1.000 87.293 0 89 ARG BBB CG 1 ? 3 ATOM 2718 C CD . ARG B 1 83 ? -34.769 -7.557 -28.015 1.000 91.510 0 89 ARG BBB CD 1 ? 3 ATOM 2719 N NE . ARG B 1 83 ? -34.844 -8.823 -28.738 1.000 97.277 0 89 ARG BBB NE 1 ? 3 ATOM 2720 C CZ . ARG B 1 83 ? -35.548 -9.053 -29.851 1.000 99.414 0 89 ARG BBB CZ 1 ? 3 ATOM 2721 N NH1 . ARG B 1 83 ? -36.264 -8.095 -30.420 1.000 98.714 0 89 ARG BBB NH1 1 ? 3 ATOM 2722 N NH2 . ARG B 1 83 ? -35.534 -10.260 -30.395 1.000 99.660 0 89 ARG BBB NH2 1 ? 3 ATOM 2723 N N . ARG B 1 84 ? -30.849 -8.776 -26.346 1.000 75.305 0 90 ARG BBB N 1 ? 3 ATOM 2724 C CA . ARG B 1 84 ? -30.913 -9.450 -25.022 1.000 74.759 0 90 ARG BBB CA 1 ? 3 ATOM 2725 C C . ARG B 1 84 ? -29.857 -8.838 -24.087 1.000 71.888 0 90 ARG BBB C 1 ? 3 ATOM 2726 O O . ARG B 1 84 ? -30.195 -8.554 -22.923 1.000 69.576 0 90 ARG BBB O 1 ? 3 ATOM 2727 C CB . ARG B 1 84 ? -30.745 -10.963 -25.216 1.000 75.497 0 90 ARG BBB CB 1 ? 3 ATOM 2728 C CG . ARG B 1 84 ? -30.816 -11.791 -23.942 1.000 76.614 0 90 ARG BBB CG 1 ? 3 ATOM 2729 C CD . ARG B 1 84 ? -32.005 -11.446 -23.070 1.000 79.921 0 90 ARG BBB CD 1 ? 3 ATOM 2730 N NE . ARG B 1 84 ? -32.074 -12.282 -21.877 1.000 82.679 0 90 ARG BBB NE 1 ? 3 ATOM 2731 C CZ . ARG B 1 84 ? -32.828 -12.026 -20.813 1.000 84.344 0 90 ARG BBB CZ 1 ? 3 ATOM 2732 N NH1 . ARG B 1 84 ? -33.582 -10.937 -20.764 1.000 84.221 0 90 ARG BBB NH1 1 ? 3 ATOM 2733 N NH2 . ARG B 1 84 ? -32.807 -12.855 -19.785 1.000 88.491 0 90 ARG BBB NH2 1 ? 3 ATOM 2734 N N . GLU B 1 85 ? -28.634 -8.632 -24.586 1.000 69.580 0 91 GLU BBB N 1 ? 3 ATOM 2735 C CA . GLU B 1 85 ? -27.523 -7.975 -23.848 1.000 65.791 0 91 GLU BBB CA 1 ? 3 ATOM 2736 C C . GLU B 1 85 ? -28.010 -6.633 -23.290 1.000 67.574 0 91 GLU BBB C 1 ? 3 ATOM 2737 O O . GLU B 1 85 ? -27.787 -6.378 -22.096 1.000 73.112 0 91 GLU BBB O 1 ? 3 ATOM 2738 C CB . GLU B 1 85 ? -26.327 -7.751 -24.774 1.000 66.718 0 91 GLU BBB CB 1 ? 3 ATOM 2739 C CG . GLU B 1 85 ? -25.123 -7.129 -24.090 1.000 63.298 0 91 GLU BBB CG 1 ? 3 ATOM 2740 C CD . GLU B 1 85 ? -24.387 -8.069 -23.157 1.000 64.311 0 91 GLU BBB CD 1 ? 3 ATOM 2741 O OE1 . GLU B 1 85 ? -24.575 -9.299 -23.307 1.000 66.932 0 91 GLU BBB OE1 1 ? 3 ATOM 2742 O OE2 . GLU B 1 85 ? -23.627 -7.572 -22.289 1.000 59.936 0 91 GLU BBB OE2 1 ? 3 ATOM 2743 N N . ILE B 1 86 ? -28.652 -5.813 -24.128 1.000 68.912 0 92 ILE BBB N 1 ? 3 ATOM 2744 C CA . ILE B 1 86 ? -29.155 -4.455 -23.754 1.000 69.421 0 92 ILE BBB CA 1 ? 3 ATOM 2745 C C . ILE B 1 86 ? -30.252 -4.607 -22.688 1.000 70.561 0 92 ILE BBB C 1 ? 3 ATOM 2746 O O . ILE B 1 86 ? -30.187 -3.891 -21.670 1.000 69.276 0 92 ILE BBB O 1 ? 3 ATOM 2747 C CB . ILE B 1 86 ? -29.655 -3.679 -24.989 1.000 69.978 0 92 ILE BBB CB 1 ? 3 ATOM 2748 C CG1 . ILE B 1 86 ? -28.583 -3.556 -26.075 1.000 68.933 0 92 ILE BBB CG1 1 ? 3 ATOM 2749 C CG2 . ILE B 1 86 ? -30.192 -2.313 -24.589 1.000 70.282 0 92 ILE BBB CG2 1 ? 3 ATOM 2750 C CD1 . ILE B 1 86 ? -27.371 -2.768 -25.658 1.000 67.060 0 92 ILE BBB CD1 1 ? 3 ATOM 2751 N N . GLU B 1 87 ? -31.212 -5.510 -22.912 1.000 72.783 0 93 GLU BBB N 1 ? 3 ATOM 2752 C CA . GLU B 1 87 ? -32.361 -5.761 -22.000 1.000 76.518 0 93 GLU BBB CA 1 ? 3 ATOM 2753 C C . GLU B 1 87 ? -31.839 -6.207 -20.626 1.000 72.829 0 93 GLU BBB C 1 ? 3 ATOM 2754 O O . GLU B 1 87 ? -32.349 -5.690 -19.611 1.000 72.418 0 93 GLU BBB O 1 ? 3 ATOM 2755 C CB . GLU B 1 87 ? -33.303 -6.799 -22.612 1.000 83.711 0 93 GLU BBB CB 1 ? 3 ATOM 2756 C CG . GLU B 1 87 ? -34.536 -7.095 -21.777 1.000 89.487 0 93 GLU BBB CG 1 ? 3 ATOM 2757 C CD . GLU B 1 87 ? -35.539 -8.013 -22.456 1.000 98.921 0 93 GLU BBB CD 1 ? 3 ATOM 2758 O OE1 . GLU B 1 87 ? -35.123 -8.804 -23.336 1.000 99.816 0 93 GLU BBB OE1 1 ? 3 ATOM 2759 O OE2 . GLU B 1 87 ? -36.732 -7.947 -22.095 1.000 105.969 0 93 GLU BBB OE2 1 ? 3 ATOM 2760 N N . ILE B 1 88 ? -30.875 -7.133 -20.594 1.000 68.812 0 94 ILE BBB N 1 ? 3 ATOM 2761 C CA . ILE B 1 88 ? -30.232 -7.621 -19.337 1.000 68.843 0 94 ILE BBB CA 1 ? 3 ATOM 2762 C C . ILE B 1 88 ? -29.564 -6.438 -18.626 1.000 67.986 0 94 ILE BBB C 1 ? 3 ATOM 2763 O O . ILE B 1 88 ? -29.796 -6.281 -17.418 1.000 69.846 0 94 ILE BBB O 1 ? 3 ATOM 2764 C CB . ILE B 1 88 ? -29.227 -8.762 -19.617 1.000 69.356 0 94 ILE BBB CB 1 ? 3 ATOM 2765 C CG1 . ILE B 1 88 ? -29.943 -10.069 -19.960 1.000 73.726 0 94 ILE BBB CG1 1 ? 3 ATOM 2766 C CG2 . ILE B 1 88 ? -28.277 -8.948 -18.444 1.000 67.426 0 94 ILE BBB CG2 1 ? 3 ATOM 2767 C CD1 . ILE B 1 88 ? -30.989 -10.436 -18.949 1.000 80.923 0 94 ILE BBB CD1 1 ? 3 ATOM 2768 N N . GLN B 1 89 ? -28.771 -5.642 -19.348 1.000 63.307 0 95 GLN BBB N 1 ? 3 ATOM 2769 C CA . GLN B 1 89 ? -27.908 -4.582 -18.764 1.000 62.046 0 95 GLN BBB CA 1 ? 3 ATOM 2770 C C . GLN B 1 89 ? -28.749 -3.387 -18.301 1.000 62.578 0 95 GLN BBB C 1 ? 3 ATOM 2771 O O . GLN B 1 89 ? -28.221 -2.566 -17.517 1.000 61.088 0 95 GLN BBB O 1 ? 3 ATOM 2772 C CB . GLN B 1 89 ? -26.865 -4.132 -19.786 1.000 61.971 0 95 GLN BBB CB 1 ? 3 ATOM 2773 C CG . GLN B 1 89 ? -25.740 -5.132 -19.995 1.000 61.898 0 95 GLN BBB CG 1 ? 3 ATOM 2774 C CD . GLN B 1 89 ? -24.522 -4.804 -19.170 1.000 64.237 0 95 GLN BBB CD 1 ? 3 ATOM 2775 O OE1 . GLN B 1 89 ? -24.508 -3.855 -18.390 1.000 65.157 0 95 GLN BBB OE1 1 ? 3 ATOM 2776 N NE2 . GLN B 1 89 ? -23.469 -5.580 -19.349 1.000 70.920 0 95 GLN BBB NE2 1 ? 3 ATOM 2777 N N . ALA B 1 90 ? -29.988 -3.281 -18.787 1.000 64.794 0 96 ALA BBB N 1 ? 3 ATOM 2778 C CA . ALA B 1 90 ? -30.957 -2.221 -18.422 1.000 71.684 0 96 ALA BBB CA 1 ? 3 ATOM 2779 C C . ALA B 1 90 ? -31.704 -2.596 -17.135 1.000 74.395 0 96 ALA BBB C 1 ? 3 ATOM 2780 O O . ALA B 1 90 ? -32.289 -1.690 -16.514 1.000 71.909 0 96 ALA BBB O 1 ? 3 ATOM 2781 C CB . ALA B 1 90 ? -31.924 -1.998 -19.563 1.000 75.938 0 96 ALA BBB CB 1 ? 3 ATOM 2782 N N . HIS B 1 91 ? -31.705 -3.883 -16.770 1.000 80.467 0 97 HIS BBB N 1 ? 3 ATOM 2783 C CA . HIS B 1 91 ? -32.458 -4.458 -15.619 1.000 83.103 0 97 HIS BBB CA 1 ? 3 ATOM 2784 C C . HIS B 1 91 ? -31.490 -4.900 -14.506 1.000 78.561 0 97 HIS BBB C 1 ? 3 ATOM 2785 O O . HIS B 1 91 ? -31.889 -4.784 -13.332 1.000 82.621 0 97 HIS BBB O 1 ? 3 ATOM 2786 C CB . HIS B 1 91 ? -33.371 -5.605 -16.095 1.000 85.528 0 97 HIS BBB CB 1 ? 3 ATOM 2787 C CG . HIS B 1 91 ? -34.640 -5.166 -16.755 1.000 92.047 0 97 HIS BBB CG 1 ? 3 ATOM 2788 N ND1 . HIS B 1 91 ? -34.759 -3.959 -17.424 1.000 91.224 0 97 HIS BBB ND1 1 ? 3 ATOM 2789 C CD2 . HIS B 1 91 ? -35.835 -5.786 -16.883 1.000 97.739 0 97 HIS BBB CD2 1 ? 3 ATOM 2790 C CE1 . HIS B 1 91 ? -35.979 -3.846 -17.913 1.000 95.486 0 97 HIS BBB CE1 1 ? 3 ATOM 2791 N NE2 . HIS B 1 91 ? -36.659 -4.954 -17.595 1.000 98.943 0 97 HIS BBB NE2 1 ? 3 ATOM 2792 N N . LEU B 1 92 ? -30.275 -5.364 -14.847 1.000 71.361 0 98 LEU BBB N 1 ? 3 ATOM 2793 C CA . LEU B 1 92 ? -29.297 -5.978 -13.898 1.000 71.093 0 98 LEU BBB CA 1 ? 3 ATOM 2794 C C . LEU B 1 92 ? -28.024 -5.124 -13.770 1.000 67.350 0 98 LEU BBB C 1 ? 3 ATOM 2795 O O . LEU B 1 92 ? -27.589 -4.525 -14.783 1.000 64.984 0 98 LEU BBB O 1 ? 3 ATOM 2796 C CB . LEU B 1 92 ? -28.946 -7.389 -14.377 1.000 72.036 0 98 LEU BBB CB 1 ? 3 ATOM 2797 C CG . LEU B 1 92 ? -29.874 -8.507 -13.905 1.000 78.728 0 98 LEU BBB CG 1 ? 3 ATOM 2798 C CD1 . LEU B 1 92 ? -31.337 -8.152 -14.126 1.000 82.930 0 98 LEU BBB CD1 1 ? 3 ATOM 2799 C CD2 . LEU B 1 92 ? -29.534 -9.814 -14.602 1.000 81.655 0 98 LEU BBB CD2 1 ? 3 ATOM 2800 N N . GLN B 1 93 ? -27.449 -5.091 -12.561 1.000 65.146 0 99 GLN BBB N 1 ? 3 ATOM 2801 C CA . GLN B 1 93 ? -26.191 -4.374 -12.213 1.000 62.679 0 99 GLN BBB CA 1 ? 3 ATOM 2802 C C . GLN B 1 93 ? -25.404 -5.209 -11.196 1.000 59.776 0 99 GLN BBB C 1 ? 3 ATOM 2803 O O . GLN B 1 93 ? -26.048 -5.877 -10.367 1.000 60.655 0 99 GLN BBB O 1 ? 3 ATOM 2804 C CB . GLN B 1 93 ? -26.500 -2.992 -11.634 1.000 68.689 0 99 GLN BBB CB 1 ? 3 ATOM 2805 C CG . GLN B 1 93 ? -26.898 -1.963 -12.683 1.000 74.411 0 99 GLN BBB CG 1 ? 3 ATOM 2806 C CD . GLN B 1 93 ? -28.328 -2.091 -13.151 1.000 77.368 0 99 GLN BBB CD 1 ? 3 ATOM 2807 O OE1 . GLN B 1 93 ? -29.256 -2.191 -12.346 1.000 75.405 0 99 GLN BBB OE1 1 ? 3 ATOM 2808 N NE2 . GLN B 1 93 ? -28.514 -2.093 -14.465 1.000 72.429 0 99 GLN BBB NE2 1 ? 3 ATOM 2809 N N . HIS B 1 94 ? -24.068 -5.186 -11.265 1.000 57.077 0 100 HIS BBB N 1 ? 3 ATOM 2810 C CA . HIS B 1 94 ? -23.163 -5.890 -10.314 1.000 59.458 0 100 HIS BBB CA 1 ? 3 ATOM 2811 C C . HIS B 1 94 ? -21.761 -5.302 -10.396 1.000 57.237 0 100 HIS BBB C 1 ? 3 ATOM 2812 O O . HIS B 1 94 ? -21.261 -5.033 -11.481 1.000 61.165 0 100 HIS BBB O 1 ? 3 ATOM 2813 C CB . HIS B 1 94 ? -23.136 -7.400 -10.576 1.000 62.305 0 100 HIS BBB CB 1 ? 3 ATOM 2814 C CG . HIS B 1 94 ? -22.458 -8.170 -9.497 1.000 65.307 0 100 HIS BBB CG 1 ? 3 ATOM 2815 N ND1 . HIS B 1 94 ? -23.105 -8.549 -8.345 1.000 71.791 0 100 HIS BBB ND1 1 ? 3 ATOM 2816 C CD2 . HIS B 1 94 ? -21.195 -8.626 -9.381 1.000 68.777 0 100 HIS BBB CD2 1 ? 3 ATOM 2817 C CE1 . HIS B 1 94 ? -22.271 -9.212 -7.563 1.000 75.415 0 100 HIS BBB CE1 1 ? 3 ATOM 2818 N NE2 . HIS B 1 94 ? -21.088 -9.263 -8.172 1.000 71.130 0 100 HIS BBB NE2 1 ? 3 ATOM 2819 N N . PRO B 1 95 ? -21.074 -5.085 -9.254 1.000 59.075 0 101 PRO BBB N 1 ? 3 ATOM 2820 C CA . PRO B 1 95 ? -19.746 -4.469 -9.275 1.000 57.875 0 101 PRO BBB CA 1 ? 3 ATOM 2821 C C . PRO B 1 95 ? -18.648 -5.299 -9.964 1.000 54.363 0 101 PRO BBB C 1 ? 3 ATOM 2822 O O . PRO B 1 95 ? -17.628 -4.733 -10.287 1.000 54.796 0 101 PRO BBB O 1 ? 3 ATOM 2823 C CB . PRO B 1 95 ? -19.390 -4.271 -7.792 1.000 61.147 0 101 PRO BBB CB 1 ? 3 ATOM 2824 C CG . PRO B 1 95 ? -20.690 -4.476 -7.027 1.000 65.002 0 101 PRO BBB CG 1 ? 3 ATOM 2825 C CD . PRO B 1 95 ? -21.549 -5.371 -7.893 1.000 63.006 0 101 PRO BBB CD 1 ? 3 ATOM 2826 N N . ASN B 1 96 ? -18.869 -6.601 -10.167 1.000 53.414 0 102 ASN BBB N 1 ? 3 ATOM 2827 C CA . ASN B 1 96 ? -17.884 -7.535 -10.780 1.000 55.351 0 102 ASN BBB CA 1 ? 3 ATOM 2828 C C . ASN B 1 96 ? -18.374 -8.018 -12.148 1.000 56.541 0 102 ASN BBB C 1 ? 3 ATOM 2829 O O . ASN B 1 96 ? -17.828 -9.035 -12.629 1.000 57.887 0 102 ASN BBB O 1 ? 3 ATOM 2830 C CB . ASN B 1 96 ? -17.594 -8.735 -9.878 1.000 57.035 0 102 ASN BBB CB 1 ? 3 ATOM 2831 C CG . ASN B 1 96 ? -17.107 -8.318 -8.512 1.000 59.929 0 102 ASN BBB CG 1 ? 3 ATOM 2832 O OD1 . ASN B 1 96 ? -17.687 -8.697 -7.497 1.000 65.778 0 102 ASN BBB OD1 1 ? 3 ATOM 2833 N ND2 . ASN B 1 96 ? -16.055 -7.518 -8.480 1.000 58.766 0 102 ASN BBB ND2 1 ? 3 ATOM 2834 N N . ILE B 1 97 ? -19.380 -7.346 -12.722 1.000 55.028 0 103 ILE BBB N 1 ? 3 ATOM 2835 C CA . ILE B 1 97 ? -19.799 -7.493 -14.147 1.000 52.905 0 103 ILE BBB CA 1 ? 3 ATOM 2836 C C . ILE B 1 97 ? -19.681 -6.116 -14.796 1.000 50.468 0 103 ILE BBB C 1 ? 3 ATOM 2837 O O . ILE B 1 97 ? -20.375 -5.200 -14.305 1.000 46.529 0 103 ILE BBB O 1 ? 3 ATOM 2838 C CB . ILE B 1 97 ? -21.234 -8.030 -14.304 1.000 54.778 0 103 ILE BBB CB 1 ? 3 ATOM 2839 C CG1 . ILE B 1 97 ? -21.414 -9.433 -13.720 1.000 59.973 0 103 ILE BBB CG1 1 ? 3 ATOM 2840 C CG2 . ILE B 1 97 ? -21.638 -7.984 -15.771 1.000 54.982 0 103 ILE BBB CG2 1 ? 3 ATOM 2841 C CD1 . ILE B 1 97 ? -22.863 -9.902 -13.681 1.000 61.231 0 103 ILE BBB CD1 1 ? 3 ATOM 2842 N N . LEU B 1 98 ? -18.869 -5.996 -15.859 1.000 47.921 0 104 LEU BBB N 1 ? 3 ATOM 2843 C CA . LEU B 1 98 ? -18.590 -4.705 -16.539 1.000 44.147 0 104 LEU BBB CA 1 ? 3 ATOM 2844 C C . LEU B 1 98 ? -19.922 -4.127 -17.018 1.000 45.262 0 104 LEU BBB C 1 ? 3 ATOM 2845 O O . LEU B 1 98 ? -20.749 -4.889 -17.535 1.000 48.522 0 104 LEU BBB O 1 ? 3 ATOM 2846 C CB . LEU B 1 98 ? -17.612 -4.921 -17.694 1.000 43.840 0 104 LEU BBB CB 1 ? 3 ATOM 2847 C CG . LEU B 1 98 ? -16.907 -3.663 -18.198 1.000 44.706 0 104 LEU BBB CG 1 ? 3 ATOM 2848 C CD1 . LEU B 1 98 ? -15.818 -3.219 -17.226 1.000 45.991 0 104 LEU BBB CD1 1 ? 3 ATOM 2849 C CD2 . LEU B 1 98 ? -16.320 -3.885 -19.586 1.000 46.049 0 104 LEU BBB CD2 1 ? 3 ATOM 2850 N N . ARG B 1 99 ? -20.129 -2.831 -16.809 1.000 46.051 0 105 ARG BBB N 1 ? 3 ATOM 2851 C CA . ARG B 1 99 ? -21.432 -2.153 -17.015 1.000 47.367 0 105 ARG BBB CA 1 ? 3 ATOM 2852 C C . ARG B 1 99 ? -21.557 -1.633 -18.447 1.000 46.600 0 105 ARG BBB C 1 ? 3 ATOM 2853 O O . ARG B 1 99 ? -20.565 -1.107 -18.982 1.000 46.704 0 105 ARG BBB O 1 ? 3 ATOM 2854 C CB . ARG B 1 99 ? -21.549 -0.963 -16.061 1.000 49.988 0 105 ARG BBB CB 1 ? 3 ATOM 2855 C CG . ARG B 1 99 ? -22.919 -0.308 -16.042 1.000 54.708 0 105 ARG BBB CG 1 ? 3 ATOM 2856 C CD . ARG B 1 99 ? -23.724 -0.749 -14.846 1.000 62.340 0 105 ARG BBB CD 1 ? 3 ATOM 2857 N NE . ARG B 1 99 ? -25.038 -0.131 -14.820 1.000 66.656 0 105 ARG BBB NE 1 ? 3 ATOM 2858 C CZ . ARG B 1 99 ? -25.423 0.834 -13.995 1.000 66.068 0 105 ARG BBB CZ 1 ? 3 ATOM 2859 N NH1 . ARG B 1 99 ? -24.580 1.336 -13.109 1.000 69.103 0 105 ARG BBB NH1 1 ? 3 ATOM 2860 N NH2 . ARG B 1 99 ? -26.662 1.291 -14.061 1.000 68.697 0 105 ARG BBB NH2 1 ? 3 ATOM 2861 N N . LEU B 1 100 ? -22.758 -1.730 -19.012 1.000 48.477 0 106 LEU BBB N 1 ? 3 ATOM 2862 C CA . LEU B 1 100 ? -23.214 -0.897 -20.153 1.000 49.822 0 106 LEU BBB CA 1 ? 3 ATOM 2863 C C . LEU B 1 100 ? -24.004 0.278 -19.575 1.000 49.458 0 106 LEU BBB C 1 ? 3 ATOM 2864 O O . LEU B 1 100 ? -25.079 0.033 -18.993 1.000 53.298 0 106 LEU BBB O 1 ? 3 ATOM 2865 C CB . LEU B 1 100 ? -24.078 -1.747 -21.090 1.000 53.773 0 106 LEU BBB CB 1 ? 3 ATOM 2866 C CG . LEU B 1 100 ? -24.505 -1.078 -22.397 1.000 56.506 0 106 LEU BBB CG 1 ? 3 ATOM 2867 C CD1 . LEU B 1 100 ? -23.356 -1.013 -23.390 1.000 57.671 0 106 LEU BBB CD1 1 ? 3 ATOM 2868 C CD2 . LEU B 1 100 ? -25.689 -1.796 -23.012 1.000 59.190 0 106 LEU BBB CD2 1 ? 3 ATOM 2869 N N . TYR B 1 101 ? -23.470 1.496 -19.683 1.000 49.607 0 107 TYR BBB N 1 ? 3 ATOM 2870 C CA . TYR B 1 101 ? -24.135 2.734 -19.200 1.000 53.176 0 107 TYR BBB CA 1 ? 3 ATOM 2871 C C . TYR B 1 101 ? -25.323 3.032 -20.118 1.000 54.632 0 107 TYR BBB C 1 ? 3 ATOM 2872 O O . TYR B 1 101 ? -26.424 3.294 -19.604 1.000 54.307 0 107 TYR BBB O 1 ? 3 ATOM 2873 C CB . TYR B 1 101 ? -23.169 3.921 -19.152 1.000 55.578 0 107 TYR BBB CB 1 ? 3 ATOM 2874 C CG . TYR B 1 101 ? -21.952 3.751 -18.275 1.000 54.486 0 107 TYR BBB CG 1 ? 3 ATOM 2875 C CD1 . TYR B 1 101 ? -22.067 3.482 -16.923 1.000 56.521 0 107 TYR BBB CD1 1 ? 3 ATOM 2876 C CD2 . TYR B 1 101 ? -20.677 3.897 -18.796 1.000 54.698 0 107 TYR BBB CD2 1 ? 3 ATOM 2877 C CE1 . TYR B 1 101 ? -20.948 3.344 -16.115 1.000 57.342 0 107 TYR BBB CE1 1 ? 3 ATOM 2878 C CE2 . TYR B 1 101 ? -19.550 3.762 -18.006 1.000 57.124 0 107 TYR BBB CE2 1 ? 3 ATOM 2879 C CZ . TYR B 1 101 ? -19.684 3.482 -16.659 1.000 57.361 0 107 TYR BBB CZ 1 ? 3 ATOM 2880 O OH . TYR B 1 101 ? -18.566 3.362 -15.888 1.000 52.710 0 107 TYR BBB OH 1 ? 3 ATOM 2881 N N . ASN B 1 102 ? -25.085 2.982 -21.435 1.000 59.152 0 108 ASN BBB N 1 ? 3 ATOM 2882 C CA . ASN B 1 102 ? -26.102 3.144 -22.515 1.000 59.986 0 108 ASN BBB CA 1 ? 3 ATOM 2883 C C . ASN B 1 102 ? -25.446 2.913 -23.889 1.000 61.812 0 108 ASN BBB C 1 ? 3 ATOM 2884 O O . ASN B 1 102 ? -24.219 2.661 -23.938 1.000 60.701 0 108 ASN BBB O 1 ? 3 ATOM 2885 C CB . ASN B 1 102 ? -26.773 4.518 -22.461 1.000 59.445 0 108 ASN BBB CB 1 ? 3 ATOM 2886 C CG . ASN B 1 102 ? -28.233 4.472 -22.843 1.000 64.196 0 108 ASN BBB CG 1 ? 3 ATOM 2887 O OD1 . ASN B 1 102 ? -28.652 3.606 -23.607 1.000 67.275 0 108 ASN BBB OD1 1 ? 3 ATOM 2888 N ND2 . ASN B 1 102 ? -29.010 5.410 -22.331 1.000 69.985 0 108 ASN BBB ND2 1 ? 3 ATOM 2889 N N . TYR B 1 103 ? -26.240 2.991 -24.963 1.000 63.689 0 109 TYR BBB N 1 ? 3 ATOM 2890 C CA . TYR B 1 103 ? -25.814 2.783 -26.373 1.000 62.311 0 109 TYR BBB CA 1 ? 3 ATOM 2891 C C . TYR B 1 103 ? -26.501 3.810 -27.281 1.000 62.595 0 109 TYR BBB C 1 ? 3 ATOM 2892 O O . TYR B 1 103 ? -27.598 4.287 -26.947 1.000 66.632 0 109 TYR BBB O 1 ? 3 ATOM 2893 C CB . TYR B 1 103 ? -26.170 1.368 -26.841 1.000 59.977 0 109 TYR BBB CB 1 ? 3 ATOM 2894 C CG . TYR B 1 103 ? -27.649 1.148 -27.028 1.000 58.298 0 109 TYR BBB CG 1 ? 3 ATOM 2895 C CD1 . TYR B 1 103 ? -28.468 0.877 -25.949 1.000 58.971 0 109 TYR BBB CD1 1 ? 3 ATOM 2896 C CD2 . TYR B 1 103 ? -28.238 1.247 -28.276 1.000 60.446 0 109 TYR BBB CD2 1 ? 3 ATOM 2897 C CE1 . TYR B 1 103 ? -29.832 0.693 -26.104 1.000 62.341 0 109 TYR BBB CE1 1 ? 3 ATOM 2898 C CE2 . TYR B 1 103 ? -29.600 1.068 -28.449 1.000 62.779 0 109 TYR BBB CE2 1 ? 3 ATOM 2899 C CZ . TYR B 1 103 ? -30.401 0.783 -27.360 1.000 63.340 0 109 TYR BBB CZ 1 ? 3 ATOM 2900 O OH . TYR B 1 103 ? -31.744 0.602 -27.515 1.000 65.306 0 109 TYR BBB OH 1 ? 3 ATOM 2901 N N . PHE B 1 104 ? -25.871 4.115 -28.413 1.000 59.489 0 110 PHE BBB N 1 ? 3 ATOM 2902 C CA . PHE B 1 104 ? -26.463 4.867 -29.550 1.000 59.892 0 110 PHE BBB CA 1 ? 3 ATOM 2903 C C . PHE B 1 104 ? -26.050 4.146 -30.839 1.000 59.000 0 110 PHE BBB C 1 ? 3 ATOM 2904 O O . PHE B 1 104 ? -25.325 3.135 -30.752 1.000 55.494 0 110 PHE BBB O 1 ? 3 ATOM 2905 C CB . PHE B 1 104 ? -26.042 6.340 -29.505 1.000 59.325 0 110 PHE BBB CB 1 ? 3 ATOM 2906 C CG . PHE B 1 104 ? -24.558 6.588 -29.381 1.000 58.076 0 110 PHE BBB CG 1 ? 3 ATOM 2907 C CD1 . PHE B 1 104 ? -23.891 6.371 -28.181 1.000 58.546 0 110 PHE BBB CD1 1 ? 3 ATOM 2908 C CD2 . PHE B 1 104 ? -23.824 7.047 -30.461 1.000 56.788 0 110 PHE BBB CD2 1 ? 3 ATOM 2909 C CE1 . PHE B 1 104 ? -22.529 6.614 -28.066 1.000 57.504 0 110 PHE BBB CE1 1 ? 3 ATOM 2910 C CE2 . PHE B 1 104 ? -22.463 7.289 -30.346 1.000 57.308 0 110 PHE BBB CE2 1 ? 3 ATOM 2911 C CZ . PHE B 1 104 ? -21.817 7.073 -29.151 1.000 58.051 0 110 PHE BBB CZ 1 ? 3 ATOM 2912 N N . HIS B 1 105 ? -26.511 4.627 -31.996 1.000 62.933 0 111 HIS BBB N 1 ? 3 ATOM 2913 C CA . HIS B 1 105 ? -26.215 4.004 -33.315 1.000 62.817 0 111 HIS BBB CA 1 ? 3 ATOM 2914 C C . HIS B 1 105 ? -26.233 5.042 -34.444 1.000 64.817 0 111 HIS BBB C 1 ? 3 ATOM 2915 O O . HIS B 1 105 ? -26.969 6.039 -34.339 1.000 62.993 0 111 HIS BBB O 1 ? 3 ATOM 2916 C CB . HIS B 1 105 ? -27.170 2.835 -33.584 1.000 63.621 0 111 HIS BBB CB 1 ? 3 ATOM 2917 C CG . HIS B 1 105 ? -28.575 3.246 -33.849 1.000 66.845 0 111 HIS BBB CG 1 ? 3 ATOM 2918 N ND1 . HIS B 1 105 ? -29.026 3.521 -35.120 1.000 71.384 0 111 HIS BBB ND1 1 ? 3 ATOM 2919 C CD2 . HIS B 1 105 ? -29.627 3.419 -33.023 1.000 70.880 0 111 HIS BBB CD2 1 ? 3 ATOM 2920 C CE1 . HIS B 1 105 ? -30.300 3.854 -35.072 1.000 76.184 0 111 HIS BBB CE1 1 ? 3 ATOM 2921 N NE2 . HIS B 1 105 ? -30.695 3.796 -33.796 1.000 77.324 0 111 HIS BBB NE2 1 ? 3 ATOM 2922 N N . ASP B 1 106 ? -25.419 4.769 -35.471 1.000 67.845 0 112 ASP BBB N 1 ? 3 ATOM 2923 C CA . ASP B 1 106 ? -25.228 5.537 -36.729 1.000 68.328 0 112 ASP BBB CA 1 ? 3 ATOM 2924 C C . ASP B 1 106 ? -25.835 4.736 -37.883 1.000 70.215 0 112 ASP BBB C 1 ? 3 ATOM 2925 O O . ASP B 1 106 ? -26.381 3.649 -37.619 1.000 68.146 0 112 ASP BBB O 1 ? 3 ATOM 2926 C CB . ASP B 1 106 ? -23.736 5.752 -37.009 1.000 69.895 0 112 ASP BBB CB 1 ? 3 ATOM 2927 C CG . ASP B 1 106 ? -23.230 7.160 -36.735 1.000 75.258 0 112 ASP BBB CG 1 ? 3 ATOM 2928 O OD1 . ASP B 1 106 ? -23.994 8.140 -37.008 1.000 78.526 0 112 ASP BBB OD1 1 ? 3 ATOM 2929 O OD2 . ASP B 1 106 ? -22.065 7.266 -36.279 1.000 78.457 0 112 ASP BBB OD2 1 ? 3 ATOM 2930 N N . ALA B 1 107 ? -25.708 5.249 -39.111 1.000 72.187 0 113 ALA BBB N 1 ? 3 ATOM 2931 C CA . ALA B 1 107 ? -26.004 4.541 -40.377 1.000 74.298 0 113 ALA BBB CA 1 ? 3 ATOM 2932 C C . ALA B 1 107 ? -25.161 3.261 -40.487 1.000 71.685 0 113 ALA BBB C 1 ? 3 ATOM 2933 O O . ALA B 1 107 ? -25.705 2.221 -40.924 1.000 72.350 0 113 ALA BBB O 1 ? 3 ATOM 2934 C CB . ALA B 1 107 ? -25.723 5.463 -41.531 1.000 79.765 0 113 ALA BBB CB 1 ? 3 ATOM 2935 N N . ARG B 1 108 ? -23.881 3.345 -40.110 1.000 69.028 0 114 ARG BBB N 1 ? 3 ATOM 2936 C CA . ARG B 1 108 ? -22.859 2.274 -40.277 1.000 67.575 0 114 ARG BBB CA 1 ? 3 ATOM 2937 C C . ARG B 1 108 ? -22.549 1.603 -38.922 1.000 63.506 0 114 ARG BBB C 1 ? 3 ATOM 2938 O O . ARG B 1 108 ? -22.207 0.400 -38.917 1.000 62.003 0 114 ARG BBB O 1 ? 3 ATOM 2939 C CB . ARG B 1 108 ? -21.600 2.876 -40.917 1.000 67.448 0 114 ARG BBB CB 1 ? 3 ATOM 2940 C CG . ARG B 1 108 ? -21.851 3.744 -42.145 1.000 70.060 0 114 ARG BBB CG 1 ? 3 ATOM 2941 C CD . ARG B 1 108 ? -20.556 4.291 -42.712 1.000 71.267 0 114 ARG BBB CD 1 ? 3 ATOM 2942 N NE . ARG B 1 108 ? -20.730 5.333 -43.730 1.000 75.199 0 114 ARG BBB NE 1 ? 3 ATOM 2943 C CZ . ARG B 1 108 ? -20.618 5.177 -45.056 1.000 77.697 0 114 ARG BBB CZ 1 ? 3 ATOM 2944 N NH1 . ARG B 1 108 ? -20.353 3.999 -45.597 1.000 78.686 0 114 ARG BBB NH1 1 ? 3 ATOM 2945 N NH2 . ARG B 1 108 ? -20.788 6.220 -45.847 1.000 80.721 0 114 ARG BBB NH2 1 ? 3 ATOM 2946 N N . ARG B 1 109 ? -22.686 2.323 -37.804 1.000 62.419 0 115 ARG BBB N 1 ? 3 ATOM 2947 C CA . ARG B 1 109 ? -22.107 1.914 -36.493 1.000 60.776 0 115 ARG BBB CA 1 ? 3 ATOM 2948 C C . ARG B 1 109 ? -23.188 1.672 -35.434 1.000 58.661 0 115 ARG BBB C 1 ? 3 ATOM 2949 O O . ARG B 1 109 ? -24.261 2.280 -35.529 1.000 59.492 0 115 ARG BBB O 1 ? 3 ATOM 2950 C CB . ARG B 1 109 ? -21.153 2.996 -35.983 1.000 59.716 0 115 ARG BBB CB 1 ? 3 ATOM 2951 C CG . ARG B 1 109 ? -19.891 3.185 -36.806 1.000 61.789 0 115 ARG BBB CG 1 ? 3 ATOM 2952 C CD . ARG B 1 109 ? -19.197 1.874 -37.109 1.000 63.197 0 115 ARG BBB CD 1 ? 3 ATOM 2953 N NE . ARG B 1 109 ? -17.826 2.055 -37.570 1.000 65.569 0 115 ARG BBB NE 1 ? 3 ATOM 2954 C CZ . ARG B 1 109 ? -17.431 2.026 -38.843 1.000 71.674 0 115 ARG BBB CZ 1 ? 3 ATOM 2955 N NH1 . ARG B 1 109 ? -18.299 1.844 -39.825 1.000 74.208 0 115 ARG BBB NH1 1 ? 3 ATOM 2956 N NH2 . ARG B 1 109 ? -16.156 2.199 -39.133 1.000 75.898 0 115 ARG BBB NH2 1 ? 3 ATOM 2957 N N . VAL B 1 110 ? -22.894 0.789 -34.475 1.000 57.106 0 116 VAL BBB N 1 ? 3 ATOM 2958 C CA . VAL B 1 110 ? -23.560 0.702 -33.138 1.000 58.062 0 116 VAL BBB CA 1 ? 3 ATOM 2959 C C . VAL B 1 110 ? -22.487 0.972 -32.079 1.000 57.033 0 116 VAL BBB C 1 ? 3 ATOM 2960 O O . VAL B 1 110 ? -21.429 0.318 -32.140 1.000 59.419 0 116 VAL BBB O 1 ? 3 ATOM 2961 C CB . VAL B 1 110 ? -24.235 -0.663 -32.894 1.000 56.079 0 116 VAL BBB CB 1 ? 3 ATOM 2962 C CG1 . VAL B 1 110 ? -24.721 -0.802 -31.460 1.000 51.064 0 116 VAL BBB CG1 1 ? 3 ATOM 2963 C CG2 . VAL B 1 110 ? -25.365 -0.922 -33.885 1.000 58.546 0 116 VAL BBB CG2 1 ? 3 ATOM 2964 N N . TYR B 1 111 ? -22.748 1.905 -31.165 1.000 55.462 0 117 TYR BBB N 1 ? 3 ATOM 2965 C CA . TYR B 1 111 ? -21.809 2.319 -30.094 1.000 53.211 0 117 TYR BBB CA 1 ? 3 ATOM 2966 C C . TYR B 1 111 ? -22.340 1.827 -28.749 1.000 50.325 0 117 TYR BBB C 1 ? 3 ATOM 2967 O O . TYR B 1 111 ? -23.500 2.114 -28.389 1.000 48.423 0 117 TYR BBB O 1 ? 3 ATOM 2968 C CB . TYR B 1 111 ? -21.627 3.836 -30.102 1.000 56.710 0 117 TYR BBB CB 1 ? 3 ATOM 2969 C CG . TYR B 1 111 ? -21.198 4.385 -31.437 1.000 61.339 0 117 TYR BBB CG 1 ? 3 ATOM 2970 C CD1 . TYR B 1 111 ? -22.128 4.771 -32.385 1.000 65.309 0 117 TYR BBB CD1 1 ? 3 ATOM 2971 C CD2 . TYR B 1 111 ? -19.860 4.500 -31.759 1.000 62.143 0 117 TYR BBB CD2 1 ? 3 ATOM 2972 C CE1 . TYR B 1 111 ? -21.739 5.276 -33.615 1.000 66.659 0 117 TYR BBB CE1 1 ? 3 ATOM 2973 C CE2 . TYR B 1 111 ? -19.451 4.999 -32.981 1.000 63.126 0 117 TYR BBB CE2 1 ? 3 ATOM 2974 C CZ . TYR B 1 111 ? -20.393 5.387 -33.916 1.000 67.071 0 117 TYR BBB CZ 1 ? 3 ATOM 2975 O OH . TYR B 1 111 ? -19.990 5.880 -35.123 1.000 68.991 0 117 TYR BBB OH 1 ? 3 ATOM 2976 N N . LEU B 1 112 ? -21.506 1.071 -28.042 1.000 49.324 0 118 LEU BBB N 1 ? 3 ATOM 2977 C CA . LEU B 1 112 ? -21.733 0.702 -26.626 1.000 48.879 0 118 LEU BBB CA 1 ? 3 ATOM 2978 C C . LEU B 1 112 ? -20.833 1.582 -25.757 1.000 46.387 0 118 LEU BBB C 1 ? 3 ATOM 2979 O O . LEU B 1 112 ? -19.596 1.540 -25.960 1.000 45.905 0 118 LEU BBB O 1 ? 3 ATOM 2980 C CB . LEU B 1 112 ? -21.441 -0.791 -26.453 1.000 48.665 0 118 LEU BBB CB 1 ? 3 ATOM 2981 C CG . LEU B 1 112 ? -22.279 -1.700 -27.349 1.000 51.139 0 118 LEU BBB CG 1 ? 3 ATOM 2982 C CD1 . LEU B 1 112 ? -22.113 -3.155 -26.943 1.000 53.989 0 118 LEU BBB CD1 1 ? 3 ATOM 2983 C CD2 . LEU B 1 112 ? -23.748 -1.290 -27.329 1.000 49.247 0 118 LEU BBB CD2 1 ? 3 ATOM 2984 N N . ILE B 1 113 ? -21.451 2.391 -24.889 1.000 44.229 0 119 ILE BBB N 1 ? 3 ATOM 2985 C CA . ILE B 1 113 ? -20.770 3.185 -23.826 1.000 43.159 0 119 ILE BBB CA 1 ? 3 ATOM 2986 C C . ILE B 1 113 ? -20.582 2.249 -22.633 1.000 41.354 0 119 ILE BBB C 1 ? 3 ATOM 2987 O O . ILE B 1 113 ? -21.580 1.991 -21.944 1.000 41.377 0 119 ILE BBB O 1 ? 3 ATOM 2988 C CB . ILE B 1 113 ? -21.567 4.440 -23.418 1.000 44.308 0 119 ILE BBB CB 1 ? 3 ATOM 2989 C CG1 . ILE B 1 113 ? -22.137 5.217 -24.605 1.000 45.326 0 119 ILE BBB CG1 1 ? 3 ATOM 2990 C CG2 . ILE B 1 113 ? -20.702 5.336 -22.552 1.000 46.226 0 119 ILE BBB CG2 1 ? 3 ATOM 2991 C CD1 . ILE B 1 113 ? -23.297 6.119 -24.234 1.000 47.435 0 119 ILE BBB CD1 1 ? 3 ATOM 2992 N N . LEU B 1 114 ? -19.365 1.744 -22.428 1.000 40.918 0 120 LEU BBB N 1 ? 3 ATOM 2993 C CA . LEU B 1 114 ? -19.062 0.711 -21.403 1.000 43.393 0 120 LEU BBB CA 1 ? 3 ATOM 2994 C C . LEU B 1 114 ? -18.232 1.295 -20.244 1.000 44.337 0 120 LEU BBB C 1 ? 3 ATOM 2995 O O . LEU B 1 114 ? -17.507 2.302 -20.444 1.000 41.517 0 120 LEU BBB O 1 ? 3 ATOM 2996 C CB . LEU B 1 114 ? -18.317 -0.443 -22.080 1.000 43.668 0 120 LEU BBB CB 1 ? 3 ATOM 2997 C CG . LEU B 1 114 ? -19.122 -1.291 -23.065 1.000 43.692 0 120 LEU BBB CG 1 ? 3 ATOM 2998 C CD1 . LEU B 1 114 ? -18.233 -2.358 -23.690 1.000 43.323 0 120 LEU BBB CD1 1 ? 3 ATOM 2999 C CD2 . LEU B 1 114 ? -20.330 -1.941 -22.400 1.000 41.591 0 120 LEU BBB CD2 1 ? 3 ATOM 3000 N N . GLU B 1 115 ? -18.341 0.670 -19.068 1.000 45.908 0 121 GLU BBB N 1 ? 3 ATOM 3001 C CA . GLU B 1 115 ? -17.444 0.897 -17.902 1.000 51.666 0 121 GLU BBB CA 1 ? 3 ATOM 3002 C C . GLU B 1 115 ? -16.000 0.692 -18.370 1.000 52.186 0 121 GLU BBB C 1 ? 3 ATOM 3003 O O . GLU B 1 115 ? -15.750 -0.330 -19.041 1.000 52.298 0 121 GLU BBB O 1 ? 3 ATOM 3004 C CB . GLU B 1 115 ? -17.787 -0.054 -16.748 1.000 52.867 0 121 GLU BBB CB 1 ? 3 ATOM 3005 C CG . GLU B 1 115 ? -17.030 0.225 -15.460 1.000 53.447 0 121 GLU BBB CG 1 ? 3 ATOM 3006 C CD . GLU B 1 115 ? -17.119 -0.851 -14.386 1.000 57.083 0 121 GLU BBB CD 1 ? 3 ATOM 3007 O OE1 . GLU B 1 115 ? -18.143 -1.562 -14.329 1.000 53.670 0 121 GLU BBB OE1 1 ? 3 ATOM 3008 O OE2 . GLU B 1 115 ? -16.149 -0.980 -13.606 1.000 62.230 0 121 GLU BBB OE2 1 ? 3 ATOM 3009 N N . TYR B 1 116 ? -15.115 1.649 -18.053 1.000 50.827 0 122 TYR BBB N 1 ? 3 ATOM 3010 C CA . TYR B 1 116 ? -13.651 1.596 -18.313 1.000 44.971 0 122 TYR BBB CA 1 ? 3 ATOM 3011 C C . TYR B 1 116 ? -12.993 0.842 -17.154 1.000 42.345 0 122 TYR BBB C 1 ? 3 ATOM 3012 O O . TYR B 1 116 ? -13.192 1.249 -15.997 1.000 47.372 0 122 TYR BBB O 1 ? 3 ATOM 3013 C CB . TYR B 1 116 ? -13.067 3.001 -18.519 1.000 46.470 0 122 TYR BBB CB 1 ? 3 ATOM 3014 C CG . TYR B 1 116 ? -11.566 3.061 -18.696 1.000 49.054 0 122 TYR BBB CG 1 ? 3 ATOM 3015 C CD1 . TYR B 1 116 ? -10.923 2.297 -19.659 1.000 50.499 0 122 TYR BBB CD1 1 ? 3 ATOM 3016 C CD2 . TYR B 1 116 ? -10.781 3.900 -17.919 1.000 49.567 0 122 TYR BBB CD2 1 ? 3 ATOM 3017 C CE1 . TYR B 1 116 ? -9.547 2.333 -19.814 1.000 51.891 0 122 TYR BBB CE1 1 ? 3 ATOM 3018 C CE2 . TYR B 1 116 ? -9.405 3.957 -18.072 1.000 50.407 0 122 TYR BBB CE2 1 ? 3 ATOM 3019 C CZ . TYR B 1 116 ? -8.786 3.170 -19.023 1.000 51.072 0 122 TYR BBB CZ 1 ? 3 ATOM 3020 O OH . TYR B 1 116 ? -7.435 3.208 -19.196 1.000 54.067 0 122 TYR BBB OH 1 ? 3 ATOM 3021 N N . ALA B 1 117 ? -12.289 -0.247 -17.482 1.000 38.554 0 123 ALA BBB N 1 ? 3 ATOM 3022 C CA . ALA B 1 117 ? -11.461 -1.084 -16.588 1.000 39.123 0 123 ALA BBB CA 1 ? 3 ATOM 3023 C C . ALA B 1 117 ? -10.021 -0.573 -16.609 1.000 43.131 0 123 ALA BBB C 1 ? 3 ATOM 3024 O O . ALA B 1 117 ? -9.226 -1.008 -17.439 1.000 42.627 0 123 ALA BBB O 1 ? 3 ATOM 3025 C CB . ALA B 1 117 ? -11.531 -2.533 -17.014 1.000 37.613 0 123 ALA BBB CB 1 ? 3 ATOM 3026 N N . PRO B 1 118 ? -9.626 0.318 -15.667 1.000 52.854 0 124 PRO BBB N 1 ? 4 ATOM 3027 C CA . PRO B 1 118 ? -8.307 0.956 -15.700 1.000 55.134 0 124 PRO BBB CA 1 ? 4 ATOM 3028 C C . PRO B 1 118 ? -7.096 0.009 -15.711 1.000 55.571 0 124 PRO BBB C 1 ? 4 ATOM 3029 O O . PRO B 1 118 ? -6.096 0.409 -16.249 1.000 57.292 0 124 PRO BBB O 1 ? 4 ATOM 3030 C CB . PRO B 1 118 ? -8.258 1.766 -14.393 1.000 56.584 0 124 PRO BBB CB 1 ? 4 ATOM 3031 C CG . PRO B 1 118 ? -9.710 2.000 -14.039 1.000 55.577 0 124 PRO BBB CG 1 ? 4 ATOM 3032 C CD . PRO B 1 118 ? -10.422 0.747 -14.503 1.000 52.617 0 124 PRO BBB CD 1 ? 4 ATOM 3033 N N . ARG B 1 119 ? -7.205 -1.186 -15.116 1.000 58.394 0 125 ARG BBB N 1 ? 4 ATOM 3034 C CA . ARG B 1 119 ? -6.081 -2.154 -14.959 1.000 61.123 0 125 ARG BBB CA 1 ? 4 ATOM 3035 C C . ARG B 1 119 ? -6.153 -3.245 -16.040 1.000 60.294 0 125 ARG BBB C 1 ? 4 ATOM 3036 O O . ARG B 1 119 ? -5.420 -4.237 -15.915 1.000 61.564 0 125 ARG BBB O 1 ? 4 ATOM 3037 C CB . ARG B 1 119 ? -6.090 -2.727 -13.538 1.000 65.524 0 125 ARG BBB CB 1 ? 4 ATOM 3038 C CG . ARG B 1 119 ? -5.569 -1.758 -12.483 1.000 72.761 0 125 ARG BBB CG 1 ? 4 ATOM 3039 C CD . ARG B 1 119 ? -5.337 -2.395 -11.120 1.000 79.668 0 125 ARG BBB CD 1 ? 4 ATOM 3040 N NE . ARG B 1 119 ? -4.201 -1.800 -10.420 1.000 89.032 0 125 ARG BBB NE 1 ? 4 ATOM 3041 C CZ . ARG B 1 119 ? -2.949 -2.262 -10.435 1.000 90.806 0 125 ARG BBB CZ 1 ? 4 ATOM 3042 N NH1 . ARG B 1 119 ? -2.635 -3.359 -11.109 1.000 89.147 0 125 ARG BBB NH1 1 ? 4 ATOM 3043 N NH2 . ARG B 1 119 ? -2.006 -1.624 -9.763 1.000 91.244 0 125 ARG BBB NH2 1 ? 4 ATOM 3044 N N . GLY B 1 120 ? -6.998 -3.064 -17.063 1.000 60.128 0 126 GLY BBB N 1 ? 4 ATOM 3045 C CA . GLY B 1 120 ? -7.021 -3.871 -18.301 1.000 58.905 0 126 GLY BBB CA 1 ? 4 ATOM 3046 C C . GLY B 1 120 ? -7.408 -5.327 -18.085 1.000 58.055 0 126 GLY BBB C 1 ? 4 ATOM 3047 O O . GLY B 1 120 ? -8.233 -5.614 -17.205 1.000 60.688 0 126 GLY BBB O 1 ? 4 ATOM 3048 N N . GLU B 1 121 ? -6.837 -6.214 -18.898 1.000 62.056 0 127 GLU BBB N 1 ? 4 ATOM 3049 C CA . GLU B 1 121 ? -7.195 -7.654 -19.009 1.000 64.694 0 127 GLU BBB CA 1 ? 4 ATOM 3050 C C . GLU B 1 121 ? -6.485 -8.437 -17.897 1.000 57.466 0 127 GLU BBB C 1 ? 4 ATOM 3051 O O . GLU B 1 121 ? -5.321 -8.104 -17.594 1.000 58.471 0 127 GLU BBB O 1 ? 4 ATOM 3052 C CB . GLU B 1 121 ? -6.822 -8.134 -20.416 1.000 73.301 0 127 GLU BBB CB 1 ? 4 ATOM 3053 C CG . GLU B 1 121 ? -7.300 -9.535 -20.760 1.000 82.642 0 127 GLU BBB CG 1 ? 4 ATOM 3054 C CD . GLU B 1 121 ? -7.137 -9.876 -22.231 1.000 93.256 0 127 GLU BBB CD 1 ? 4 ATOM 3055 O OE1 . GLU B 1 121 ? -7.682 -9.115 -23.057 1.000 106.945 0 127 GLU BBB OE1 1 ? 4 ATOM 3056 O OE2 . GLU B 1 121 ? -6.447 -10.880 -22.549 1.000 90.084 0 127 GLU BBB OE2 1 ? 4 ATOM 3057 N N . LEU B 1 122 ? -7.166 -9.419 -17.299 1.000 52.529 0 128 LEU BBB N 1 ? 4 ATOM 3058 C CA . LEU B 1 122 ? -6.621 -10.247 -16.186 1.000 50.912 0 128 LEU BBB CA 1 ? 4 ATOM 3059 C C . LEU B 1 122 ? -5.465 -11.095 -16.720 1.000 53.063 0 128 LEU BBB C 1 ? 4 ATOM 3060 O O . LEU B 1 122 ? -4.415 -11.118 -16.064 1.000 52.232 0 128 LEU BBB O 1 ? 4 ATOM 3061 C CB . LEU B 1 122 ? -7.725 -11.123 -15.582 1.000 49.109 0 128 LEU BBB CB 1 ? 4 ATOM 3062 C CG . LEU B 1 122 ? -7.307 -12.044 -14.431 1.000 49.672 0 128 LEU BBB CG 1 ? 4 ATOM 3063 C CD1 . LEU B 1 122 ? -6.581 -11.278 -13.333 1.000 49.521 0 128 LEU BBB CD1 1 ? 4 ATOM 3064 C CD2 . LEU B 1 122 ? -8.506 -12.776 -13.842 1.000 48.756 0 128 LEU BBB CD2 1 ? 4 ATOM 3065 N N . TYR B 1 123 ? -5.640 -11.741 -17.879 1.000 56.462 0 129 TYR BBB N 1 ? 4 ATOM 3066 C CA . TYR B 1 123 ? -4.614 -12.629 -18.491 1.000 57.636 0 129 TYR BBB CA 1 ? 4 ATOM 3067 C C . TYR B 1 123 ? -3.314 -11.849 -18.681 1.000 56.871 0 129 TYR BBB C 1 ? 4 ATOM 3068 O O . TYR B 1 123 ? -2.232 -12.415 -18.446 1.000 53.983 0 129 TYR BBB O 1 ? 4 ATOM 3069 C CB . TYR B 1 123 ? -5.055 -13.190 -19.843 1.000 60.284 0 129 TYR BBB CB 1 ? 4 ATOM 3070 C CG . TYR B 1 123 ? -4.011 -14.064 -20.490 1.000 62.495 0 129 TYR BBB CG 1 ? 4 ATOM 3071 C CD1 . TYR B 1 123 ? -3.755 -15.342 -20.017 1.000 63.044 0 129 TYR BBB CD1 1 ? 4 ATOM 3072 C CD2 . TYR B 1 123 ? -3.250 -13.601 -21.552 1.000 66.190 0 129 TYR BBB CD2 1 ? 4 ATOM 3073 C CE1 . TYR B 1 123 ? -2.791 -16.151 -20.602 1.000 67.496 0 129 TYR BBB CE1 1 ? 4 ATOM 3074 C CE2 . TYR B 1 123 ? -2.280 -14.394 -22.146 1.000 68.673 0 129 TYR BBB CE2 1 ? 4 ATOM 3075 C CZ . TYR B 1 123 ? -2.044 -15.674 -21.669 1.000 67.626 0 129 TYR BBB CZ 1 ? 4 ATOM 3076 O OH . TYR B 1 123 ? -1.090 -16.452 -22.263 1.000 64.945 0 129 TYR BBB OH 1 ? 4 ATOM 3077 N N . LYS B 1 124 ? -3.428 -10.587 -19.100 1.000 58.246 0 130 LYS BBB N 1 ? 4 ATOM 3078 C CA . LYS B 1 124 ? -2.260 -9.702 -19.344 1.000 61.985 0 130 LYS BBB CA 1 ? 4 ATOM 3079 C C . LYS B 1 124 ? -1.597 -9.402 -17.997 1.000 60.275 0 130 LYS BBB C 1 ? 4 ATOM 3080 O O . LYS B 1 124 ? -0.362 -9.462 -17.932 1.000 60.963 0 130 LYS BBB O 1 ? 4 ATOM 3081 C CB . LYS B 1 124 ? -2.685 -8.435 -20.090 1.000 63.304 0 130 LYS BBB CB 1 ? 4 ATOM 3082 C CG . LYS B 1 124 ? -1.544 -7.551 -20.568 1.000 69.806 0 130 LYS BBB CG 1 ? 4 ATOM 3083 C CD . LYS B 1 124 ? -1.996 -6.139 -20.867 1.000 76.196 0 130 LYS BBB CD 1 ? 4 ATOM 3084 C CE . LYS B 1 124 ? -0.904 -5.264 -21.443 1.000 82.529 0 130 LYS BBB CE 1 ? 4 ATOM 3085 N NZ . LYS B 1 124 ? -0.072 -4.668 -20.375 1.000 83.933 0 130 LYS BBB NZ 1 ? 4 ATOM 3086 N N . GLU B 1 125 ? -2.389 -9.114 -16.962 1.000 59.658 0 131 GLU BBB N 1 ? 4 ATOM 3087 C CA . GLU B 1 125 ? -1.877 -8.856 -15.590 1.000 61.995 0 131 GLU BBB CA 1 ? 4 ATOM 3088 C C . GLU B 1 125 ? -1.179 -10.115 -15.057 1.000 61.484 0 131 GLU BBB C 1 ? 4 ATOM 3089 O O . GLU B 1 125 ? -0.126 -9.969 -14.414 1.000 63.836 0 131 GLU BBB O 1 ? 4 ATOM 3090 C CB . GLU B 1 125 ? -3.010 -8.408 -14.665 1.000 62.900 0 131 GLU BBB CB 1 ? 4 ATOM 3091 C CG . GLU B 1 125 ? -2.579 -8.190 -13.230 1.000 64.732 0 131 GLU BBB CG 1 ? 4 ATOM 3092 C CD . GLU B 1 125 ? -1.377 -7.282 -13.043 1.000 72.065 0 131 GLU BBB CD 1 ? 4 ATOM 3093 O OE1 . GLU B 1 125 ? -1.274 -6.279 -13.772 1.000 78.221 0 131 GLU BBB OE1 1 ? 4 ATOM 3094 O OE2 . GLU B 1 125 ? -0.541 -7.587 -12.166 1.000 76.279 0 131 GLU BBB OE2 1 ? 4 ATOM 3095 N N . LEU B 1 126 ? -1.729 -11.300 -15.329 1.000 59.420 0 132 LEU BBB N 1 ? 4 ATOM 3096 C CA . LEU B 1 126 ? -1.161 -12.603 -14.886 1.000 61.490 0 132 LEU BBB CA 1 ? 4 ATOM 3097 C C . LEU B 1 126 ? 0.223 -12.826 -15.521 1.000 65.028 0 132 LEU BBB C 1 ? 4 ATOM 3098 O O . LEU B 1 126 ? 1.160 -13.166 -14.776 1.000 67.458 0 132 LEU BBB O 1 ? 4 ATOM 3099 C CB . LEU B 1 126 ? -2.131 -13.733 -15.243 1.000 60.030 0 132 LEU BBB CB 1 ? 4 ATOM 3100 C CG . LEU B 1 126 ? -1.670 -15.142 -14.869 1.000 62.197 0 132 LEU BBB CG 1 ? 4 ATOM 3101 C CD1 . LEU B 1 126 ? -1.539 -15.283 -13.365 1.000 65.058 0 132 LEU BBB CD1 1 ? 4 ATOM 3102 C CD2 . LEU B 1 126 ? -2.627 -16.194 -15.410 1.000 63.864 0 132 LEU BBB CD2 1 ? 4 ATOM 3103 N N . GLN B 1 127 ? 0.364 -12.650 -16.836 1.000 66.380 0 133 GLN BBB N 1 ? 4 ATOM 3104 C CA . GLN B 1 127 ? 1.663 -12.859 -17.535 1.000 72.949 0 133 GLN BBB CA 1 ? 4 ATOM 3105 C C . GLN B 1 127 ? 2.713 -11.938 -16.908 1.000 74.398 0 133 GLN BBB C 1 ? 4 ATOM 3106 O O . GLN B 1 127 ? 3.850 -12.406 -16.698 1.000 81.691 0 133 GLN BBB O 1 ? 4 ATOM 3107 C CB . GLN B 1 127 ? 1.575 -12.589 -19.043 1.000 75.949 0 133 GLN BBB CB 1 ? 4 ATOM 3108 C CG . GLN B 1 127 ? 0.728 -13.581 -19.831 1.000 76.107 0 133 GLN BBB CG 1 ? 4 ATOM 3109 C CD . GLN B 1 127 ? 0.831 -15.010 -19.344 1.000 80.635 0 133 GLN BBB CD 1 ? 4 ATOM 3110 O OE1 . GLN B 1 127 ? 0.005 -15.484 -18.561 1.000 74.549 0 133 GLN BBB OE1 1 ? 4 ATOM 3111 N NE2 . GLN B 1 127 ? 1.857 -15.712 -19.803 1.000 83.506 0 133 GLN BBB NE2 1 ? 4 ATOM 3112 N N . LYS B 1 128 ? 2.335 -10.689 -16.619 1.000 70.215 0 134 LYS BBB N 1 ? 4 ATOM 3113 C CA . LYS B 1 128 ? 3.230 -9.652 -16.042 1.000 73.482 0 134 LYS BBB CA 1 ? 4 ATOM 3114 C C . LYS B 1 128 ? 3.593 -10.025 -14.598 1.000 73.509 0 134 LYS BBB C 1 ? 4 ATOM 3115 O O . LYS B 1 128 ? 4.739 -9.765 -14.198 1.000 75.821 0 134 LYS BBB O 1 ? 4 ATOM 3116 C CB . LYS B 1 128 ? 2.563 -8.274 -16.111 1.000 76.550 0 134 LYS BBB CB 1 ? 4 ATOM 3117 C CG . LYS B 1 128 ? 3.211 -7.195 -15.247 1.000 83.440 0 134 LYS BBB CG 1 ? 4 ATOM 3118 C CD . LYS B 1 128 ? 2.511 -5.849 -15.318 1.000 88.690 0 134 LYS BBB CD 1 ? 4 ATOM 3119 C CE . LYS B 1 128 ? 2.426 -5.129 -13.986 1.000 89.648 0 134 LYS BBB CE 1 ? 4 ATOM 3120 N NZ . LYS B 1 128 ? 1.200 -4.297 -13.889 1.000 86.425 0 134 LYS BBB NZ 1 ? 4 ATOM 3121 N N . SER B 1 129 ? 2.653 -10.598 -13.841 1.000 71.504 0 135 SER BBB N 1 ? 4 ATOM 3122 C CA . SER B 1 129 ? 2.834 -10.983 -12.414 1.000 68.061 0 135 SER BBB CA 1 ? 4 ATOM 3123 C C . SER B 1 129 ? 3.511 -12.357 -12.298 1.000 69.143 0 135 SER BBB C 1 ? 4 ATOM 3124 O O . SER B 1 129 ? 3.968 -12.679 -11.191 1.000 66.680 0 135 SER BBB O 1 ? 4 ATOM 3125 C CB . SER B 1 129 ? 1.514 -10.966 -11.675 1.000 64.211 0 135 SER BBB CB 1 ? 4 ATOM 3126 O OG . SER B 1 129 ? 0.998 -9.646 -11.576 1.000 61.480 0 135 SER BBB OG 1 ? 4 ATOM 3127 N N . GLU B 1 130 ? 3.567 -13.133 -13.390 1.000 70.320 0 136 GLU BBB N 1 ? 4 ATOM 3128 C CA . GLU B 1 130 ? 3.942 -14.577 -13.417 1.000 72.166 0 136 GLU BBB CA 1 ? 4 ATOM 3129 C C . GLU B 1 130 ? 2.853 -15.383 -12.694 1.000 70.054 0 136 GLU BBB C 1 ? 4 ATOM 3130 O O . GLU B 1 130 ? 2.258 -16.268 -13.335 1.000 71.451 0 136 GLU BBB O 1 ? 4 ATOM 3131 C CB . GLU B 1 130 ? 5.323 -14.842 -12.807 1.000 77.666 0 136 GLU BBB CB 1 ? 4 ATOM 3132 C CG . GLU B 1 130 ? 6.482 -14.283 -13.619 1.000 84.988 0 136 GLU BBB CG 1 ? 4 ATOM 3133 C CD . GLU B 1 130 ? 7.863 -14.505 -13.013 1.000 93.760 0 136 GLU BBB CD 1 ? 4 ATOM 3134 O OE1 . GLU B 1 130 ? 8.730 -13.616 -13.162 1.000 94.332 0 136 GLU BBB OE1 1 ? 4 ATOM 3135 O OE2 . GLU B 1 130 ? 8.076 -15.567 -12.391 1.000 101.617 0 136 GLU BBB OE2 1 ? 4 ATOM 3136 N N . LYS B 1 131 ? 2.601 -15.088 -11.415 1.000 68.944 0 137 LYS BBB N 1 ? 4 ATOM 3137 C CA . LYS B 1 131 ? 1.545 -15.738 -10.587 1.000 66.736 0 137 LYS BBB CA 1 ? 4 ATOM 3138 C C . LYS B 1 131 ? 0.940 -14.692 -9.644 1.000 64.528 0 137 LYS BBB C 1 ? 4 ATOM 3139 O O . LYS B 1 131 ? 1.619 -13.685 -9.376 1.000 71.768 0 137 LYS BBB O 1 ? 4 ATOM 3140 C CB . LYS B 1 131 ? 2.122 -16.942 -9.832 1.000 68.495 0 137 LYS BBB CB 1 ? 4 ATOM 3141 C CG . LYS B 1 131 ? 3.511 -16.745 -9.229 1.000 71.060 0 137 LYS BBB CG 1 ? 4 ATOM 3142 C CD . LYS B 1 131 ? 4.196 -18.031 -8.813 1.000 72.841 0 137 LYS BBB CD 1 ? 4 ATOM 3143 C CE . LYS B 1 131 ? 5.180 -18.528 -9.851 1.000 80.208 0 137 LYS BBB CE 1 ? 4 ATOM 3144 N NZ . LYS B 1 131 ? 5.298 -20.006 -9.845 1.000 86.599 0 137 LYS BBB NZ 1 ? 4 ATOM 3145 N N . LEU B 1 132 ? -0.294 -14.907 -9.181 1.000 59.793 0 138 LEU BBB N 1 ? 4 ATOM 3146 C CA . LEU B 1 132 ? -0.975 -13.999 -8.221 1.000 61.603 0 138 LEU BBB CA 1 ? 4 ATOM 3147 C C . LEU B 1 132 ? -0.840 -14.562 -6.804 1.000 67.045 0 138 LEU BBB C 1 ? 4 ATOM 3148 O O . LEU B 1 132 ? -0.953 -15.797 -6.634 1.000 68.105 0 138 LEU BBB O 1 ? 4 ATOM 3149 C CB . LEU B 1 132 ? -2.441 -13.817 -8.624 1.000 60.593 0 138 LEU BBB CB 1 ? 4 ATOM 3150 C CG . LEU B 1 132 ? -2.720 -12.566 -9.459 1.000 60.318 0 138 LEU BBB CG 1 ? 4 ATOM 3151 C CD1 . LEU B 1 132 ? -1.878 -12.561 -10.727 1.000 60.298 0 138 LEU BBB CD1 1 ? 4 ATOM 3152 C CD2 . LEU B 1 132 ? -4.198 -12.446 -9.791 1.000 57.310 0 138 LEU BBB CD2 1 ? 4 ATOM 3153 N N . ASP B 1 133 ? -0.572 -13.686 -5.831 1.000 71.521 0 139 ASP BBB N 1 ? 4 ATOM 3154 C CA . ASP B 1 133 ? -0.493 -14.053 -4.392 1.000 74.951 0 139 ASP BBB CA 1 ? 4 ATOM 3155 C C . ASP B 1 133 ? -1.862 -14.582 -3.963 1.000 73.746 0 139 ASP BBB C 1 ? 4 ATOM 3156 O O . ASP B 1 133 ? -2.820 -14.466 -4.751 1.000 79.427 0 139 ASP BBB O 1 ? 4 ATOM 3157 C CB . ASP B 1 133 ? -0.034 -12.879 -3.521 1.000 78.704 0 139 ASP BBB CB 1 ? 4 ATOM 3158 C CG . ASP B 1 133 ? -0.845 -11.611 -3.717 1.000 81.979 0 139 ASP BBB CG 1 ? 4 ATOM 3159 O OD1 . ASP B 1 133 ? -2.077 -11.717 -3.846 1.000 85.023 0 139 ASP BBB OD1 1 ? 4 ATOM 3160 O OD2 . ASP B 1 133 ? -0.232 -10.530 -3.754 1.000 84.264 0 139 ASP BBB OD2 1 ? 4 ATOM 3161 N N . GLU B 1 134 ? -1.950 -15.138 -2.757 1.000 71.954 0 140 GLU BBB N 1 ? 4 ATOM 3162 C CA . GLU B 1 134 ? -3.188 -15.777 -2.243 1.000 68.782 0 140 GLU BBB CA 1 ? 4 ATOM 3163 C C . GLU B 1 134 ? -4.273 -14.707 -2.096 1.000 65.143 0 140 GLU BBB C 1 ? 4 ATOM 3164 O O . GLU B 1 134 ? -5.459 -15.066 -2.248 1.000 66.958 0 140 GLU BBB O 1 ? 4 ATOM 3165 C CB . GLU B 1 134 ? -2.921 -16.468 -0.906 1.000 72.663 0 140 GLU BBB CB 1 ? 4 ATOM 3166 C CG . GLU B 1 134 ? -1.793 -17.478 -0.957 1.000 76.236 0 140 GLU BBB CG 1 ? 4 ATOM 3167 C CD . GLU B 1 134 ? -1.638 -18.276 0.321 1.000 81.319 0 140 GLU BBB CD 1 ? 4 ATOM 3168 O OE1 . GLU B 1 134 ? -2.670 -18.694 0.878 1.000 81.128 0 140 GLU BBB OE1 1 ? 4 ATOM 3169 O OE2 . GLU B 1 134 ? -0.489 -18.462 0.761 1.000 88.013 0 140 GLU BBB OE2 1 ? 4 ATOM 3170 N N . GLN B 1 135 ? -3.869 -13.457 -1.819 1.000 62.066 0 141 GLN BBB N 1 ? 4 ATOM 3171 C CA A GLN B 1 135 ? -4.786 -12.317 -1.536 0.200 58.492 0 141 GLN BBB CA 1 ? 4 ATOM 3172 C CA B GLN B 1 135 ? -4.783 -12.313 -1.540 0.800 61.788 0 141 GLN BBB CA 1 ? 4 ATOM 3173 C C . GLN B 1 135 ? -5.588 -11.991 -2.807 1.000 56.045 0 141 GLN BBB C 1 ? 4 ATOM 3174 O O . GLN B 1 135 ? -6.836 -12.073 -2.768 1.000 50.328 0 141 GLN BBB O 1 ? 4 ATOM 3175 C CB A GLN B 1 135 ? -3.980 -11.116 -1.021 0.200 58.121 0 141 GLN BBB CB 1 ? 4 ATOM 3176 C CB B GLN B 1 135 ? -4.008 -11.070 -1.081 0.800 66.914 0 141 GLN BBB CB 1 ? 4 ATOM 3177 C CG A GLN B 1 135 ? -4.747 -10.224 -0.053 0.200 57.289 0 141 GLN BBB CG 1 ? 4 ATOM 3178 C CG B GLN B 1 135 ? -3.810 -10.964 0.430 0.800 75.242 0 141 GLN BBB CG 1 ? 4 ATOM 3179 C CD A GLN B 1 135 ? -3.845 -9.334 0.772 0.200 57.594 0 141 GLN BBB CD 1 ? 4 ATOM 3180 C CD B GLN B 1 135 ? -2.815 -11.954 0.988 0.800 77.330 0 141 GLN BBB CD 1 ? 4 ATOM 3181 O OE1 A GLN B 1 135 ? -3.438 -9.682 1.879 0.200 57.097 0 141 GLN BBB OE1 1 ? 4 ATOM 3182 O OE1 B GLN B 1 135 ? -3.015 -12.515 2.062 0.800 74.476 0 141 GLN BBB OE1 1 ? 4 ATOM 3183 N NE2 A GLN B 1 135 ? -3.526 -8.168 0.235 0.200 56.998 0 141 GLN BBB NE2 1 ? 4 ATOM 3184 N NE2 B GLN B 1 135 ? -1.729 -12.180 0.262 0.800 76.668 0 141 GLN BBB NE2 1 ? 4 ATOM 3185 N N . ARG B 1 136 ? -4.890 -11.658 -3.892 1.000 54.585 0 142 ARG BBB N 1 ? 4 ATOM 3186 C CA . ARG B 1 136 ? -5.494 -11.197 -5.170 1.000 53.485 0 142 ARG BBB CA 1 ? 4 ATOM 3187 C C . ARG B 1 136 ? -6.368 -12.310 -5.768 1.000 49.562 0 142 ARG BBB C 1 ? 4 ATOM 3188 O O . ARG B 1 136 ? -7.493 -12.002 -6.229 1.000 45.637 0 142 ARG BBB O 1 ? 4 ATOM 3189 C CB . ARG B 1 136 ? -4.387 -10.752 -6.124 1.000 56.055 0 142 ARG BBB CB 1 ? 4 ATOM 3190 C CG . ARG B 1 136 ? -3.592 -9.549 -5.634 1.000 59.436 0 142 ARG BBB CG 1 ? 4 ATOM 3191 C CD . ARG B 1 136 ? -2.322 -9.340 -6.432 1.000 63.145 0 142 ARG BBB CD 1 ? 4 ATOM 3192 N NE . ARG B 1 136 ? -2.639 -8.840 -7.759 1.000 68.430 0 142 ARG BBB NE 1 ? 4 ATOM 3193 C CZ . ARG B 1 136 ? -1.783 -8.762 -8.778 1.000 74.722 0 142 ARG BBB CZ 1 ? 4 ATOM 3194 N NH1 . ARG B 1 136 ? -0.523 -9.149 -8.631 1.000 75.998 0 142 ARG BBB NH1 1 ? 4 ATOM 3195 N NH2 . ARG B 1 136 ? -2.198 -8.296 -9.946 1.000 68.856 0 142 ARG BBB NH2 1 ? 4 ATOM 3196 N N . THR B 1 137 ? -5.876 -13.550 -5.726 1.000 50.215 0 143 THR BBB N 1 ? 4 ATOM 3197 C CA . THR B 1 137 ? -6.556 -14.776 -6.227 1.000 52.729 0 143 THR BBB CA 1 ? 4 ATOM 3198 C C . THR B 1 137 ? -7.882 -15.013 -5.481 1.000 55.982 0 143 THR BBB C 1 ? 4 ATOM 3199 O O . THR B 1 137 ? -8.917 -15.162 -6.156 1.000 57.182 0 143 THR BBB O 1 ? 4 ATOM 3200 C CB . THR B 1 137 ? -5.620 -15.983 -6.096 1.000 52.802 0 143 THR BBB CB 1 ? 4 ATOM 3201 O OG1 . THR B 1 137 ? -4.454 -15.655 -6.848 1.000 53.243 0 143 THR BBB OG1 1 ? 4 ATOM 3202 C CG2 . THR B 1 137 ? -6.236 -17.278 -6.582 1.000 53.403 0 143 THR BBB CG2 1 ? 4 ATOM 3203 N N . ALA B 1 138 ? -7.851 -15.067 -4.145 1.000 55.686 0 144 ALA BBB N 1 ? 4 ATOM 3204 C CA . ALA B 1 138 ? -9.021 -15.369 -3.287 1.000 57.008 0 144 ALA BBB CA 1 ? 4 ATOM 3205 C C . ALA B 1 138 ? -10.049 -14.229 -3.359 1.000 54.781 0 144 ALA BBB C 1 ? 4 ATOM 3206 O O . ALA B 1 138 ? -11.275 -14.503 -3.202 1.000 58.776 0 144 ALA BBB O 1 ? 4 ATOM 3207 C CB . ALA B 1 138 ? -8.581 -15.609 -1.862 1.000 59.623 0 144 ALA BBB CB 1 ? 4 ATOM 3208 N N . THR B 1 139 ? -9.580 -12.993 -3.547 1.000 50.383 0 145 THR BBB N 1 ? 4 ATOM 3209 C CA . THR B 1 139 ? -10.454 -11.808 -3.739 1.000 50.140 0 145 THR BBB CA 1 ? 4 ATOM 3210 C C . THR B 1 139 ? -11.254 -11.994 -5.033 1.000 49.977 0 145 THR BBB C 1 ? 4 ATOM 3211 O O . THR B 1 139 ? -12.481 -11.789 -4.997 1.000 53.060 0 145 THR BBB O 1 ? 4 ATOM 3212 C CB . THR B 1 139 ? -9.658 -10.496 -3.746 1.000 50.898 0 145 THR BBB CB 1 ? 4 ATOM 3213 O OG1 . THR B 1 139 ? -8.834 -10.420 -2.579 1.000 48.544 0 145 THR BBB OG1 1 ? 4 ATOM 3214 C CG2 . THR B 1 139 ? -10.557 -9.277 -3.809 1.000 50.620 0 145 THR BBB CG2 1 ? 4 ATOM 3215 N N . ILE B 1 140 ? -10.594 -12.398 -6.121 1.000 48.378 0 146 ILE BBB N 1 ? 4 ATOM 3216 C CA . ILE B 1 140 ? -11.245 -12.632 -7.446 1.000 48.217 0 146 ILE BBB CA 1 ? 4 ATOM 3217 C C . ILE B 1 140 ? -12.268 -13.775 -7.293 1.000 48.857 0 146 ILE BBB C 1 ? 4 ATOM 3218 O O . ILE B 1 140 ? -13.435 -13.578 -7.671 1.000 50.937 0 146 ILE BBB O 1 ? 4 ATOM 3219 C CB . ILE B 1 140 ? -10.184 -12.878 -8.551 1.000 45.873 0 146 ILE BBB CB 1 ? 4 ATOM 3220 C CG1 . ILE B 1 140 ? -9.418 -11.598 -8.897 1.000 43.911 0 146 ILE BBB CG1 1 ? 4 ATOM 3221 C CG2 . ILE B 1 140 ? -10.805 -13.480 -9.799 1.000 46.456 0 146 ILE BBB CG2 1 ? 4 ATOM 3222 C CD1 . ILE B 1 140 ? -7.997 -11.825 -9.358 1.000 43.600 0 146 ILE BBB CD1 1 ? 4 ATOM 3223 N N . ILE B 1 141 ? -11.866 -14.906 -6.715 1.000 49.157 0 147 ILE BBB N 1 ? 4 ATOM 3224 C CA . ILE B 1 141 ? -12.711 -16.134 -6.588 1.000 53.400 0 147 ILE BBB CA 1 ? 4 ATOM 3225 C C . ILE B 1 141 ? -14.030 -15.801 -5.865 1.000 54.696 0 147 ILE BBB C 1 ? 4 ATOM 3226 O O . ILE B 1 141 ? -15.083 -16.319 -6.271 1.000 51.553 0 147 ILE BBB O 1 ? 4 ATOM 3227 C CB . ILE B 1 141 ? -11.922 -17.255 -5.877 1.000 56.176 0 147 ILE BBB CB 1 ? 4 ATOM 3228 C CG1 . ILE B 1 141 ? -10.682 -17.678 -6.673 1.000 57.979 0 147 ILE BBB CG1 1 ? 4 ATOM 3229 C CG2 . ILE B 1 141 ? -12.822 -18.443 -5.564 1.000 57.566 0 147 ILE BBB CG2 1 ? 4 ATOM 3230 C CD1 . ILE B 1 141 ? -10.975 -18.253 -8.049 1.000 58.877 0 147 ILE BBB CD1 1 ? 4 ATOM 3231 N N . GLU B 1 142 ? -13.992 -14.984 -4.814 1.000 59.030 0 148 GLU BBB N 1 ? 4 ATOM 3232 C CA . GLU B 1 142 ? -15.222 -14.586 -4.082 1.000 60.844 0 148 GLU BBB CA 1 ? 4 ATOM 3233 C C . GLU B 1 142 ? -16.041 -13.670 -4.997 1.000 59.500 0 148 GLU BBB C 1 ? 4 ATOM 3234 O O . GLU B 1 142 ? -17.228 -13.971 -5.230 1.000 62.139 0 148 GLU BBB O 1 ? 4 ATOM 3235 C CB . GLU B 1 142 ? -14.879 -13.913 -2.752 1.000 60.556 0 148 GLU BBB CB 1 ? 4 ATOM 3236 C CG . GLU B 1 142 ? -16.103 -13.449 -1.980 1.000 59.852 0 148 GLU BBB CG 1 ? 4 ATOM 3237 C CD . GLU B 1 142 ? -15.812 -12.828 -0.620 1.000 59.692 0 148 GLU BBB CD 1 ? 4 ATOM 3238 O OE1 . GLU B 1 142 ? -14.627 -12.749 -0.232 1.000 56.151 0 148 GLU BBB OE1 1 ? 4 ATOM 3239 O OE2 . GLU B 1 142 ? -16.776 -12.416 0.050 1.000 61.678 0 148 GLU BBB OE2 1 ? 4 ATOM 3240 N N . GLU B 1 143 ? -15.412 -12.603 -5.495 1.000 57.490 0 149 GLU BBB N 1 ? 4 ATOM 3241 C CA . GLU B 1 143 ? -16.019 -11.629 -6.441 1.000 59.177 0 149 GLU BBB CA 1 ? 4 ATOM 3242 C C . GLU B 1 143 ? -16.764 -12.397 -7.542 1.000 58.016 0 149 GLU BBB C 1 ? 4 ATOM 3243 O O . GLU B 1 143 ? -17.955 -12.110 -7.758 1.000 58.738 0 149 GLU BBB O 1 ? 4 ATOM 3244 C CB . GLU B 1 143 ? -14.940 -10.707 -7.018 1.000 60.972 0 149 GLU BBB CB 1 ? 4 ATOM 3245 C CG . GLU B 1 143 ? -14.548 -9.566 -6.093 1.000 66.173 0 149 GLU BBB CG 1 ? 4 ATOM 3246 C CD . GLU B 1 143 ? -13.518 -8.593 -6.654 1.000 75.708 0 149 GLU BBB CD 1 ? 4 ATOM 3247 O OE1 . GLU B 1 143 ? -13.751 -7.372 -6.539 1.000 81.117 0 149 GLU BBB OE1 1 ? 4 ATOM 3248 O OE2 . GLU B 1 143 ? -12.479 -9.051 -7.198 1.000 80.927 0 149 GLU BBB OE2 1 ? 4 ATOM 3249 N N . LEU B 1 144 ? -16.094 -13.355 -8.189 1.000 53.852 0 150 LEU BBB N 1 ? 4 ATOM 3250 C CA . LEU B 1 144 ? -16.658 -14.165 -9.300 1.000 52.725 0 150 LEU BBB CA 1 ? 4 ATOM 3251 C C . LEU B 1 144 ? -17.799 -15.043 -8.781 1.000 52.587 0 150 LEU BBB C 1 ? 4 ATOM 3252 O O . LEU B 1 144 ? -18.881 -15.042 -9.396 1.000 55.007 0 150 LEU BBB O 1 ? 4 ATOM 3253 C CB . LEU B 1 144 ? -15.556 -15.031 -9.916 1.000 52.434 0 150 LEU BBB CB 1 ? 4 ATOM 3254 C CG . LEU B 1 144 ? -14.640 -14.323 -10.908 1.000 49.188 0 150 LEU BBB CG 1 ? 4 ATOM 3255 C CD1 . LEU B 1 144 ? -13.491 -15.230 -11.308 1.000 48.700 0 150 LEU BBB CD1 1 ? 4 ATOM 3256 C CD2 . LEU B 1 144 ? -15.417 -13.871 -12.129 1.000 48.015 0 150 LEU BBB CD2 1 ? 4 ATOM 3257 N N . ALA B 1 145 ? -17.563 -15.785 -7.705 1.000 51.632 0 151 ALA BBB N 1 ? 4 ATOM 3258 C CA . ALA B 1 145 ? -18.586 -16.647 -7.077 1.000 53.128 0 151 ALA BBB CA 1 ? 4 ATOM 3259 C C . ALA B 1 145 ? -19.839 -15.805 -6.816 1.000 52.726 0 151 ALA BBB C 1 ? 4 ATOM 3260 O O . ALA B 1 145 ? -20.949 -16.333 -7.003 1.000 53.076 0 151 ALA BBB O 1 ? 4 ATOM 3261 C CB . ALA B 1 145 ? -18.054 -17.271 -5.810 1.000 54.374 0 151 ALA BBB CB 1 ? 4 ATOM 3262 N N . ASP B 1 146 ? -19.666 -14.539 -6.424 1.000 52.093 0 152 ASP BBB N 1 ? 4 ATOM 3263 C CA . ASP B 1 146 ? -20.798 -13.642 -6.078 1.000 56.984 0 152 ASP BBB CA 1 ? 4 ATOM 3264 C C . ASP B 1 146 ? -21.539 -13.275 -7.366 1.000 56.244 0 152 ASP BBB C 1 ? 4 ATOM 3265 O O . ASP B 1 146 ? -22.746 -13.578 -7.475 1.000 57.466 0 152 ASP BBB O 1 ? 4 ATOM 3266 C CB . ASP B 1 146 ? -20.329 -12.402 -5.312 1.000 60.114 0 152 ASP BBB CB 1 ? 4 ATOM 3267 C CG . ASP B 1 146 ? -21.472 -11.582 -4.730 1.000 65.802 0 152 ASP BBB CG 1 ? 4 ATOM 3268 O OD1 . ASP B 1 146 ? -22.571 -12.160 -4.509 1.000 67.967 0 152 ASP BBB OD1 1 ? 4 ATOM 3269 O OD2 . ASP B 1 146 ? -21.256 -10.373 -4.495 1.000 68.033 0 152 ASP BBB OD2 1 ? 4 ATOM 3270 N N . ALA B 1 147 ? -20.823 -12.660 -8.306 1.000 54.475 0 153 ALA BBB N 1 ? 4 ATOM 3271 C CA . ALA B 1 147 ? -21.325 -12.249 -9.637 1.000 55.607 0 153 ALA BBB CA 1 ? 4 ATOM 3272 C C . ALA B 1 147 ? -22.130 -13.385 -10.267 1.000 54.515 0 153 ALA BBB C 1 ? 4 ATOM 3273 O O . ALA B 1 147 ? -23.175 -13.092 -10.874 1.000 53.856 0 153 ALA BBB O 1 ? 4 ATOM 3274 C CB . ALA B 1 147 ? -20.174 -11.848 -10.525 1.000 56.786 0 153 ALA BBB CB 1 ? 4 ATOM 3275 N N . LEU B 1 148 ? -21.660 -14.625 -10.115 1.000 55.425 0 154 LEU BBB N 1 ? 4 ATOM 3276 C CA . LEU B 1 148 ? -22.291 -15.825 -10.724 1.000 60.636 0 154 LEU BBB CA 1 ? 4 ATOM 3277 C C . LEU B 1 148 ? -23.567 -16.204 -9.960 1.000 68.017 0 154 LEU BBB C 1 ? 4 ATOM 3278 O O . LEU B 1 148 ? -24.554 -16.568 -10.643 1.000 73.230 0 154 LEU BBB O 1 ? 4 ATOM 3279 C CB . LEU B 1 148 ? -21.259 -16.955 -10.767 1.000 61.027 0 154 LEU BBB CB 1 ? 4 ATOM 3280 C CG . LEU B 1 148 ? -20.177 -16.766 -11.832 1.000 60.135 0 154 LEU BBB CG 1 ? 4 ATOM 3281 C CD1 . LEU B 1 148 ? -18.973 -17.668 -11.590 1.000 58.031 0 154 LEU BBB CD1 1 ? 4 ATOM 3282 C CD2 . LEU B 1 148 ? -20.754 -17.010 -13.214 1.000 60.391 0 154 LEU BBB CD2 1 ? 4 ATOM 3283 N N . THR B 1 149 ? -23.572 -16.098 -8.620 1.000 68.616 0 155 THR BBB N 1 ? 4 ATOM 3284 C CA . THR B 1 149 ? -24.769 -16.322 -7.759 1.000 68.808 0 155 THR BBB CA 1 ? 4 ATOM 3285 C C . THR B 1 149 ? -25.879 -15.371 -8.218 1.000 69.238 0 155 THR BBB C 1 ? 4 ATOM 3286 O O . THR B 1 149 ? -27.015 -15.843 -8.434 1.000 71.570 0 155 THR BBB O 1 ? 4 ATOM 3287 C CB . THR B 1 149 ? -24.467 -16.118 -6.266 1.000 69.256 0 155 THR BBB CB 1 ? 4 ATOM 3288 O OG1 . THR B 1 149 ? -23.433 -17.028 -5.886 1.000 68.989 0 155 THR BBB OG1 1 ? 4 ATOM 3289 C CG2 . THR B 1 149 ? -25.671 -16.333 -5.373 1.000 69.776 0 155 THR BBB CG2 1 ? 4 ATOM 3290 N N . TYR B 1 150 ? -25.541 -14.086 -8.359 1.000 66.721 0 156 TYR BBB N 1 ? 4 ATOM 3291 C CA . TYR B 1 150 ? -26.419 -13.022 -8.912 1.000 67.612 0 156 TYR BBB CA 1 ? 4 ATOM 3292 C C . TYR B 1 150 ? -26.953 -13.457 -10.283 1.000 67.592 0 156 TYR BBB C 1 ? 4 ATOM 3293 O O . TYR B 1 150 ? -28.179 -13.383 -10.494 1.000 70.309 0 156 TYR BBB O 1 ? 4 ATOM 3294 C CB . TYR B 1 150 ? -25.654 -11.698 -8.986 1.000 67.273 0 156 TYR BBB CB 1 ? 4 ATOM 3295 C CG . TYR B 1 150 ? -26.451 -10.527 -9.501 1.000 71.246 0 156 TYR BBB CG 1 ? 4 ATOM 3296 C CD1 . TYR B 1 150 ? -27.622 -10.129 -8.872 1.000 75.674 0 156 TYR BBB CD1 1 ? 4 ATOM 3297 C CD2 . TYR B 1 150 ? -26.032 -9.803 -10.607 1.000 70.874 0 156 TYR BBB CD2 1 ? 4 ATOM 3298 C CE1 . TYR B 1 150 ? -28.361 -9.052 -9.336 1.000 77.031 0 156 TYR BBB CE1 1 ? 4 ATOM 3299 C CE2 . TYR B 1 150 ? -26.761 -8.727 -11.087 1.000 71.852 0 156 TYR BBB CE2 1 ? 4 ATOM 3300 C CZ . TYR B 1 150 ? -27.929 -8.351 -10.449 1.000 75.150 0 156 TYR BBB CZ 1 ? 4 ATOM 3301 O OH . TYR B 1 150 ? -28.650 -7.290 -10.910 1.000 76.152 0 156 TYR BBB OH 1 ? 4 ATOM 3302 N N . CYS B 1 151 ? -26.070 -13.918 -11.177 1.000 64.105 0 157 CYS BBB N 1 ? 4 ATOM 3303 C CA . CYS B 1 151 ? -26.408 -14.263 -12.586 1.000 66.483 0 157 CYS BBB CA 1 ? 4 ATOM 3304 C C . CYS B 1 151 ? -27.395 -15.437 -12.627 1.000 69.876 0 157 CYS BBB C 1 ? 4 ATOM 3305 O O . CYS B 1 151 ? -28.294 -15.406 -13.483 1.000 70.586 0 157 CYS BBB O 1 ? 4 ATOM 3306 C CB . CYS B 1 151 ? -25.165 -14.561 -13.418 1.000 65.783 0 157 CYS BBB CB 1 ? 4 ATOM 3307 S SG . CYS B 1 151 ? -24.347 -13.070 -14.054 1.000 63.310 0 157 CYS BBB SG 1 ? 4 ATOM 3308 N N . HIS B 1 152 ? -27.258 -16.422 -11.733 1.000 74.133 0 158 HIS BBB N 1 ? 4 ATOM 3309 C CA . HIS B 1 152 ? -28.119 -17.640 -11.696 1.000 78.848 0 158 HIS BBB CA 1 ? 4 ATOM 3310 C C . HIS B 1 152 ? -29.441 -17.323 -10.987 1.000 77.129 0 158 HIS BBB C 1 ? 4 ATOM 3311 O O . HIS B 1 152 ? -30.478 -17.846 -11.429 1.000 76.928 0 158 HIS BBB O 1 ? 4 ATOM 3312 C CB . HIS B 1 152 ? -27.362 -18.837 -11.099 1.000 83.850 0 158 HIS BBB CB 1 ? 4 ATOM 3313 C CG . HIS B 1 152 ? -26.084 -19.124 -11.818 1.000 92.504 0 158 HIS BBB CG 1 ? 4 ATOM 3314 N ND1 . HIS B 1 152 ? -24.951 -19.577 -11.176 1.000 96.131 0 158 HIS BBB ND1 1 ? 4 ATOM 3315 C CD2 . HIS B 1 152 ? -25.741 -18.963 -13.117 1.000 104.704 0 158 HIS BBB CD2 1 ? 4 ATOM 3316 C CE1 . HIS B 1 152 ? -23.969 -19.703 -12.049 1.000 99.975 0 158 HIS BBB CE1 1 ? 4 ATOM 3317 N NE2 . HIS B 1 152 ? -24.427 -19.333 -13.251 1.000 103.429 0 158 HIS BBB NE2 1 ? 4 ATOM 3318 N N . ASP B 1 153 ? -29.413 -16.479 -9.953 1.000 77.468 0 159 ASP BBB N 1 ? 4 ATOM 3319 C CA . ASP B 1 153 ? -30.634 -16.005 -9.244 1.000 81.994 0 159 ASP BBB CA 1 ? 4 ATOM 3320 C C . ASP B 1 153 ? -31.552 -15.309 -10.252 1.000 80.638 0 159 ASP BBB C 1 ? 4 ATOM 3321 O O . ASP B 1 153 ? -32.746 -15.643 -10.284 1.000 82.360 0 159 ASP BBB O 1 ? 4 ATOM 3322 C CB . ASP B 1 153 ? -30.305 -15.074 -8.073 1.000 82.794 0 159 ASP BBB CB 1 ? 4 ATOM 3323 C CG . ASP B 1 153 ? -30.039 -15.801 -6.767 1.000 86.150 0 159 ASP BBB CG 1 ? 4 ATOM 3324 O OD1 . ASP B 1 153 ? -29.877 -17.034 -6.809 1.000 87.220 0 159 ASP BBB OD1 1 ? 4 ATOM 3325 O OD2 . ASP B 1 153 ? -30.003 -15.130 -5.719 1.000 91.078 0 159 ASP BBB OD2 1 ? 4 ATOM 3326 N N . LYS B 1 154 ? -30.997 -14.400 -11.058 1.000 78.174 0 160 LYS BBB N 1 ? 4 ATOM 3327 C CA . LYS B 1 154 ? -31.757 -13.552 -12.016 1.000 79.169 0 160 LYS BBB CA 1 ? 4 ATOM 3328 C C . LYS B 1 154 ? -31.986 -14.315 -13.330 1.000 77.404 0 160 LYS BBB C 1 ? 4 ATOM 3329 O O . LYS B 1 154 ? -32.651 -13.751 -14.217 1.000 76.452 0 160 LYS BBB O 1 ? 4 ATOM 3330 C CB . LYS B 1 154 ? -31.027 -12.222 -12.229 1.000 77.400 0 160 LYS BBB CB 1 ? 4 ATOM 3331 C CG . LYS B 1 154 ? -30.755 -11.415 -10.961 1.000 77.612 0 160 LYS BBB CG 1 ? 4 ATOM 3332 C CD . LYS B 1 154 ? -32.001 -10.909 -10.239 1.000 80.803 0 160 LYS BBB CD 1 ? 4 ATOM 3333 C CE . LYS B 1 154 ? -31.685 -10.068 -9.015 1.000 79.496 0 160 LYS BBB CE 1 ? 4 ATOM 3334 N NZ . LYS B 1 154 ? -32.805 -10.049 -8.042 1.000 81.268 0 160 LYS BBB NZ 1 ? 4 ATOM 3335 N N . LYS B 1 155 ? -31.474 -15.549 -13.429 1.000 76.918 0 161 LYS BBB N 1 ? 4 ATOM 3336 C CA . LYS B 1 155 ? -31.743 -16.532 -14.519 1.000 80.144 0 161 LYS BBB CA 1 ? 4 ATOM 3337 C C . LYS B 1 155 ? -31.303 -15.934 -15.860 1.000 79.153 0 161 LYS BBB C 1 ? 4 ATOM 3338 O O . LYS B 1 155 ? -32.141 -15.865 -16.779 1.000 83.539 0 161 LYS BBB O 1 ? 4 ATOM 3339 C CB . LYS B 1 155 ? -33.216 -16.961 -14.535 1.000 84.352 0 161 LYS BBB CB 1 ? 4 ATOM 3340 C CG . LYS B 1 155 ? -33.602 -17.965 -13.458 1.000 86.933 0 161 LYS BBB CG 1 ? 4 ATOM 3341 C CD . LYS B 1 155 ? -35.015 -18.468 -13.589 1.000 91.930 0 161 LYS BBB CD 1 ? 4 ATOM 3342 C CE . LYS B 1 155 ? -35.188 -19.500 -14.683 1.000 93.247 0 161 LYS BBB CE 1 ? 4 ATOM 3343 N NZ . LYS B 1 155 ? -36.555 -20.075 -14.676 1.000 97.546 0 161 LYS BBB NZ 1 ? 4 ATOM 3344 N N . VAL B 1 156 ? -30.031 -15.536 -15.959 1.000 75.410 0 162 VAL BBB N 1 ? 4 ATOM 3345 C CA . VAL B 1 156 ? -29.433 -14.887 -17.165 1.000 71.323 0 162 VAL BBB CA 1 ? 4 ATOM 3346 C C . VAL B 1 156 ? -28.132 -15.603 -17.546 1.000 69.163 0 162 VAL BBB C 1 ? 4 ATOM 3347 O O . VAL B 1 156 ? -27.434 -16.127 -16.652 1.000 66.805 0 162 VAL BBB O 1 ? 4 ATOM 3348 C CB . VAL B 1 156 ? -29.207 -13.378 -16.941 1.000 67.890 0 162 VAL BBB CB 1 ? 4 ATOM 3349 C CG1 . VAL B 1 156 ? -30.513 -12.672 -16.601 1.000 69.437 0 162 VAL BBB CG1 1 ? 4 ATOM 3350 C CG2 . VAL B 1 156 ? -28.149 -13.081 -15.887 1.000 63.840 0 162 VAL BBB CG2 1 ? 4 ATOM 3351 N N . ILE B 1 157 ? -27.830 -15.625 -18.844 1.000 73.103 0 163 ILE BBB N 1 ? 4 ATOM 3352 C CA . ILE B 1 157 ? -26.546 -16.135 -19.402 1.000 75.953 0 163 ILE BBB CA 1 ? 4 ATOM 3353 C C . ILE B 1 157 ? -25.460 -15.130 -19.014 1.000 74.454 0 163 ILE BBB C 1 ? 4 ATOM 3354 O O . ILE B 1 157 ? -25.801 -13.953 -18.793 1.000 82.975 0 163 ILE BBB O 1 ? 4 ATOM 3355 C CB . ILE B 1 157 ? -26.654 -16.336 -20.928 1.000 81.067 0 163 ILE BBB CB 1 ? 4 ATOM 3356 C CG1 . ILE B 1 157 ? -27.684 -17.412 -21.279 1.000 88.934 0 163 ILE BBB CG1 1 ? 4 ATOM 3357 C CG2 . ILE B 1 157 ? -25.298 -16.646 -21.542 1.000 85.038 0 163 ILE BBB CG2 1 ? 4 ATOM 3358 C CD1 . ILE B 1 157 ? -28.116 -17.416 -22.737 1.000 96.304 0 163 ILE BBB CD1 1 ? 4 ATOM 3359 N N . HIS B 1 158 ? -24.215 -15.584 -18.905 1.000 68.908 0 164 HIS BBB N 1 ? 4 ATOM 3360 C CA . HIS B 1 158 ? -23.032 -14.738 -18.602 1.000 68.785 0 164 HIS BBB CA 1 ? 4 ATOM 3361 C C . HIS B 1 158 ? -21.864 -15.221 -19.463 1.000 70.606 0 164 HIS BBB C 1 ? 4 ATOM 3362 O O . HIS B 1 158 ? -21.866 -16.415 -19.832 1.000 72.532 0 164 HIS BBB O 1 ? 4 ATOM 3363 C CB . HIS B 1 158 ? -22.697 -14.793 -17.102 1.000 66.416 0 164 HIS BBB CB 1 ? 4 ATOM 3364 C CG . HIS B 1 158 ? -22.298 -16.152 -16.635 1.000 65.019 0 164 HIS BBB CG 1 ? 4 ATOM 3365 N ND1 . HIS B 1 158 ? -21.022 -16.640 -16.820 1.000 62.199 0 164 HIS BBB ND1 1 ? 4 ATOM 3366 C CD2 . HIS B 1 158 ? -23.000 -17.134 -16.020 1.000 69.495 0 164 HIS BBB CD2 1 ? 4 ATOM 3367 C CE1 . HIS B 1 158 ? -20.949 -17.864 -16.334 1.000 66.010 0 164 HIS BBB CE1 1 ? 4 ATOM 3368 N NE2 . HIS B 1 158 ? -22.154 -18.194 -15.830 1.000 67.125 0 164 HIS BBB NE2 1 ? 4 ATOM 3369 N N . ARG B 1 159 ? -20.907 -14.334 -19.751 1.000 68.276 0 165 ARG BBB N 1 ? 4 ATOM 3370 C CA . ARG B 1 159 ? -19.651 -14.672 -20.465 1.000 70.080 0 165 ARG BBB CA 1 ? 4 ATOM 3371 C C . ARG B 1 159 ? -18.881 -15.718 -19.645 1.000 75.520 0 165 ARG BBB C 1 ? 4 ATOM 3372 O O . ARG B 1 159 ? -18.524 -15.415 -18.488 1.000 77.385 0 165 ARG BBB O 1 ? 4 ATOM 3373 C CB . ARG B 1 159 ? -18.835 -13.399 -20.690 1.000 68.855 0 165 ARG BBB CB 1 ? 4 ATOM 3374 C CG . ARG B 1 159 ? -17.670 -13.568 -21.649 1.000 70.740 0 165 ARG BBB CG 1 ? 4 ATOM 3375 C CD . ARG B 1 159 ? -17.598 -12.411 -22.617 1.000 76.255 0 165 ARG BBB CD 1 ? 4 ATOM 3376 N NE . ARG B 1 159 ? -16.263 -12.228 -23.158 1.000 86.784 0 165 ARG BBB NE 1 ? 4 ATOM 3377 C CZ . ARG B 1 159 ? -15.939 -11.319 -24.073 1.000 95.136 0 165 ARG BBB CZ 1 ? 4 ATOM 3378 N NH1 . ARG B 1 159 ? -16.864 -10.509 -24.564 1.000 94.445 0 165 ARG BBB NH1 1 ? 4 ATOM 3379 N NH2 . ARG B 1 159 ? -14.691 -11.226 -24.498 1.000 99.190 0 165 ARG BBB NH2 1 ? 4 ATOM 3380 N N . ASP B 1 160 ? -18.652 -16.909 -20.213 1.000 83.903 0 166 ASP BBB N 1 ? 4 ATOM 3381 C CA . ASP B 1 160 ? -17.902 -18.009 -19.545 1.000 88.992 0 166 ASP BBB CA 1 ? 4 ATOM 3382 C C . ASP B 1 160 ? -16.611 -17.422 -18.958 1.000 82.127 0 166 ASP BBB C 1 ? 4 ATOM 3383 O O . ASP B 1 160 ? -16.013 -16.512 -19.577 1.000 78.182 0 166 ASP BBB O 1 ? 4 ATOM 3384 C CB . ASP B 1 160 ? -17.626 -19.178 -20.496 1.000 97.469 0 166 ASP BBB CB 1 ? 4 ATOM 3385 C CG . ASP B 1 160 ? -16.671 -18.846 -21.629 1.000 109.955 0 166 ASP BBB CG 1 ? 4 ATOM 3386 O OD1 . ASP B 1 160 ? -16.760 -17.716 -22.155 1.000 117.833 0 166 ASP BBB OD1 1 ? 4 ATOM 3387 O OD2 . ASP B 1 160 ? -15.847 -19.723 -21.979 1.000 117.718 0 166 ASP BBB OD2 1 ? 4 ATOM 3388 N N . ILE B 1 161 ? -16.214 -17.903 -17.782 1.000 72.607 0 167 ILE BBB N 1 ? 4 ATOM 3389 C CA . ILE B 1 161 ? -15.125 -17.278 -16.980 1.000 70.485 0 167 ILE BBB CA 1 ? 4 ATOM 3390 C C . ILE B 1 161 ? -13.782 -17.905 -17.390 1.000 69.624 0 167 ILE BBB C 1 ? 4 ATOM 3391 O O . ILE B 1 161 ? -13.709 -19.149 -17.501 1.000 71.081 0 167 ILE BBB O 1 ? 4 ATOM 3392 C CB . ILE B 1 161 ? -15.449 -17.361 -15.470 1.000 65.968 0 167 ILE BBB CB 1 ? 4 ATOM 3393 C CG1 . ILE B 1 161 ? -15.279 -18.765 -14.887 1.000 66.264 0 167 ILE BBB CG1 1 ? 4 ATOM 3394 C CG2 . ILE B 1 161 ? -16.845 -16.819 -15.204 1.000 64.960 0 167 ILE BBB CG2 1 ? 4 ATOM 3395 C CD1 . ILE B 1 161 ? -13.949 -18.982 -14.208 1.000 67.275 0 167 ILE BBB CD1 1 ? 4 ATOM 3396 N N . LYS B 1 162 ? -12.795 -17.047 -17.672 1.000 66.896 0 168 LYS BBB N 1 ? 4 ATOM 3397 C CA . LYS B 1 162 ? -11.403 -17.369 -18.101 1.000 65.825 0 168 LYS BBB CA 1 ? 4 ATOM 3398 C C . LYS B 1 162 ? -10.597 -16.076 -18.087 1.000 63.002 0 168 LYS BBB C 1 ? 4 ATOM 3399 O O . LYS B 1 162 ? -11.144 -15.022 -18.384 1.000 70.614 0 168 LYS BBB O 1 ? 4 ATOM 3400 C CB . LYS B 1 162 ? -11.326 -17.887 -19.540 1.000 69.735 0 168 LYS BBB CB 1 ? 4 ATOM 3401 C CG . LYS B 1 162 ? -12.086 -19.162 -19.875 1.000 75.651 0 168 LYS BBB CG 1 ? 4 ATOM 3402 C CD . LYS B 1 162 ? -11.602 -19.820 -21.162 1.000 73.912 0 168 LYS BBB CD 1 ? 4 ATOM 3403 C CE . LYS B 1 162 ? -12.063 -19.120 -22.423 1.000 72.557 0 168 LYS BBB CE 1 ? 4 ATOM 3404 N NZ . LYS B 1 162 ? -13.157 -19.870 -23.086 1.000 77.248 0 168 LYS BBB NZ 1 ? 4 ATOM 3405 N N . PRO B 1 163 ? -9.276 -16.102 -17.823 1.000 60.072 0 169 PRO BBB N 1 ? 4 ATOM 3406 C CA . PRO B 1 163 ? -8.503 -14.865 -17.683 1.000 61.002 0 169 PRO BBB CA 1 ? 4 ATOM 3407 C C . PRO B 1 163 ? -8.701 -13.865 -18.839 1.000 59.970 0 169 PRO BBB C 1 ? 4 ATOM 3408 O O . PRO B 1 163 ? -8.752 -12.664 -18.586 1.000 54.558 0 169 PRO BBB O 1 ? 4 ATOM 3409 C CB . PRO B 1 163 ? -7.049 -15.360 -17.635 1.000 64.095 0 169 PRO BBB CB 1 ? 4 ATOM 3410 C CG . PRO B 1 163 ? -7.154 -16.784 -17.113 1.000 65.094 0 169 PRO BBB CG 1 ? 4 ATOM 3411 C CD . PRO B 1 163 ? -8.463 -17.315 -17.661 1.000 61.906 0 169 PRO BBB CD 1 ? 4 ATOM 3412 N N . GLU B 1 164 ? -8.824 -14.376 -20.070 1.000 65.298 0 170 GLU BBB N 1 ? 4 ATOM 3413 C CA . GLU B 1 164 ? -9.034 -13.580 -21.315 1.000 68.049 0 170 GLU BBB CA 1 ? 4 ATOM 3414 C C . GLU B 1 164 ? -10.332 -12.765 -21.222 1.000 66.987 0 170 GLU BBB C 1 ? 4 ATOM 3415 O O . GLU B 1 164 ? -10.347 -11.623 -21.725 1.000 64.230 0 170 GLU BBB O 1 ? 4 ATOM 3416 C CB . GLU B 1 164 ? -9.140 -14.495 -22.537 1.000 68.212 0 170 GLU BBB CB 1 ? 4 ATOM 3417 C CG . GLU B 1 164 ? -7.915 -15.359 -22.767 1.000 71.375 0 170 GLU BBB CG 1 ? 4 ATOM 3418 C CD . GLU B 1 164 ? -8.019 -16.763 -22.201 1.000 70.866 0 170 GLU BBB CD 1 ? 4 ATOM 3419 O OE1 . GLU B 1 164 ? -7.781 -17.726 -22.956 1.000 69.335 0 170 GLU BBB OE1 1 ? 4 ATOM 3420 O OE2 . GLU B 1 164 ? -8.329 -16.887 -21.004 1.000 71.790 0 170 GLU BBB OE2 1 ? 4 ATOM 3421 N N . ASN B 1 165 ? -11.366 -13.347 -20.602 1.000 62.308 0 171 ASN BBB N 1 ? 4 ATOM 3422 C CA . ASN B 1 165 ? -12.773 -12.866 -20.582 1.000 60.971 0 171 ASN BBB CA 1 ? 4 ATOM 3423 C C . ASN B 1 165 ? -13.028 -11.973 -19.364 1.000 58.297 0 171 ASN BBB C 1 ? 4 ATOM 3424 O O . ASN B 1 165 ? -14.190 -11.526 -19.201 1.000 58.094 0 171 ASN BBB O 1 ? 4 ATOM 3425 C CB . ASN B 1 165 ? -13.754 -14.044 -20.552 1.000 64.821 0 171 ASN BBB CB 1 ? 4 ATOM 3426 C CG . ASN B 1 165 ? -13.897 -14.748 -21.887 1.000 64.655 0 171 ASN BBB CG 1 ? 4 ATOM 3427 O OD1 . ASN B 1 165 ? -13.916 -14.103 -22.934 1.000 57.848 0 171 ASN BBB OD1 1 ? 4 ATOM 3428 N ND2 . ASN B 1 165 ? -14.022 -16.068 -21.856 1.000 65.495 0 171 ASN BBB ND2 1 ? 4 ATOM 3429 N N . LEU B 1 166 ? -12.002 -11.744 -18.535 1.000 56.235 0 172 LEU BBB N 1 ? 4 ATOM 3430 C CA . LEU B 1 166 ? -12.099 -10.982 -17.259 1.000 52.462 0 172 LEU BBB CA 1 ? 4 ATOM 3431 C C . LEU B 1 166 ? -11.240 -9.716 -17.358 1.000 50.966 0 172 LEU BBB C 1 ? 4 ATOM 3432 O O . LEU B 1 166 ? -10.082 -9.834 -17.816 1.000 51.696 0 172 LEU BBB O 1 ? 4 ATOM 3433 C CB . LEU B 1 166 ? -11.631 -11.882 -16.112 1.000 51.840 0 172 LEU BBB CB 1 ? 4 ATOM 3434 C CG . LEU B 1 166 ? -12.474 -13.132 -15.875 1.000 54.447 0 172 LEU BBB CG 1 ? 4 ATOM 3435 C CD1 . LEU B 1 166 ? -11.859 -13.999 -14.789 1.000 54.379 0 172 LEU BBB CD1 1 ? 4 ATOM 3436 C CD2 . LEU B 1 166 ? -13.905 -12.761 -15.519 1.000 57.515 0 172 LEU BBB CD2 1 ? 4 ATOM 3437 N N . LEU B 1 167 ? -11.800 -8.561 -16.966 1.000 47.672 0 173 LEU BBB N 1 ? 4 ATOM 3438 C CA . LEU B 1 167 ? -11.101 -7.247 -16.884 1.000 46.505 0 173 LEU BBB CA 1 ? 4 ATOM 3439 C C . LEU B 1 167 ? -10.940 -6.861 -15.403 1.000 45.907 0 173 LEU BBB C 1 ? 4 ATOM 3440 O O . LEU B 1 167 ? -11.534 -7.551 -14.551 1.000 44.324 0 173 LEU BBB O 1 ? 4 ATOM 3441 C CB . LEU B 1 167 ? -11.905 -6.202 -17.669 1.000 46.922 0 173 LEU BBB CB 1 ? 4 ATOM 3442 C CG . LEU B 1 167 ? -11.932 -6.374 -19.194 1.000 49.003 0 173 LEU BBB CG 1 ? 4 ATOM 3443 C CD1 . LEU B 1 167 ? -13.170 -5.739 -19.807 1.000 49.161 0 173 LEU BBB CD1 1 ? 4 ATOM 3444 C CD2 . LEU B 1 167 ? -10.687 -5.794 -19.848 1.000 49.880 0 173 LEU BBB CD2 1 ? 4 ATOM 3445 N N . LEU B 1 168 ? -10.177 -5.799 -15.116 1.000 45.344 0 174 LEU BBB N 1 ? 4 ATOM 3446 C CA . LEU B 1 168 ? -9.770 -5.382 -13.748 1.000 45.438 0 174 LEU BBB CA 1 ? 4 ATOM 3447 C C . LEU B 1 168 ? -10.117 -3.909 -13.503 1.000 45.883 0 174 LEU BBB C 1 ? 4 ATOM 3448 O O . LEU B 1 168 ? -9.694 -3.068 -14.305 1.000 44.066 0 174 LEU BBB O 1 ? 4 ATOM 3449 C CB . LEU B 1 168 ? -8.259 -5.586 -13.609 1.000 47.313 0 174 LEU BBB CB 1 ? 4 ATOM 3450 C CG . LEU B 1 168 ? -7.782 -7.036 -13.556 1.000 46.905 0 174 LEU BBB CG 1 ? 4 ATOM 3451 C CD1 . LEU B 1 168 ? -6.264 -7.107 -13.677 1.000 47.658 0 174 LEU BBB CD1 1 ? 4 ATOM 3452 C CD2 . LEU B 1 168 ? -8.263 -7.723 -12.283 1.000 44.771 0 174 LEU BBB CD2 1 ? 4 ATOM 3453 N N . GLY B 1 169 ? -10.782 -3.607 -12.385 1.000 48.842 0 175 GLY BBB N 1 ? 4 ATOM 3454 C CA . GLY B 1 169 ? -11.070 -2.230 -11.928 1.000 53.632 0 175 GLY BBB CA 1 ? 4 ATOM 3455 C C . GLY B 1 169 ? -9.842 -1.509 -11.379 1.000 53.540 0 175 GLY BBB C 1 ? 4 ATOM 3456 O O . GLY B 1 169 ? -8.735 -2.085 -11.429 1.000 50.402 0 175 GLY BBB O 1 ? 4 ATOM 3457 N N . PHE B 1 170 ? -10.033 -0.286 -10.863 1.000 55.513 0 176 PHE BBB N 1 ? 4 ATOM 3458 C CA . PHE B 1 170 ? -8.950 0.607 -10.364 1.000 59.401 0 176 PHE BBB CA 1 ? 4 ATOM 3459 C C . PHE B 1 170 ? -8.207 -0.036 -9.185 1.000 59.532 0 176 PHE BBB C 1 ? 4 ATOM 3460 O O . PHE B 1 170 ? -6.995 0.227 -9.056 1.000 62.850 0 176 PHE BBB O 1 ? 4 ATOM 3461 C CB . PHE B 1 170 ? -9.482 1.981 -9.942 1.000 59.224 0 176 PHE BBB CB 1 ? 4 ATOM 3462 C CG . PHE B 1 170 ? -8.445 2.859 -9.286 1.000 59.344 0 176 PHE BBB CG 1 ? 4 ATOM 3463 C CD1 . PHE B 1 170 ? -7.382 3.367 -10.014 1.000 59.308 0 176 PHE BBB CD1 1 ? 4 ATOM 3464 C CD2 . PHE B 1 170 ? -8.501 3.138 -7.929 1.000 63.035 0 176 PHE BBB CD2 1 ? 4 ATOM 3465 C CE1 . PHE B 1 170 ? -6.418 4.161 -9.412 1.000 60.436 0 176 PHE BBB CE1 1 ? 4 ATOM 3466 C CE2 . PHE B 1 170 ? -7.538 3.934 -7.325 1.000 61.687 0 176 PHE BBB CE2 1 ? 4 ATOM 3467 C CZ . PHE B 1 170 ? -6.501 4.447 -8.070 1.000 61.587 0 176 PHE BBB CZ 1 ? 4 ATOM 3468 N N . ARG B 1 171 ? -8.897 -0.822 -8.351 1.000 58.884 0 177 ARG BBB N 1 ? 4 ATOM 3469 C CA . ARG B 1 171 ? -8.269 -1.594 -7.239 1.000 61.950 0 177 ARG BBB CA 1 ? 4 ATOM 3470 C C . ARG B 1 171 ? -8.319 -3.095 -7.543 1.000 57.161 0 177 ARG BBB C 1 ? 4 ATOM 3471 O O . ARG B 1 171 ? -8.460 -3.883 -6.596 1.000 58.318 0 177 ARG BBB O 1 ? 4 ATOM 3472 C CB . ARG B 1 171 ? -8.951 -1.278 -5.905 1.000 65.785 0 177 ARG BBB CB 1 ? 4 ATOM 3473 C CG . ARG B 1 171 ? -8.701 0.138 -5.409 1.000 70.656 0 177 ARG BBB CG 1 ? 4 ATOM 3474 C CD . ARG B 1 171 ? -9.861 0.658 -4.587 1.000 76.557 0 177 ARG BBB CD 1 ? 4 ATOM 3475 N NE . ARG B 1 171 ? -9.839 0.158 -3.221 1.000 92.035 0 177 ARG BBB NE 1 ? 4 ATOM 3476 C CZ . ARG B 1 171 ? -10.903 0.026 -2.431 1.000 101.434 0 177 ARG BBB CZ 1 ? 4 ATOM 3477 N NH1 . ARG B 1 171 ? -12.121 0.336 -2.852 1.000 104.352 0 177 ARG BBB NH1 1 ? 4 ATOM 3478 N NH2 . ARG B 1 171 ? -10.743 -0.439 -1.209 1.000 107.116 0 177 ARG BBB NH2 1 ? 4 ATOM 3479 N N . GLY B 1 172 ? -8.186 -3.476 -8.812 1.000 54.996 0 178 GLY BBB N 1 ? 4 ATOM 3480 C CA . GLY B 1 172 ? -8.004 -4.881 -9.220 1.000 54.272 0 178 GLY BBB CA 1 ? 4 ATOM 3481 C C . GLY B 1 172 ? -9.237 -5.731 -8.952 1.000 51.667 0 178 GLY BBB C 1 ? 4 ATOM 3482 O O . GLY B 1 172 ? -9.072 -6.974 -8.760 1.000 53.992 0 178 GLY BBB O 1 ? 4 ATOM 3483 N N . GLU B 1 173 ? -10.424 -5.097 -8.946 1.000 50.435 0 179 GLU BBB N 1 ? 4 ATOM 3484 C CA . GLU B 1 173 ? -11.739 -5.795 -8.883 1.000 51.503 0 179 GLU BBB CA 1 ? 4 ATOM 3485 C C . GLU B 1 173 ? -11.990 -6.506 -10.218 1.000 53.022 0 179 GLU BBB C 1 ? 4 ATOM 3486 O O . GLU B 1 173 ? -11.917 -5.838 -11.276 1.000 51.254 0 179 GLU BBB O 1 ? 4 ATOM 3487 C CB . GLU B 1 173 ? -12.890 -4.821 -8.631 1.000 53.159 0 179 GLU BBB CB 1 ? 4 ATOM 3488 C CG . GLU B 1 173 ? -12.759 -4.025 -7.347 1.000 56.957 0 179 GLU BBB CG 1 ? 4 ATOM 3489 C CD . GLU B 1 173 ? -12.279 -2.596 -7.517 1.000 58.436 0 179 GLU BBB CD 1 ? 4 ATOM 3490 O OE1 . GLU B 1 173 ? -11.659 -2.302 -8.563 1.000 57.791 0 179 GLU BBB OE1 1 ? 4 ATOM 3491 O OE2 . GLU B 1 173 ? -12.523 -1.784 -6.594 1.000 58.862 0 179 GLU BBB OE2 1 ? 4 ATOM 3492 N N . VAL B 1 174 ? -12.282 -7.807 -10.185 1.000 52.501 0 180 VAL BBB N 1 ? 4 ATOM 3493 C CA . VAL B 1 174 ? -12.529 -8.598 -11.424 1.000 50.569 0 180 VAL BBB CA 1 ? 4 ATOM 3494 C C . VAL B 1 174 ? -13.827 -8.085 -12.049 1.000 52.722 0 180 VAL BBB C 1 ? 4 ATOM 3495 O O . VAL B 1 174 ? -14.766 -7.769 -11.295 1.000 51.631 0 180 VAL BBB O 1 ? 4 ATOM 3496 C CB . VAL B 1 174 ? -12.599 -10.109 -11.155 1.000 49.703 0 180 VAL BBB CB 1 ? 4 ATOM 3497 C CG1 . VAL B 1 174 ? -13.895 -10.499 -10.453 1.000 51.415 0 180 VAL BBB CG1 1 ? 4 ATOM 3498 C CG2 . VAL B 1 174 ? -12.418 -10.903 -12.437 1.000 47.901 0 180 VAL BBB CG2 1 ? 4 ATOM 3499 N N . LYS B 1 175 ? -13.848 -7.985 -13.378 1.000 53.098 0 181 LYS BBB N 1 ? 4 ATOM 3500 C CA . LYS B 1 175 ? -15.029 -7.576 -14.175 1.000 55.105 0 181 LYS BBB CA 1 ? 4 ATOM 3501 C C . LYS B 1 175 ? -15.230 -8.620 -15.276 1.000 55.654 0 181 LYS BBB C 1 ? 4 ATOM 3502 O O . LYS B 1 175 ? -14.342 -8.739 -16.145 1.000 57.353 0 181 LYS BBB O 1 ? 4 ATOM 3503 C CB . LYS B 1 175 ? -14.825 -6.182 -14.778 1.000 57.838 0 181 LYS BBB CB 1 ? 4 ATOM 3504 C CG . LYS B 1 175 ? -14.311 -5.102 -13.832 1.000 60.043 0 181 LYS BBB CG 1 ? 4 ATOM 3505 C CD . LYS B 1 175 ? -15.410 -4.310 -13.152 1.000 60.544 0 181 LYS BBB CD 1 ? 4 ATOM 3506 C CE . LYS B 1 175 ? -14.951 -3.656 -11.866 1.000 55.542 0 181 LYS BBB CE 1 ? 4 ATOM 3507 N NZ . LYS B 1 175 ? -16.005 -2.797 -11.292 1.000 54.009 0 181 LYS BBB NZ 1 ? 4 ATOM 3508 N N . ILE B 1 176 ? -16.327 -9.376 -15.210 1.000 54.185 0 182 ILE BBB N 1 ? 4 ATOM 3509 C CA . ILE B 1 176 ? -16.808 -10.241 -16.325 1.000 52.370 0 182 ILE BBB CA 1 ? 4 ATOM 3510 C C . ILE B 1 176 ? -17.191 -9.285 -17.459 1.000 54.754 0 182 ILE BBB C 1 ? 4 ATOM 3511 O O . ILE B 1 176 ? -17.964 -8.340 -17.185 1.000 59.659 0 182 ILE BBB O 1 ? 4 ATOM 3512 C CB . ILE B 1 176 ? -17.973 -11.140 -15.863 1.000 51.990 0 182 ILE BBB CB 1 ? 4 ATOM 3513 C CG1 . ILE B 1 176 ? -17.543 -12.103 -14.752 1.000 50.391 0 182 ILE BBB CG1 1 ? 4 ATOM 3514 C CG2 . ILE B 1 176 ? -18.584 -11.887 -17.037 1.000 54.080 0 182 ILE BBB CG2 1 ? 4 ATOM 3515 C CD1 . ILE B 1 176 ? -18.694 -12.752 -14.020 1.000 49.788 0 182 ILE BBB CD1 1 ? 4 ATOM 3516 N N . ALA B 1 177 ? -16.636 -9.476 -18.661 1.000 51.133 0 183 ALA BBB N 1 ? 4 ATOM 3517 C CA . ALA B 1 177 ? -16.592 -8.434 -19.713 1.000 51.988 0 183 ALA BBB CA 1 ? 4 ATOM 3518 C C . ALA B 1 177 ? -18.014 -8.032 -20.135 1.000 55.026 0 183 ALA BBB C 1 ? 4 ATOM 3519 O O . ALA B 1 177 ? -18.194 -6.863 -20.545 1.000 58.159 0 183 ALA BBB O 1 ? 4 ATOM 3520 C CB . ALA B 1 177 ? -15.759 -8.906 -20.880 1.000 53.178 0 183 ALA BBB CB 1 ? 4 ATOM 3521 N N . ASP B 1 178 ? -18.985 -8.951 -20.032 1.000 54.891 0 184 ASP BBB N 1 ? 4 ATOM 3522 C CA . ASP B 1 178 ? -20.408 -8.732 -20.418 1.000 56.295 0 184 ASP BBB CA 1 ? 4 ATOM 3523 C C . ASP B 1 178 ? -21.196 -10.026 -20.181 1.000 56.937 0 184 ASP BBB C 1 ? 4 ATOM 3524 O O . ASP B 1 178 ? -20.606 -10.997 -19.664 1.000 56.578 0 184 ASP BBB O 1 ? 4 ATOM 3525 C CB . ASP B 1 178 ? -20.516 -8.278 -21.877 1.000 58.948 0 184 ASP BBB CB 1 ? 4 ATOM 3526 C CG . ASP B 1 178 ? -19.787 -9.190 -22.849 1.000 60.819 0 184 ASP BBB CG 1 ? 4 ATOM 3527 O OD1 . ASP B 1 178 ? -19.997 -10.419 -22.777 1.000 59.855 0 184 ASP BBB OD1 1 ? 4 ATOM 3528 O OD2 . ASP B 1 178 ? -19.002 -8.668 -23.658 1.000 63.217 0 184 ASP BBB OD2 1 ? 4 ATOM 3529 N N . PHE B 1 179 ? -22.470 -10.052 -20.576 1.000 59.528 0 185 PHE BBB N 1 ? 4 ATOM 3530 C CA . PHE B 1 179 ? -23.375 -11.227 -20.445 1.000 63.004 0 185 PHE BBB CA 1 ? 4 ATOM 3531 C C . PHE B 1 179 ? -23.265 -12.138 -21.684 1.000 66.338 0 185 PHE BBB C 1 ? 4 ATOM 3532 O O . PHE B 1 179 ? -24.228 -12.871 -21.994 1.000 66.262 0 185 PHE BBB O 1 ? 4 ATOM 3533 C CB . PHE B 1 179 ? -24.798 -10.737 -20.171 1.000 64.177 0 185 PHE BBB CB 1 ? 4 ATOM 3534 C CG . PHE B 1 179 ? -24.960 -10.024 -18.852 1.000 64.401 0 185 PHE BBB CG 1 ? 4 ATOM 3535 C CD1 . PHE B 1 179 ? -25.192 -10.738 -17.685 1.000 62.446 0 185 PHE BBB CD1 1 ? 4 ATOM 3536 C CD2 . PHE B 1 179 ? -24.883 -8.641 -18.773 1.000 65.310 0 185 PHE BBB CD2 1 ? 4 ATOM 3537 C CE1 . PHE B 1 179 ? -25.357 -10.085 -16.475 1.000 61.422 0 185 PHE BBB CE1 1 ? 4 ATOM 3538 C CE2 . PHE B 1 179 ? -25.036 -7.991 -17.556 1.000 63.282 0 185 PHE BBB CE2 1 ? 4 ATOM 3539 C CZ . PHE B 1 179 ? -25.276 -8.714 -16.412 1.000 61.519 0 185 PHE BBB CZ 1 ? 4 ATOM 3540 N N . GLY B 1 180 ? -22.123 -12.084 -22.380 1.000 68.208 0 186 GLY BBB N 1 ? 4 ATOM 3541 C CA . GLY B 1 180 ? -21.673 -13.085 -23.370 1.000 72.989 0 186 GLY BBB CA 1 ? 4 ATOM 3542 C C . GLY B 1 180 ? -22.632 -13.264 -24.532 1.000 77.441 0 186 GLY BBB C 1 ? 4 ATOM 3543 O O . GLY B 1 180 ? -23.098 -14.398 -24.719 1.000 85.630 0 186 GLY BBB O 1 ? 4 ATOM 3544 N N . TRP B 1 181 ? -22.885 -12.201 -25.302 1.000 79.136 0 187 TRP BBB N 1 ? 4 ATOM 3545 C CA . TRP B 1 181 ? -23.736 -12.214 -26.528 1.000 79.548 0 187 TRP BBB CA 1 ? 4 ATOM 3546 C C . TRP B 1 181 ? -22.903 -12.640 -27.748 1.000 77.181 0 187 TRP BBB C 1 ? 4 ATOM 3547 O O . TRP B 1 181 ? -23.467 -13.322 -28.614 1.000 75.624 0 187 TRP BBB O 1 ? 4 ATOM 3548 C CB . TRP B 1 181 ? -24.425 -10.857 -26.749 1.000 79.311 0 187 TRP BBB CB 1 ? 4 ATOM 3549 C CG . TRP B 1 181 ? -23.489 -9.720 -27.027 1.000 75.759 0 187 TRP BBB CG 1 ? 4 ATOM 3550 C CD1 . TRP B 1 181 ? -22.789 -8.987 -26.112 1.000 71.757 0 187 TRP BBB CD1 1 ? 4 ATOM 3551 C CD2 . TRP B 1 181 ? -23.151 -9.176 -28.314 1.000 75.038 0 187 TRP BBB CD2 1 ? 4 ATOM 3552 N NE1 . TRP B 1 181 ? -22.037 -8.032 -26.739 1.000 71.239 0 187 TRP BBB NE1 1 ? 4 ATOM 3553 C CE2 . TRP B 1 181 ? -22.240 -8.121 -28.090 1.000 72.079 0 187 TRP BBB CE2 1 ? 4 ATOM 3554 C CE3 . TRP B 1 181 ? -23.525 -9.473 -29.629 1.000 79.660 0 187 TRP BBB CE3 1 ? 4 ATOM 3555 C CZ2 . TRP B 1 181 ? -21.697 -7.373 -29.132 1.000 74.434 0 187 TRP BBB CZ2 1 ? 4 ATOM 3556 C CZ3 . TRP B 1 181 ? -22.991 -8.731 -30.660 1.000 80.164 0 187 TRP BBB CZ3 1 ? 4 ATOM 3557 C CH2 . TRP B 1 181 ? -22.088 -7.697 -30.413 1.000 78.966 0 187 TRP BBB CH2 1 ? 4 ATOM 3558 N N . SER B 1 182 ? -21.616 -12.270 -27.796 1.000 77.885 0 188 SER BBB N 1 ? 4 ATOM 3559 C CA . SER B 1 182 ? -20.655 -12.609 -28.884 1.000 79.227 0 188 SER BBB CA 1 ? 4 ATOM 3560 C C . SER B 1 182 ? -19.951 -13.942 -28.603 1.000 78.761 0 188 SER BBB C 1 ? 4 ATOM 3561 O O . SER B 1 182 ? -19.067 -14.308 -29.396 1.000 75.535 0 188 SER BBB O 1 ? 4 ATOM 3562 C CB . SER B 1 182 ? -19.633 -11.520 -29.086 1.000 81.991 0 188 SER BBB CB 1 ? 4 ATOM 3563 O OG . SER B 1 182 ? -20.214 -10.231 -28.968 1.000 88.493 0 188 SER BBB OG 1 ? 4 ATOM 3564 N N . VAL B 1 183 ? -20.299 -14.616 -27.502 1.000 85.874 0 189 VAL BBB N 1 ? 4 ATOM 3565 C CA . VAL B 1 183 ? -19.786 -15.974 -27.145 1.000 93.284 0 189 VAL BBB CA 1 ? 4 ATOM 3566 C C . VAL B 1 183 ? -20.368 -16.972 -28.150 1.000 100.621 0 189 VAL BBB C 1 ? 4 ATOM 3567 O O . VAL B 1 183 ? -21.606 -17.047 -28.251 1.000 102.875 0 189 VAL BBB O 1 ? 4 ATOM 3568 C CB . VAL B 1 183 ? -20.148 -16.356 -25.695 1.000 100.604 0 189 VAL BBB CB 1 ? 4 ATOM 3569 C CG1 . VAL B 1 183 ? -20.247 -17.863 -25.496 1.000 101.594 0 189 VAL BBB CG1 1 ? 4 ATOM 3570 C CG2 . VAL B 1 183 ? -19.178 -15.748 -24.696 1.000 102.378 0 189 VAL BBB CG2 1 ? 4 ATOM 3571 N N . HIS B 1 184 ? -19.507 -17.707 -28.859 1.000 105.606 0 190 HIS BBB N 1 ? 4 ATOM 3572 C CA . HIS B 1 184 ? -19.891 -18.759 -29.837 1.000 111.096 0 190 HIS BBB CA 1 ? 4 ATOM 3573 C C . HIS B 1 184 ? -19.814 -20.128 -29.151 1.000 108.558 0 190 HIS BBB C 1 ? 4 ATOM 3574 O O . HIS B 1 184 ? -18.883 -20.333 -28.352 1.000 114.685 0 190 HIS BBB O 1 ? 4 ATOM 3575 C CB . HIS B 1 184 ? -19.032 -18.635 -31.106 1.000 121.564 0 190 HIS BBB CB 1 ? 4 ATOM 3576 C CG . HIS B 1 184 ? -19.394 -17.454 -31.951 1.000 128.647 0 190 HIS BBB CG 1 ? 4 ATOM 3577 N ND1 . HIS B 1 184 ? -20.582 -17.391 -32.658 1.000 123.353 0 190 HIS BBB ND1 1 ? 4 ATOM 3578 C CD2 . HIS B 1 184 ? -18.743 -16.293 -32.201 1.000 129.122 0 190 HIS BBB CD2 1 ? 4 ATOM 3579 C CE1 . HIS B 1 184 ? -20.645 -16.245 -33.306 1.000 127.446 0 190 HIS BBB CE1 1 ? 4 ATOM 3580 N NE2 . HIS B 1 184 ? -19.528 -15.553 -33.043 1.000 128.564 0 190 HIS BBB NE2 1 ? 4 ATOM 3581 N N . THR B 1 185 ? -20.784 -21.007 -29.432 1.000 110.022 0 191 THR BBB N 1 ? 4 ATOM 3582 C CA . THR B 1 185 ? -20.878 -22.404 -28.922 1.000 110.073 0 191 THR BBB CA 1 ? 4 ATOM 3583 C C . THR B 1 185 ? -19.498 -23.053 -28.996 1.000 105.638 0 191 THR BBB C 1 ? 4 ATOM 3584 O O . THR B 1 185 ? -19.070 -23.456 -30.076 1.000 102.421 0 191 THR BBB O 1 ? 4 ATOM 3585 C CB . THR B 1 185 ? -21.896 -23.217 -29.737 1.000 116.955 0 191 THR BBB CB 1 ? 4 ATOM 3586 O OG1 . THR B 1 185 ? -21.580 -23.030 -31.115 1.000 126.500 0 191 THR BBB OG1 1 ? 4 ATOM 3587 C CG2 . THR B 1 185 ? -23.335 -22.809 -29.521 1.000 117.728 0 191 THR BBB CG2 1 ? 4 ATOM 3588 N N . PRO B 1 186 ? -18.747 -23.179 -27.875 1.000 105.111 0 192 PRO BBB N 1 ? 4 ATOM 3589 C CA . PRO B 1 186 ? -17.337 -23.572 -27.942 1.000 101.229 0 192 PRO BBB CA 1 ? 4 ATOM 3590 C C . PRO B 1 186 ? -17.126 -24.946 -28.603 1.000 95.197 0 192 PRO BBB C 1 ? 4 ATOM 3591 O O . PRO B 1 186 ? -17.761 -25.899 -28.179 1.000 98.126 0 192 PRO BBB O 1 ? 4 ATOM 3592 C CB . PRO B 1 186 ? -16.879 -23.603 -26.474 1.000 102.503 0 192 PRO BBB CB 1 ? 4 ATOM 3593 C CG . PRO B 1 186 ? -17.904 -22.759 -25.741 1.000 104.907 0 192 PRO BBB CG 1 ? 4 ATOM 3594 C CD . PRO B 1 186 ? -19.203 -22.971 -26.491 1.000 103.919 0 192 PRO BBB CD 1 ? 4 ATOM 3595 N N . SER B 1 187 ? -16.252 -25.000 -29.618 1.000 84.084 0 193 SER BBB N 1 ? 4 ATOM 3596 C CA . SER B 1 187 ? -15.828 -26.224 -30.350 1.000 79.588 0 193 SER BBB CA 1 ? 4 ATOM 3597 C C . SER B 1 187 ? -14.710 -26.938 -29.575 1.000 78.407 0 193 SER BBB C 1 ? 4 ATOM 3598 O O . SER B 1 187 ? -13.906 -26.243 -28.936 1.000 81.388 0 193 SER BBB O 1 ? 4 ATOM 3599 C CB . SER B 1 187 ? -15.395 -25.870 -31.756 1.000 77.834 0 193 SER BBB CB 1 ? 4 ATOM 3600 O OG . SER B 1 187 ? -14.836 -26.988 -32.442 1.000 76.950 0 193 SER BBB OG 1 ? 4 ATOM 3601 N N . LEU B 1 188 ? -14.673 -28.272 -29.618 1.000 76.721 0 194 LEU BBB N 1 ? 4 ATOM 3602 C CA . LEU B 1 188 ? -13.561 -29.090 -29.062 1.000 75.172 0 194 LEU BBB CA 1 ? 4 ATOM 3603 C C . LEU B 1 188 ? -12.264 -28.735 -29.804 1.000 75.841 0 194 LEU BBB C 1 ? 4 ATOM 3604 O O . LEU B 1 188 ? -11.265 -28.436 -29.133 1.000 77.194 0 194 LEU BBB O 1 ? 4 ATOM 3605 C CB . LEU B 1 188 ? -13.900 -30.578 -29.195 1.000 78.690 0 194 LEU BBB CB 1 ? 4 ATOM 3606 C CG . LEU B 1 188 ? -13.157 -31.511 -28.237 1.000 83.475 0 194 LEU BBB CG 1 ? 4 ATOM 3607 C CD1 . LEU B 1 188 ? -13.855 -32.861 -28.147 1.000 85.975 0 194 LEU BBB CD1 1 ? 4 ATOM 3608 C CD2 . LEU B 1 188 ? -11.700 -31.705 -28.638 1.000 86.788 0 194 LEU BBB CD2 1 ? 4 ATOM 3609 N N . ALA B 1 189 ? -12.295 -28.718 -31.138 1.000 79.067 0 195 ALA BBB N 1 ? 4 ATOM 3610 C CA . ALA B 1 189 ? -11.136 -28.417 -32.017 1.000 82.674 0 195 ALA BBB CA 1 ? 4 ATOM 3611 C C . ALA B 1 189 ? -10.587 -27.004 -31.749 1.000 83.172 0 195 ALA BBB C 1 ? 4 ATOM 3612 O O . ALA B 1 189 ? -9.350 -26.843 -31.709 1.000 80.817 0 195 ALA BBB O 1 ? 4 ATOM 3613 C CB . ALA B 1 189 ? -11.539 -28.583 -33.462 1.000 82.997 0 195 ALA BBB CB 1 ? 4 ATOM 3614 N N . ALA B 1 190 ? -11.468 -26.013 -31.592 1.000 83.658 0 196 ALA BBB N 1 ? 4 ATOM 3615 C CA . ALA B 1 190 ? -11.112 -24.589 -31.387 1.000 83.255 0 196 ALA BBB CA 1 ? 4 ATOM 3616 C C . ALA B 1 190 ? -10.365 -24.430 -30.062 1.000 80.945 0 196 ALA BBB C 1 ? 4 ATOM 3617 O O . ALA B 1 190 ? -9.301 -23.782 -30.057 1.000 78.071 0 196 ALA BBB O 1 ? 4 ATOM 3618 C CB . ALA B 1 190 ? -12.353 -23.733 -31.406 1.000 84.082 0 196 ALA BBB CB 1 ? 4 ATOM 3619 N N . ALA B 1 191 ? -10.929 -24.999 -28.991 1.000 83.482 0 197 ALA BBB N 1 ? 4 ATOM 3620 C CA . ALA B 1 191 ? -10.407 -24.963 -27.603 1.000 83.023 0 197 ALA BBB CA 1 ? 4 ATOM 3621 C C . ALA B 1 191 ? -9.027 -25.623 -27.553 1.000 83.840 0 197 ALA BBB C 1 ? 4 ATOM 3622 O O . ALA B 1 191 ? -8.156 -25.102 -26.839 1.000 86.141 0 197 ALA BBB O 1 ? 4 ATOM 3623 C CB . ALA B 1 191 ? -11.375 -25.648 -26.671 1.000 81.729 0 197 ALA BBB CB 1 ? 4 ATOM 3624 N N . THR B 1 192 ? -8.849 -26.733 -28.275 1.000 87.594 0 198 THR BBB N 1 ? 4 ATOM 3625 C CA . THR B 1 192 ? -7.555 -27.456 -28.421 1.000 91.774 0 198 THR BBB CA 1 ? 4 ATOM 3626 C C . THR B 1 192 ? -6.500 -26.472 -28.948 1.000 95.024 0 198 THR BBB C 1 ? 4 ATOM 3627 O O . THR B 1 192 ? -5.452 -26.328 -28.286 1.000 104.429 0 198 THR BBB O 1 ? 4 ATOM 3628 C CB . THR B 1 192 ? -7.722 -28.711 -29.292 1.000 90.408 0 198 THR BBB CB 1 ? 4 ATOM 3629 O OG1 . THR B 1 192 ? -8.563 -29.620 -28.580 1.000 86.021 0 198 THR BBB OG1 1 ? 4 ATOM 3630 C CG2 . THR B 1 192 ? -6.417 -29.399 -29.625 1.000 91.263 0 198 THR BBB CG2 1 ? 4 ATOM 3631 N N . MET B 1 193 ? -6.788 -25.794 -30.063 1.000 88.412 0 199 MET BBB N 1 ? 4 ATOM 3632 C CA . MET B 1 193 ? -5.857 -24.850 -30.735 1.000 88.675 0 199 MET BBB CA 1 ? 4 ATOM 3633 C C . MET B 1 193 ? -5.688 -23.574 -29.902 1.000 84.429 0 199 MET BBB C 1 ? 4 ATOM 3634 O O . MET B 1 193 ? -4.532 -23.136 -29.749 1.000 83.309 0 199 MET BBB O 1 ? 4 ATOM 3635 C CB . MET B 1 193 ? -6.370 -24.464 -32.122 1.000 94.601 0 199 MET BBB CB 1 ? 4 ATOM 3636 C CG . MET B 1 193 ? -6.426 -25.624 -33.081 1.000 98.723 0 199 MET BBB CG 1 ? 4 ATOM 3637 S SD . MET B 1 193 ? -6.173 -25.099 -34.786 1.000 107.467 0 199 MET BBB SD 1 ? 4 ATOM 3638 C CE . MET B 1 193 ? -7.184 -23.619 -34.844 1.000 107.371 0 199 MET BBB CE 1 ? 4 ATOM 3639 N N . CYS B 1 194 ? -6.787 -22.990 -29.408 1.000 82.508 0 200 CYS BBB N 1 ? 4 ATOM 3640 C CA . CYS B 1 194 ? -6.788 -21.761 -28.558 1.000 87.541 0 200 CYS BBB CA 1 ? 4 ATOM 3641 C C . CYS B 1 194 ? -5.994 -21.987 -27.262 1.000 78.427 0 200 CYS BBB C 1 ? 4 ATOM 3642 O O . CYS B 1 194 ? -5.575 -20.978 -26.667 1.000 74.278 0 200 CYS BBB O 1 ? 4 ATOM 3643 C CB . CYS B 1 194 ? -8.200 -21.292 -28.211 1.000 95.190 0 200 CYS BBB CB 1 ? 4 ATOM 3644 S SG . CYS B 1 194 ? -8.949 -20.232 -29.481 1.000 110.572 0 200 CYS BBB SG 1 ? 4 ATOM 3645 N N . GLY B 1 195 ? -5.798 -23.249 -26.854 1.000 74.755 0 201 GLY BBB N 1 ? 4 ATOM 3646 C CA . GLY B 1 195 ? -5.156 -23.639 -25.582 1.000 73.497 0 201 GLY BBB CA 1 ? 4 ATOM 3647 C C . GLY B 1 195 ? -6.088 -23.421 -24.402 1.000 72.895 0 201 GLY BBB C 1 ? 4 ATOM 3648 O O . GLY B 1 195 ? -5.603 -23.076 -23.314 1.000 73.319 0 201 GLY BBB O 1 ? 4 ATOM 3649 N N . THR B 1 196 ? -7.390 -23.617 -24.633 1.000 78.020 0 202 THR BBB N 1 ? 4 ATOM 3650 C CA . THR B 1 196 ? -8.541 -23.255 -23.757 1.000 78.356 0 202 THR BBB CA 1 ? 4 ATOM 3651 C C . THR B 1 196 ? -9.285 -24.540 -23.355 1.000 79.965 0 202 THR BBB C 1 ? 4 ATOM 3652 O O . THR B 1 196 ? -10.388 -24.438 -22.775 1.000 77.933 0 202 THR BBB O 1 ? 4 ATOM 3653 C CB . THR B 1 196 ? -9.403 -22.220 -24.503 1.000 78.235 0 202 THR BBB CB 1 ? 4 ATOM 3654 O OG1 . THR B 1 196 ? -9.085 -20.933 -23.971 1.000 76.327 0 202 THR BBB OG1 1 ? 4 ATOM 3655 C CG2 . THR B 1 196 ? -10.901 -22.439 -24.431 1.000 78.917 0 202 THR BBB CG2 1 ? 4 ATOM 3656 N N . LEU B 1 197 ? -8.689 -25.703 -23.642 1.000 77.771 0 203 LEU BBB N 1 ? 4 ATOM 3657 C CA . LEU B 1 197 ? -9.302 -27.039 -23.423 1.000 75.124 0 203 LEU BBB CA 1 ? 4 ATOM 3658 C C . LEU B 1 197 ? -9.501 -27.267 -21.916 1.000 70.090 0 203 LEU BBB C 1 ? 4 ATOM 3659 O O . LEU B 1 197 ? -10.442 -27.990 -21.536 1.000 65.619 0 203 LEU BBB O 1 ? 4 ATOM 3660 C CB . LEU B 1 197 ? -8.382 -28.091 -24.052 1.000 76.413 0 203 LEU BBB CB 1 ? 4 ATOM 3661 C CG . LEU B 1 197 ? -9.037 -29.425 -24.402 1.000 80.638 0 203 LEU BBB CG 1 ? 4 ATOM 3662 C CD1 . LEU B 1 197 ? -10.173 -29.233 -25.396 1.000 82.517 0 203 LEU BBB CD1 1 ? 4 ATOM 3663 C CD2 . LEU B 1 197 ? -8.008 -30.403 -24.952 1.000 84.349 0 203 LEU BBB CD2 1 ? 4 ATOM 3664 N N . ASP B 1 198 ? -8.648 -26.650 -21.095 1.000 69.259 0 204 ASP BBB N 1 ? 4 ATOM 3665 C CA . ASP B 1 198 ? -8.626 -26.796 -19.615 1.000 71.382 0 204 ASP BBB CA 1 ? 4 ATOM 3666 C C . ASP B 1 198 ? -9.972 -26.360 -19.027 1.000 66.223 0 204 ASP BBB C 1 ? 4 ATOM 3667 O O . ASP B 1 198 ? -10.415 -26.996 -18.049 1.000 62.458 0 204 ASP BBB O 1 ? 4 ATOM 3668 C CB . ASP B 1 198 ? -7.477 -25.985 -19.012 1.000 75.997 0 204 ASP BBB CB 1 ? 4 ATOM 3669 C CG . ASP B 1 198 ? -6.109 -26.405 -19.522 1.000 87.215 0 204 ASP BBB CG 1 ? 4 ATOM 3670 O OD1 . ASP B 1 198 ? -5.572 -27.395 -18.989 1.000 98.194 0 204 ASP BBB OD1 1 ? 4 ATOM 3671 O OD2 . ASP B 1 198 ? -5.589 -25.735 -20.446 1.000 90.656 0 204 ASP BBB OD2 1 ? 4 ATOM 3672 N N . TYR B 1 199 ? -10.592 -25.324 -19.608 1.000 63.049 0 205 TYR BBB N 1 ? 4 ATOM 3673 C CA . TYR B 1 199 ? -11.841 -24.680 -19.115 1.000 62.161 0 205 TYR BBB CA 1 ? 4 ATOM 3674 C C . TYR B 1 199 ? -13.070 -25.389 -19.710 1.000 64.556 0 205 TYR BBB C 1 ? 4 ATOM 3675 O O . TYR B 1 199 ? -14.166 -24.785 -19.791 1.000 64.171 0 205 TYR BBB O 1 ? 4 ATOM 3676 C CB . TYR B 1 199 ? -11.811 -23.181 -19.434 1.000 61.016 0 205 TYR BBB CB 1 ? 4 ATOM 3677 C CG . TYR B 1 199 ? -10.776 -22.386 -18.675 1.000 60.715 0 205 TYR BBB CG 1 ? 4 ATOM 3678 C CD1 . TYR B 1 199 ? -11.081 -21.785 -17.464 1.000 60.343 0 205 TYR BBB CD1 1 ? 4 ATOM 3679 C CD2 . TYR B 1 199 ? -9.490 -22.225 -19.169 1.000 60.405 0 205 TYR BBB CD2 1 ? 4 ATOM 3680 C CE1 . TYR B 1 199 ? -10.135 -21.054 -16.761 1.000 62.280 0 205 TYR BBB CE1 1 ? 4 ATOM 3681 C CE2 . TYR B 1 199 ? -8.533 -21.497 -18.482 1.000 60.637 0 205 TYR BBB CE2 1 ? 4 ATOM 3682 C CZ . TYR B 1 199 ? -8.856 -20.905 -17.276 1.000 64.198 0 205 TYR BBB CZ 1 ? 4 ATOM 3683 O OH . TYR B 1 199 ? -7.907 -20.187 -16.606 1.000 66.859 0 205 TYR BBB OH 1 ? 4 ATOM 3684 N N . LEU B 1 200 ? -12.899 -26.649 -20.114 1.000 65.767 0 206 LEU BBB N 1 ? 4 ATOM 3685 C CA . LEU B 1 200 ? -13.983 -27.516 -20.637 1.000 68.383 0 206 LEU BBB CA 1 ? 4 ATOM 3686 C C . LEU B 1 200 ? -14.002 -28.791 -19.803 1.000 71.160 0 206 LEU BBB C 1 ? 4 ATOM 3687 O O . LEU B 1 200 ? -13.069 -29.588 -19.866 1.000 74.335 0 206 LEU BBB O 1 ? 4 ATOM 3688 C CB . LEU B 1 200 ? -13.722 -27.823 -22.117 1.000 69.465 0 206 LEU BBB CB 1 ? 4 ATOM 3689 C CG . LEU B 1 200 ? -14.595 -27.081 -23.128 1.000 66.519 0 206 LEU BBB CG 1 ? 4 ATOM 3690 C CD1 . LEU B 1 200 ? -14.186 -25.620 -23.242 1.000 65.325 0 206 LEU BBB CD1 1 ? 4 ATOM 3691 C CD2 . LEU B 1 200 ? -14.513 -27.761 -24.482 1.000 66.807 0 206 LEU BBB CD2 1 ? 4 ATOM 3692 N N . PRO B 1 201 ? -15.050 -29.019 -18.984 1.000 71.580 0 207 PRO BBB N 1 ? 4 ATOM 3693 C CA . PRO B 1 201 ? -15.137 -30.240 -18.184 1.000 74.830 0 207 PRO BBB CA 1 ? 4 ATOM 3694 C C . PRO B 1 201 ? -15.479 -31.469 -19.025 1.000 77.236 0 207 PRO BBB C 1 ? 4 ATOM 3695 O O . PRO B 1 201 ? -15.941 -31.337 -20.156 1.000 78.007 0 207 PRO BBB O 1 ? 4 ATOM 3696 C CB . PRO B 1 201 ? -16.251 -29.912 -17.177 1.000 75.217 0 207 PRO BBB CB 1 ? 4 ATOM 3697 C CG . PRO B 1 201 ? -17.127 -28.899 -17.889 1.000 72.863 0 207 PRO BBB CG 1 ? 4 ATOM 3698 C CD . PRO B 1 201 ? -16.186 -28.111 -18.773 1.000 70.342 0 207 PRO BBB CD 1 ? 4 ATOM 3699 N N . PRO B 1 202 ? -15.251 -32.696 -18.501 1.000 80.441 0 208 PRO BBB N 1 ? 4 ATOM 3700 C CA . PRO B 1 202 ? -15.597 -33.935 -19.203 1.000 83.292 0 208 PRO BBB CA 1 ? 4 ATOM 3701 C C . PRO B 1 202 ? -16.938 -33.938 -19.957 1.000 85.316 0 208 PRO BBB C 1 ? 4 ATOM 3702 O O . PRO B 1 202 ? -16.952 -34.378 -21.085 1.000 94.348 0 208 PRO BBB O 1 ? 4 ATOM 3703 C CB . PRO B 1 202 ? -15.649 -34.951 -18.051 1.000 85.744 0 208 PRO BBB CB 1 ? 4 ATOM 3704 C CG . PRO B 1 202 ? -14.579 -34.470 -17.096 1.000 83.403 0 208 PRO BBB CG 1 ? 4 ATOM 3705 C CD . PRO B 1 202 ? -14.607 -32.958 -17.204 1.000 80.882 0 208 PRO BBB CD 1 ? 4 ATOM 3706 N N . GLU B 1 203 ? -18.019 -33.467 -19.329 1.000 83.284 0 209 GLU BBB N 1 ? 4 ATOM 3707 C CA . GLU B 1 203 ? -19.386 -33.464 -19.926 1.000 87.808 0 209 GLU BBB CA 1 ? 4 ATOM 3708 C C . GLU B 1 203 ? -19.332 -32.786 -21.301 1.000 92.909 0 209 GLU BBB C 1 ? 4 ATOM 3709 O O . GLU B 1 203 ? -19.844 -33.376 -22.282 1.000 98.530 0 209 GLU BBB O 1 ? 4 ATOM 3710 C CB . GLU B 1 203 ? -20.401 -32.728 -19.053 1.000 88.674 0 209 GLU BBB CB 1 ? 4 ATOM 3711 C CG . GLU B 1 203 ? -20.225 -32.944 -17.565 1.000 93.776 0 209 GLU BBB CG 1 ? 4 ATOM 3712 C CD . GLU B 1 203 ? -19.284 -31.955 -16.900 1.000 93.217 0 209 GLU BBB CD 1 ? 4 ATOM 3713 O OE1 . GLU B 1 203 ? -18.350 -32.412 -16.202 1.000 99.812 0 209 GLU BBB OE1 1 ? 4 ATOM 3714 O OE2 . GLU B 1 203 ? -19.487 -30.739 -17.078 1.000 84.840 0 209 GLU BBB OE2 1 ? 4 ATOM 3715 N N . MET B 1 204 ? -18.728 -31.593 -21.360 1.000 88.842 0 210 MET BBB N 1 ? 4 ATOM 3716 C CA . MET B 1 204 ? -18.544 -30.791 -22.600 1.000 82.101 0 210 MET BBB CA 1 ? 4 ATOM 3717 C C . MET B 1 204 ? -17.612 -31.539 -23.553 1.000 77.427 0 210 MET BBB C 1 ? 4 ATOM 3718 O O . MET B 1 204 ? -17.964 -31.638 -24.736 1.000 81.291 0 210 MET BBB O 1 ? 4 ATOM 3719 C CB . MET B 1 204 ? -17.942 -29.419 -22.291 1.000 81.829 0 210 MET BBB CB 1 ? 4 ATOM 3720 C CG . MET B 1 204 ? -18.848 -28.547 -21.443 1.000 82.924 0 210 MET BBB CG 1 ? 4 ATOM 3721 S SD . MET B 1 204 ? -18.568 -26.780 -21.718 1.000 83.490 0 210 MET BBB SD 1 ? 4 ATOM 3722 C CE . MET B 1 204 ? -19.215 -26.569 -23.377 1.000 81.635 0 210 MET BBB CE 1 ? 4 ATOM 3723 N N . ILE B 1 205 ? -16.480 -32.041 -23.046 1.000 75.325 0 211 ILE BBB N 1 ? 4 ATOM 3724 C CA . ILE B 1 205 ? -15.438 -32.772 -23.831 1.000 77.093 0 211 ILE BBB CA 1 ? 4 ATOM 3725 C C . ILE B 1 205 ? -16.116 -33.905 -24.612 1.000 81.611 0 211 ILE BBB C 1 ? 4 ATOM 3726 O O . ILE B 1 205 ? -15.902 -33.989 -25.838 1.000 84.454 0 211 ILE BBB O 1 ? 4 ATOM 3727 C CB . ILE B 1 205 ? -14.310 -33.302 -22.919 1.000 77.536 0 211 ILE BBB CB 1 ? 4 ATOM 3728 C CG1 . ILE B 1 205 ? -13.411 -32.176 -22.397 1.000 77.340 0 211 ILE BBB CG1 1 ? 4 ATOM 3729 C CG2 . ILE B 1 205 ? -13.494 -34.377 -23.622 1.000 79.928 0 211 ILE BBB CG2 1 ? 4 ATOM 3730 C CD1 . ILE B 1 205 ? -12.530 -31.536 -23.450 1.000 77.825 0 211 ILE BBB CD1 1 ? 4 ATOM 3731 N N . GLU B 1 206 ? -16.914 -34.725 -23.924 1.000 81.624 0 212 GLU BBB N 1 ? 4 ATOM 3732 C CA . GLU B 1 206 ? -17.571 -35.930 -24.493 1.000 82.120 0 212 GLU BBB CA 1 ? 4 ATOM 3733 C C . GLU B 1 206 ? -18.922 -35.566 -25.126 1.000 84.128 0 212 GLU BBB C 1 ? 4 ATOM 3734 O O . GLU B 1 206 ? -19.664 -36.499 -25.460 1.000 85.735 0 212 GLU BBB O 1 ? 4 ATOM 3735 C CB . GLU B 1 206 ? -17.709 -36.992 -23.401 1.000 81.307 0 212 GLU BBB CB 1 ? 4 ATOM 3736 C CG . GLU B 1 206 ? -16.369 -37.427 -22.831 1.000 79.581 0 212 GLU BBB CG 1 ? 4 ATOM 3737 C CD . GLU B 1 206 ? -16.418 -38.504 -21.759 1.000 79.345 0 212 GLU BBB CD 1 ? 4 ATOM 3738 O OE1 . GLU B 1 206 ? -16.572 -39.691 -22.118 1.000 79.774 0 212 GLU BBB OE1 1 ? 4 ATOM 3739 O OE2 . GLU B 1 206 ? -16.275 -38.151 -20.571 1.000 77.933 0 212 GLU BBB OE2 1 ? 4 ATOM 3740 N N . GLY B 1 207 ? -19.243 -34.281 -25.289 1.000 85.663 0 213 GLY BBB N 1 ? 4 ATOM 3741 C CA . GLY B 1 207 ? -20.497 -33.830 -25.922 1.000 91.144 0 213 GLY BBB CA 1 ? 4 ATOM 3742 C C . GLY B 1 207 ? -21.740 -34.260 -25.157 1.000 97.280 0 213 GLY BBB C 1 ? 4 ATOM 3743 O O . GLY B 1 207 ? -22.840 -34.194 -25.746 1.000 99.816 0 213 GLY BBB O 1 ? 4 ATOM 3744 N N . ARG B 1 208 ? -21.590 -34.667 -23.890 1.000 99.491 0 214 ARG BBB N 1 ? 4 ATOM 3745 C CA . ARG B 1 208 ? -22.723 -34.942 -22.961 1.000 101.972 0 214 ARG BBB CA 1 ? 4 ATOM 3746 C C . ARG B 1 208 ? -23.347 -33.605 -22.538 1.000 97.841 0 214 ARG BBB C 1 ? 4 ATOM 3747 O O . ARG B 1 208 ? -22.690 -32.565 -22.761 1.000 92.099 0 214 ARG BBB O 1 ? 4 ATOM 3748 C CB . ARG B 1 208 ? -22.253 -35.747 -21.745 1.000 104.795 0 214 ARG BBB CB 1 ? 4 ATOM 3749 C CG . ARG B 1 208 ? -22.026 -37.231 -22.018 1.000 111.083 0 214 ARG BBB CG 1 ? 4 ATOM 3750 C CD . ARG B 1 208 ? -22.032 -38.082 -20.755 1.000 111.555 0 214 ARG BBB CD 1 ? 4 ATOM 3751 N NE . ARG B 1 208 ? -21.563 -37.311 -19.611 1.000 111.359 0 214 ARG BBB NE 1 ? 4 ATOM 3752 C CZ . ARG B 1 208 ? -20.288 -37.133 -19.258 1.000 113.956 0 214 ARG BBB CZ 1 ? 4 ATOM 3753 N NH1 . ARG B 1 208 ? -19.302 -37.678 -19.953 1.000 115.810 0 214 ARG BBB NH1 1 ? 4 ATOM 3754 N NH2 . ARG B 1 208 ? -20.004 -36.375 -18.212 1.000 116.630 0 214 ARG BBB NH2 1 ? 4 ATOM 3755 N N . THR B 1 209 ? -24.560 -33.644 -21.971 1.000 98.786 0 215 THR BBB N 1 ? 4 ATOM 3756 C CA . THR B 1 209 ? -25.358 -32.462 -21.539 1.000 98.840 0 215 THR BBB CA 1 ? 4 ATOM 3757 C C . THR B 1 209 ? -24.645 -31.748 -20.386 1.000 99.877 0 215 THR BBB C 1 ? 4 ATOM 3758 O O . THR B 1 209 ? -24.036 -32.432 -19.550 1.000 95.928 0 215 THR BBB O 1 ? 4 ATOM 3759 C CB . THR B 1 209 ? -26.784 -32.846 -21.124 1.000 99.705 0 215 THR BBB CB 1 ? 4 ATOM 3760 O OG1 . THR B 1 209 ? -27.448 -33.351 -22.280 1.000 100.952 0 215 THR BBB OG1 1 ? 4 ATOM 3761 C CG2 . THR B 1 209 ? -27.584 -31.690 -20.563 1.000 99.439 0 215 THR BBB CG2 1 ? 4 ATOM 3762 N N . TYR B 1 210 ? -24.782 -30.422 -20.345 1.000 104.003 0 216 TYR BBB N 1 ? 4 ATOM 3763 C CA . TYR B 1 210 ? -24.015 -29.474 -19.497 1.000 100.155 0 216 TYR BBB CA 1 ? 4 ATOM 3764 C C . TYR B 1 210 ? -24.989 -28.397 -19.007 1.000 99.399 0 216 TYR BBB C 1 ? 4 ATOM 3765 O O . TYR B 1 210 ? -25.853 -27.969 -19.806 1.000 100.857 0 216 TYR BBB O 1 ? 4 ATOM 3766 C CB . TYR B 1 210 ? -22.840 -28.892 -20.294 1.000 101.884 0 216 TYR BBB CB 1 ? 4 ATOM 3767 C CG . TYR B 1 210 ? -23.229 -27.962 -21.419 1.000 103.415 0 216 TYR BBB CG 1 ? 4 ATOM 3768 C CD1 . TYR B 1 210 ? -24.079 -28.375 -22.436 1.000 109.062 0 216 TYR BBB CD1 1 ? 4 ATOM 3769 C CD2 . TYR B 1 210 ? -22.750 -26.662 -21.470 1.000 102.596 0 216 TYR BBB CD2 1 ? 4 ATOM 3770 C CE1 . TYR B 1 210 ? -24.451 -27.523 -23.461 1.000 112.271 0 216 TYR BBB CE1 1 ? 4 ATOM 3771 C CE2 . TYR B 1 210 ? -23.102 -25.798 -22.494 1.000 103.465 0 216 TYR BBB CE2 1 ? 4 ATOM 3772 C CZ . TYR B 1 210 ? -23.958 -26.230 -23.491 1.000 111.999 0 216 TYR BBB CZ 1 ? 4 ATOM 3773 O OH . TYR B 1 210 ? -24.318 -25.386 -24.499 1.000 117.042 0 216 TYR BBB OH 1 ? 4 ATOM 3774 N N . ASP B 1 211 ? -24.880 -28.004 -17.735 1.000 95.643 0 217 ASP BBB N 1 ? 4 ATOM 3775 C CA . ASP B 1 211 ? -25.692 -26.922 -17.113 1.000 93.358 0 217 ASP BBB CA 1 ? 4 ATOM 3776 C C . ASP B 1 211 ? -24.723 -25.916 -16.480 1.000 88.795 0 217 ASP BBB C 1 ? 4 ATOM 3777 O O . ASP B 1 211 ? -23.517 -26.018 -16.770 1.000 87.848 0 217 ASP BBB O 1 ? 4 ATOM 3778 C CB . ASP B 1 211 ? -26.708 -27.496 -16.119 1.000 101.970 0 217 ASP BBB CB 1 ? 4 ATOM 3779 C CG . ASP B 1 211 ? -26.085 -28.142 -14.892 1.000 108.191 0 217 ASP BBB CG 1 ? 4 ATOM 3780 O OD1 . ASP B 1 211 ? -25.007 -28.758 -15.037 1.000 112.988 0 217 ASP BBB OD1 1 ? 4 ATOM 3781 O OD2 . ASP B 1 211 ? -26.683 -28.023 -13.800 1.000 104.569 0 217 ASP BBB OD2 1 ? 4 ATOM 3782 N N . GLU B 1 212 ? -25.224 -25.009 -15.629 1.000 84.623 0 218 GLU BBB N 1 ? 4 ATOM 3783 C CA A GLU B 1 212 ? -24.393 -23.939 -15.000 0.500 76.686 0 218 GLU BBB CA 1 ? 4 ATOM 3784 C CA B GLU B 1 212 ? -24.450 -23.940 -14.938 0.500 78.702 0 218 GLU BBB CA 1 ? 4 ATOM 3785 C C . GLU B 1 212 ? -23.435 -24.545 -13.957 1.000 75.450 0 218 GLU BBB C 1 ? 4 ATOM 3786 O O . GLU B 1 212 ? -22.691 -23.769 -13.342 1.000 73.626 0 218 GLU BBB O 1 ? 4 ATOM 3787 C CB A GLU B 1 212 ? -25.272 -22.839 -14.393 0.500 73.358 0 218 GLU BBB CB 1 ? 4 ATOM 3788 C CB B GLU B 1 212 ? -25.403 -22.992 -14.200 0.500 78.334 0 218 GLU BBB CB 1 ? 4 ATOM 3789 C CG A GLU B 1 212 ? -25.877 -21.889 -15.417 0.500 70.216 0 218 GLU BBB CG 1 ? 4 ATOM 3790 C CG B GLU B 1 212 ? -26.286 -23.674 -13.164 0.500 79.978 0 218 GLU BBB CG 1 ? 4 ATOM 3791 C CD A GLU B 1 212 ? -24.911 -21.013 -16.205 0.500 63.538 0 218 GLU BBB CD 1 ? 4 ATOM 3792 C CD B GLU B 1 212 ? -27.635 -24.148 -13.678 0.500 81.240 0 218 GLU BBB CD 1 ? 4 ATOM 3793 O OE1 A GLU B 1 212 ? -24.220 -20.162 -15.599 0.500 58.567 0 218 GLU BBB OE1 1 ? 4 ATOM 3794 O OE1 B GLU B 1 212 ? -27.866 -25.371 -13.687 0.500 80.657 0 218 GLU BBB OE1 1 ? 4 ATOM 3795 O OE2 A GLU B 1 212 ? -24.875 -21.168 -17.437 0.500 60.916 0 218 GLU BBB OE2 1 ? 4 ATOM 3796 O OE2 B GLU B 1 212 ? -28.450 -23.290 -14.067 0.500 81.572 0 218 GLU BBB OE2 1 ? 4 ATOM 3797 N N . LYS B 1 213 ? -23.416 -25.873 -13.793 1.000 75.654 0 219 LYS BBB N 1 ? 4 ATOM 3798 C CA . LYS B 1 213 ? -22.401 -26.570 -12.953 1.000 76.792 0 219 LYS BBB CA 1 ? 4 ATOM 3799 C C . LYS B 1 213 ? -21.048 -26.588 -13.673 1.000 76.165 0 219 LYS BBB C 1 ? 4 ATOM 3800 O O . LYS B 1 213 ? -20.044 -26.949 -13.027 1.000 73.581 0 219 LYS BBB O 1 ? 4 ATOM 3801 C CB . LYS B 1 213 ? -22.846 -27.989 -12.589 1.000 80.854 0 219 LYS BBB CB 1 ? 4 ATOM 3802 C CG . LYS B 1 213 ? -23.692 -28.059 -11.325 1.000 86.057 0 219 LYS BBB CG 1 ? 4 ATOM 3803 C CD . LYS B 1 213 ? -24.525 -29.302 -11.198 1.000 92.462 0 219 LYS BBB CD 1 ? 4 ATOM 3804 C CE . LYS B 1 213 ? -25.744 -29.067 -10.333 1.000 99.586 0 219 LYS BBB CE 1 ? 4 ATOM 3805 N NZ . LYS B 1 213 ? -26.423 -30.340 -10.004 1.000 112.061 0 219 LYS BBB NZ 1 ? 4 ATOM 3806 N N . VAL B 1 214 ? -21.018 -26.219 -14.957 1.000 76.736 0 220 VAL BBB N 1 ? 4 ATOM 3807 C CA . VAL B 1 214 ? -19.756 -26.036 -15.734 1.000 75.812 0 220 VAL BBB CA 1 ? 4 ATOM 3808 C C . VAL B 1 214 ? -18.980 -24.877 -15.106 1.000 71.796 0 220 VAL BBB C 1 ? 4 ATOM 3809 O O . VAL B 1 214 ? -17.747 -25.014 -14.969 1.000 70.295 0 220 VAL BBB O 1 ? 4 ATOM 3810 C CB . VAL B 1 214 ? -20.033 -25.787 -17.228 1.000 80.219 0 220 VAL BBB CB 1 ? 4 ATOM 3811 C CG1 . VAL B 1 214 ? -18.792 -25.292 -17.955 1.000 78.388 0 220 VAL BBB CG1 1 ? 4 ATOM 3812 C CG2 . VAL B 1 214 ? -20.596 -27.028 -17.909 1.000 85.813 0 220 VAL BBB CG2 1 ? 4 ATOM 3813 N N . ASP B 1 215 ? -19.686 -23.797 -14.742 1.000 69.392 0 221 ASP BBB N 1 ? 4 ATOM 3814 C CA . ASP B 1 215 ? -19.132 -22.607 -14.039 1.000 67.109 0 221 ASP BBB CA 1 ? 4 ATOM 3815 C C . ASP B 1 215 ? -18.207 -23.067 -12.901 1.000 65.833 0 221 ASP BBB C 1 ? 4 ATOM 3816 O O . ASP B 1 215 ? -17.097 -22.526 -12.790 1.000 66.226 0 221 ASP BBB O 1 ? 4 ATOM 3817 C CB . ASP B 1 215 ? -20.242 -21.694 -13.499 1.000 66.082 0 221 ASP BBB CB 1 ? 4 ATOM 3818 C CG . ASP B 1 215 ? -21.001 -20.919 -14.565 1.000 64.700 0 221 ASP BBB CG 1 ? 4 ATOM 3819 O OD1 . ASP B 1 215 ? -20.483 -20.835 -15.689 1.000 62.548 0 221 ASP BBB OD1 1 ? 4 ATOM 3820 O OD2 . ASP B 1 215 ? -22.102 -20.401 -14.258 1.000 62.711 0 221 ASP BBB OD2 1 ? 4 ATOM 3821 N N . LEU B 1 216 ? -18.640 -24.045 -12.104 1.000 63.723 0 222 LEU BBB N 1 ? 4 ATOM 3822 C CA . LEU B 1 216 ? -17.908 -24.508 -10.894 1.000 65.283 0 222 LEU BBB CA 1 ? 4 ATOM 3823 C C . LEU B 1 216 ? -16.539 -25.045 -11.318 1.000 64.653 0 222 LEU BBB C 1 ? 4 ATOM 3824 O O . LEU B 1 216 ? -15.532 -24.659 -10.695 1.000 64.402 0 222 LEU BBB O 1 ? 4 ATOM 3825 C CB . LEU B 1 216 ? -18.736 -25.572 -10.164 1.000 67.107 0 222 LEU BBB CB 1 ? 4 ATOM 3826 C CG . LEU B 1 216 ? -20.178 -25.166 -9.849 1.000 67.745 0 222 LEU BBB CG 1 ? 4 ATOM 3827 C CD1 . LEU B 1 216 ? -20.960 -26.324 -9.251 1.000 70.681 0 222 LEU BBB CD1 1 ? 4 ATOM 3828 C CD2 . LEU B 1 216 ? -20.222 -23.955 -8.931 1.000 66.097 0 222 LEU BBB CD2 1 ? 4 ATOM 3829 N N . TRP B 1 217 ? -16.496 -25.880 -12.358 1.000 64.937 0 223 TRP BBB N 1 ? 4 ATOM 3830 C CA . TRP B 1 217 ? -15.232 -26.451 -12.895 1.000 64.991 0 223 TRP BBB CA 1 ? 4 ATOM 3831 C C . TRP B 1 217 ? -14.286 -25.286 -13.220 1.000 62.996 0 223 TRP BBB C 1 ? 4 ATOM 3832 O O . TRP B 1 217 ? -13.183 -25.242 -12.647 1.000 68.693 0 223 TRP BBB O 1 ? 4 ATOM 3833 C CB . TRP B 1 217 ? -15.517 -27.378 -14.089 1.000 64.853 0 223 TRP BBB CB 1 ? 4 ATOM 3834 C CG . TRP B 1 217 ? -14.320 -27.896 -14.831 1.000 64.888 0 223 TRP BBB CG 1 ? 4 ATOM 3835 C CD1 . TRP B 1 217 ? -13.659 -27.263 -15.843 1.000 64.847 0 223 TRP BBB CD1 1 ? 4 ATOM 3836 C CD2 . TRP B 1 217 ? -13.683 -29.182 -14.691 1.000 65.215 0 223 TRP BBB CD2 1 ? 4 ATOM 3837 N NE1 . TRP B 1 217 ? -12.639 -28.044 -16.315 1.000 63.481 0 223 TRP BBB NE1 1 ? 4 ATOM 3838 C CE2 . TRP B 1 217 ? -12.628 -29.226 -15.627 1.000 64.832 0 223 TRP BBB CE2 1 ? 4 ATOM 3839 C CE3 . TRP B 1 217 ? -13.880 -30.293 -13.863 1.000 67.841 0 223 TRP BBB CE3 1 ? 4 ATOM 3840 C CZ2 . TRP B 1 217 ? -11.782 -30.328 -15.750 1.000 67.271 0 223 TRP BBB CZ2 1 ? 4 ATOM 3841 C CZ3 . TRP B 1 217 ? -13.045 -31.384 -13.988 1.000 67.655 0 223 TRP BBB CZ3 1 ? 4 ATOM 3842 C CH2 . TRP B 1 217 ? -12.007 -31.399 -14.917 1.000 66.743 0 223 TRP BBB CH2 1 ? 4 ATOM 3843 N N . CYS B 1 218 ? -14.740 -24.324 -14.023 1.000 58.779 0 224 CYS BBB N 1 ? 4 ATOM 3844 C CA . CYS B 1 218 ? -13.902 -23.215 -14.554 1.000 58.184 0 224 CYS BBB CA 1 ? 4 ATOM 3845 C C . CYS B 1 218 ? -13.260 -22.426 -13.405 1.000 56.445 0 224 CYS BBB C 1 ? 4 ATOM 3846 O O . CYS B 1 218 ? -12.067 -22.102 -13.502 1.000 53.649 0 224 CYS BBB O 1 ? 4 ATOM 3847 C CB . CYS B 1 218 ? -14.718 -22.311 -15.469 1.000 59.751 0 224 CYS BBB CB 1 ? 4 ATOM 3848 S SG . CYS B 1 218 ? -15.309 -23.173 -16.950 1.000 67.256 0 224 CYS BBB SG 1 ? 4 ATOM 3849 N N . ILE B 1 219 ? -14.009 -22.145 -12.341 1.000 59.919 0 225 ILE BBB N 1 ? 4 ATOM 3850 C CA . ILE B 1 219 ? -13.495 -21.403 -11.152 1.000 59.506 0 225 ILE BBB CA 1 ? 4 ATOM 3851 C C . ILE B 1 219 ? -12.316 -22.185 -10.564 1.000 59.050 0 225 ILE BBB C 1 ? 4 ATOM 3852 O O . ILE B 1 219 ? -11.299 -21.543 -10.218 1.000 57.313 0 225 ILE BBB O 1 ? 4 ATOM 3853 C CB . ILE B 1 219 ? -14.615 -21.165 -10.126 1.000 62.802 0 225 ILE BBB CB 1 ? 4 ATOM 3854 C CG1 . ILE B 1 219 ? -15.665 -20.197 -10.674 1.000 63.197 0 225 ILE BBB CG1 1 ? 4 ATOM 3855 C CG2 . ILE B 1 219 ? -14.039 -20.683 -8.801 1.000 68.728 0 225 ILE BBB CG2 1 ? 4 ATOM 3856 C CD1 . ILE B 1 219 ? -16.963 -20.212 -9.903 1.000 67.997 0 225 ILE BBB CD1 1 ? 4 ATOM 3857 N N . GLY B 1 220 ? -12.449 -23.513 -10.475 1.000 58.477 0 226 GLY BBB N 1 ? 4 ATOM 3858 C CA . GLY B 1 220 ? -11.368 -24.424 -10.054 1.000 59.830 0 226 GLY BBB CA 1 ? 4 ATOM 3859 C C . GLY B 1 220 ? -10.146 -24.294 -10.951 1.000 58.949 0 226 GLY BBB C 1 ? 4 ATOM 3860 O O . GLY B 1 220 ? -9.020 -24.193 -10.418 1.000 58.942 0 226 GLY BBB O 1 ? 4 ATOM 3861 N N . VAL B 1 221 ? -10.356 -24.287 -12.269 1.000 57.174 0 227 VAL BBB N 1 ? 4 ATOM 3862 C CA . VAL B 1 221 ? -9.274 -24.117 -13.283 1.000 57.641 0 227 VAL BBB CA 1 ? 4 ATOM 3863 C C . VAL B 1 221 ? -8.652 -22.734 -13.056 1.000 55.448 0 227 VAL BBB C 1 ? 4 ATOM 3864 O O . VAL B 1 221 ? -7.416 -22.664 -12.869 1.000 51.683 0 227 VAL BBB O 1 ? 4 ATOM 3865 C CB . VAL B 1 221 ? -9.801 -24.286 -14.724 1.000 58.155 0 227 VAL BBB CB 1 ? 4 ATOM 3866 C CG1 . VAL B 1 221 ? -8.699 -24.151 -15.764 1.000 58.379 0 227 VAL BBB CG1 1 ? 4 ATOM 3867 C CG2 . VAL B 1 221 ? -10.530 -25.608 -14.913 1.000 60.882 0 227 VAL BBB CG2 1 ? 4 ATOM 3868 N N . LEU B 1 222 ? -9.487 -21.685 -13.040 1.000 56.184 0 228 LEU BBB N 1 ? 4 ATOM 3869 C CA . LEU B 1 222 ? -9.049 -20.269 -12.902 1.000 56.415 0 228 LEU BBB CA 1 ? 4 ATOM 3870 C C . LEU B 1 222 ? -8.203 -20.132 -11.644 1.000 55.497 0 228 LEU BBB C 1 ? 4 ATOM 3871 O O . LEU B 1 222 ? -7.167 -19.451 -11.693 1.000 54.104 0 228 LEU BBB O 1 ? 4 ATOM 3872 C CB . LEU B 1 222 ? -10.248 -19.322 -12.810 1.000 56.723 0 228 LEU BBB CB 1 ? 4 ATOM 3873 C CG . LEU B 1 222 ? -9.887 -17.847 -12.603 1.000 54.034 0 228 LEU BBB CG 1 ? 4 ATOM 3874 C CD1 . LEU B 1 222 ? -9.101 -17.299 -13.786 1.000 53.565 0 228 LEU BBB CD1 1 ? 4 ATOM 3875 C CD2 . LEU B 1 222 ? -11.131 -17.005 -12.372 1.000 52.141 0 228 LEU BBB CD2 1 ? 4 ATOM 3876 N N . CYS B 1 223 ? -8.648 -20.738 -10.549 1.000 57.482 0 229 CYS BBB N 1 ? 4 ATOM 3877 C CA . CYS B 1 223 ? -7.938 -20.634 -9.254 1.000 58.267 0 229 CYS BBB CA 1 ? 4 ATOM 3878 C C . CYS B 1 223 ? -6.537 -21.234 -9.403 1.000 59.775 0 229 CYS BBB C 1 ? 4 ATOM 3879 O O . CYS B 1 223 ? -5.565 -20.552 -9.012 1.000 62.237 0 229 CYS BBB O 1 ? 4 ATOM 3880 C CB . CYS B 1 223 ? -8.694 -21.294 -8.116 1.000 59.461 0 229 CYS BBB CB 1 ? 4 ATOM 3881 S SG . CYS B 1 223 ? -8.163 -20.610 -6.531 1.000 64.384 0 229 CYS BBB SG 1 ? 4 ATOM 3882 N N . TYR B 1 224 ? -6.433 -22.434 -9.980 1.000 58.807 0 230 TYR BBB N 1 ? 4 ATOM 3883 C CA . TYR B 1 224 ? -5.135 -23.117 -10.213 1.000 60.364 0 230 TYR BBB CA 1 ? 4 ATOM 3884 C C . TYR B 1 224 ? -4.248 -22.208 -11.069 1.000 62.058 0 230 TYR BBB C 1 ? 4 ATOM 3885 O O . TYR B 1 224 ? -3.104 -21.971 -10.652 1.000 64.564 0 230 TYR BBB O 1 ? 4 ATOM 3886 C CB . TYR B 1 224 ? -5.326 -24.491 -10.853 1.000 61.819 0 230 TYR BBB CB 1 ? 4 ATOM 3887 C CG . TYR B 1 224 ? -4.054 -25.290 -10.997 1.000 65.318 0 230 TYR BBB CG 1 ? 4 ATOM 3888 C CD1 . TYR B 1 224 ? -3.154 -25.026 -12.020 1.000 64.609 0 230 TYR BBB CD1 1 ? 4 ATOM 3889 C CD2 . TYR B 1 224 ? -3.748 -26.316 -10.113 1.000 67.614 0 230 TYR BBB CD2 1 ? 4 ATOM 3890 C CE1 . TYR B 1 224 ? -1.981 -25.751 -12.157 1.000 65.824 0 230 TYR BBB CE1 1 ? 4 ATOM 3891 C CE2 . TYR B 1 224 ? -2.585 -27.059 -10.246 1.000 69.251 0 230 TYR BBB CE2 1 ? 4 ATOM 3892 C CZ . TYR B 1 224 ? -1.699 -26.777 -11.273 1.000 68.326 0 230 TYR BBB CZ 1 ? 4 ATOM 3893 O OH . TYR B 1 224 ? -0.555 -27.504 -11.426 1.000 71.001 0 230 TYR BBB OH 1 ? 4 ATOM 3894 N N . GLU B 1 225 ? -4.770 -21.699 -12.196 1.000 60.027 0 231 GLU BBB N 1 ? 4 ATOM 3895 C CA . GLU B 1 225 ? -4.017 -20.865 -13.176 1.000 59.248 0 231 GLU BBB CA 1 ? 4 ATOM 3896 C C . GLU B 1 225 ? -3.450 -19.618 -12.481 1.000 60.755 0 231 GLU BBB C 1 ? 4 ATOM 3897 O O . GLU B 1 225 ? -2.233 -19.390 -12.589 1.000 63.757 0 231 GLU BBB O 1 ? 4 ATOM 3898 C CB . GLU B 1 225 ? -4.899 -20.481 -14.367 1.000 58.485 0 231 GLU BBB CB 1 ? 4 ATOM 3899 C CG . GLU B 1 225 ? -4.140 -19.759 -15.476 1.000 61.177 0 231 GLU BBB CG 1 ? 4 ATOM 3900 C CD . GLU B 1 225 ? -4.656 -19.952 -16.898 1.000 63.026 0 231 GLU BBB CD 1 ? 4 ATOM 3901 O OE1 . GLU B 1 225 ? -5.641 -20.701 -17.092 1.000 61.286 0 231 GLU BBB OE1 1 ? 4 ATOM 3902 O OE2 . GLU B 1 225 ? -4.061 -19.359 -17.818 1.000 64.841 0 231 GLU BBB OE2 1 ? 4 ATOM 3903 N N . LEU B 1 226 ? -4.282 -18.846 -11.777 1.000 59.791 0 232 LEU BBB N 1 ? 4 ATOM 3904 C CA . LEU B 1 226 ? -3.859 -17.579 -11.118 1.000 59.377 0 232 LEU BBB CA 1 ? 4 ATOM 3905 C C . LEU B 1 226 ? -2.691 -17.857 -10.156 1.000 61.557 0 232 LEU BBB C 1 ? 4 ATOM 3906 O O . LEU B 1 226 ? -1.738 -17.055 -10.147 1.000 64.089 0 232 LEU BBB O 1 ? 4 ATOM 3907 C CB . LEU B 1 226 ? -5.054 -16.947 -10.393 1.000 56.287 0 232 LEU BBB CB 1 ? 4 ATOM 3908 C CG . LEU B 1 226 ? -6.210 -16.490 -11.288 1.000 54.872 0 232 LEU BBB CG 1 ? 4 ATOM 3909 C CD1 . LEU B 1 226 ? -7.455 -16.193 -10.470 1.000 54.297 0 232 LEU BBB CD1 1 ? 4 ATOM 3910 C CD2 . LEU B 1 226 ? -5.832 -15.271 -12.118 1.000 54.423 0 232 LEU BBB CD2 1 ? 4 ATOM 3911 N N . LEU B 1 227 ? -2.741 -18.957 -9.397 1.000 61.228 0 233 LEU BBB N 1 ? 4 ATOM 3912 C CA . LEU B 1 227 ? -1.750 -19.257 -8.324 1.000 63.563 0 233 LEU BBB CA 1 ? 4 ATOM 3913 C C . LEU B 1 227 ? -0.454 -19.822 -8.920 1.000 64.057 0 233 LEU BBB C 1 ? 4 ATOM 3914 O O . LEU B 1 227 ? 0.624 -19.461 -8.408 1.000 65.412 0 233 LEU BBB O 1 ? 4 ATOM 3915 C CB . LEU B 1 227 ? -2.361 -20.228 -7.307 1.000 65.839 0 233 LEU BBB CB 1 ? 4 ATOM 3916 C CG . LEU B 1 227 ? -3.489 -19.657 -6.443 1.000 66.257 0 233 LEU BBB CG 1 ? 4 ATOM 3917 C CD1 . LEU B 1 227 ? -4.143 -20.745 -5.600 1.000 67.146 0 233 LEU BBB CD1 1 ? 4 ATOM 3918 C CD2 . LEU B 1 227 ? -2.990 -18.524 -5.553 1.000 65.296 0 233 LEU BBB CD2 1 ? 4 ATOM 3919 N N . VAL B 1 228 ? -0.546 -20.671 -9.946 1.000 63.789 0 234 VAL BBB N 1 ? 4 ATOM 3920 C CA . VAL B 1 228 ? 0.602 -21.467 -10.477 1.000 65.264 0 234 VAL BBB CA 1 ? 4 ATOM 3921 C C . VAL B 1 228 ? 1.244 -20.742 -11.665 1.000 64.235 0 234 VAL BBB C 1 ? 4 ATOM 3922 O O . VAL B 1 228 ? 2.483 -20.836 -11.799 1.000 68.372 0 234 VAL BBB O 1 ? 4 ATOM 3923 C CB . VAL B 1 228 ? 0.166 -22.890 -10.868 1.000 67.904 0 234 VAL BBB CB 1 ? 4 ATOM 3924 C CG1 . VAL B 1 228 ? 1.356 -23.736 -11.286 1.000 74.251 0 234 VAL BBB CG1 1 ? 4 ATOM 3925 C CG2 . VAL B 1 228 ? -0.594 -23.573 -9.744 1.000 69.013 0 234 VAL BBB CG2 1 ? 4 ATOM 3926 N N . GLY B 1 229 ? 0.434 -20.080 -12.498 1.000 59.977 0 235 GLY BBB N 1 ? 4 ATOM 3927 C CA . GLY B 1 229 ? 0.879 -19.340 -13.697 1.000 60.831 0 235 GLY BBB CA 1 ? 4 ATOM 3928 C C . GLY B 1 229 ? 0.413 -19.986 -14.998 1.000 61.740 0 235 GLY BBB C 1 ? 4 ATOM 3929 O O . GLY B 1 229 ? 0.520 -19.323 -16.051 1.000 64.332 0 235 GLY BBB O 1 ? 4 ATOM 3930 N N . TYR B 1 230 ? -0.085 -21.228 -14.942 1.000 60.791 0 236 TYR BBB N 1 ? 4 ATOM 3931 C CA . TYR B 1 230 ? -0.494 -22.033 -16.124 1.000 60.295 0 236 TYR BBB CA 1 ? 4 ATOM 3932 C C . TYR B 1 230 ? -1.664 -22.944 -15.755 1.000 60.534 0 236 TYR BBB C 1 ? 4 ATOM 3933 O O . TYR B 1 230 ? -1.827 -23.294 -14.594 1.000 62.761 0 236 TYR BBB O 1 ? 4 ATOM 3934 C CB . TYR B 1 230 ? 0.697 -22.820 -16.680 1.000 61.231 0 236 TYR BBB CB 1 ? 4 ATOM 3935 C CG . TYR B 1 230 ? 1.387 -23.745 -15.707 1.000 63.695 0 236 TYR BBB CG 1 ? 4 ATOM 3936 C CD1 . TYR B 1 230 ? 0.810 -24.944 -15.316 1.000 63.741 0 236 TYR BBB CD1 1 ? 4 ATOM 3937 C CD2 . TYR B 1 230 ? 2.641 -23.441 -15.198 1.000 65.369 0 236 TYR BBB CD2 1 ? 4 ATOM 3938 C CE1 . TYR B 1 230 ? 1.439 -25.800 -14.427 1.000 64.740 0 236 TYR BBB CE1 1 ? 4 ATOM 3939 C CE2 . TYR B 1 230 ? 3.286 -24.286 -14.309 1.000 66.905 0 236 TYR BBB CE2 1 ? 4 ATOM 3940 C CZ . TYR B 1 230 ? 2.685 -25.473 -13.926 1.000 67.153 0 236 TYR BBB CZ 1 ? 4 ATOM 3941 O OH . TYR B 1 230 ? 3.310 -26.308 -13.047 1.000 70.625 0 236 TYR BBB OH 1 ? 4 ATOM 3942 N N . PRO B 1 231 ? -2.517 -23.359 -16.721 1.000 62.511 0 237 PRO BBB N 1 ? 4 ATOM 3943 C CA . PRO B 1 231 ? -3.681 -24.189 -16.412 1.000 61.661 0 237 PRO BBB CA 1 ? 4 ATOM 3944 C C . PRO B 1 231 ? -3.260 -25.594 -15.994 1.000 64.593 0 237 PRO BBB C 1 ? 4 ATOM 3945 O O . PRO B 1 231 ? -2.262 -26.112 -16.488 1.000 70.902 0 237 PRO BBB O 1 ? 4 ATOM 3946 C CB . PRO B 1 231 ? -4.480 -24.227 -17.722 1.000 62.670 0 237 PRO BBB CB 1 ? 4 ATOM 3947 C CG . PRO B 1 231 ? -3.855 -23.155 -18.605 1.000 63.037 0 237 PRO BBB CG 1 ? 4 ATOM 3948 C CD . PRO B 1 231 ? -2.416 -23.061 -18.158 1.000 63.702 0 237 PRO BBB CD 1 ? 4 ATOM 3949 N N . PRO B 1 232 ? -4.001 -26.256 -15.078 1.000 64.789 0 238 PRO BBB N 1 ? 4 ATOM 3950 C CA . PRO B 1 232 ? -3.548 -27.518 -14.492 1.000 66.473 0 238 PRO BBB CA 1 ? 4 ATOM 3951 C C . PRO B 1 232 ? -3.338 -28.654 -15.506 1.000 69.905 0 238 PRO BBB C 1 ? 4 ATOM 3952 O O . PRO B 1 232 ? -2.379 -29.396 -15.344 1.000 71.221 0 238 PRO BBB O 1 ? 4 ATOM 3953 C CB . PRO B 1 232 ? -4.656 -27.890 -13.492 1.000 65.444 0 238 PRO BBB CB 1 ? 4 ATOM 3954 C CG . PRO B 1 232 ? -5.865 -27.083 -13.919 1.000 64.475 0 238 PRO BBB CG 1 ? 4 ATOM 3955 C CD . PRO B 1 232 ? -5.310 -25.828 -14.560 1.000 64.316 0 238 PRO BBB CD 1 ? 4 ATOM 3956 N N . PHE B 1 233 ? -4.207 -28.759 -16.519 1.000 70.169 0 239 PHE BBB N 1 ? 4 ATOM 3957 C CA . PHE B 1 233 ? -4.276 -29.923 -17.443 1.000 73.631 0 239 PHE BBB CA 1 ? 4 ATOM 3958 C C . PHE B 1 233 ? -3.402 -29.718 -18.686 1.000 76.524 0 239 PHE BBB C 1 ? 4 ATOM 3959 O O . PHE B 1 233 ? -3.185 -30.720 -19.396 1.000 76.844 0 239 PHE BBB O 1 ? 4 ATOM 3960 C CB . PHE B 1 233 ? -5.724 -30.212 -17.835 1.000 73.628 0 239 PHE BBB CB 1 ? 4 ATOM 3961 C CG . PHE B 1 233 ? -6.614 -30.528 -16.663 1.000 76.739 0 239 PHE BBB CG 1 ? 4 ATOM 3962 C CD1 . PHE B 1 233 ? -6.410 -31.677 -15.909 1.000 77.980 0 239 PHE BBB CD1 1 ? 4 ATOM 3963 C CD2 . PHE B 1 233 ? -7.647 -29.675 -16.303 1.000 75.909 0 239 PHE BBB CD2 1 ? 4 ATOM 3964 C CE1 . PHE B 1 233 ? -7.232 -31.971 -14.831 1.000 76.528 0 239 PHE BBB CE1 1 ? 4 ATOM 3965 C CE2 . PHE B 1 233 ? -8.459 -29.965 -15.215 1.000 73.773 0 239 PHE BBB CE2 1 ? 4 ATOM 3966 C CZ . PHE B 1 233 ? -8.253 -31.114 -14.487 1.000 74.757 0 239 PHE BBB CZ 1 ? 4 ATOM 3967 N N . GLU B 1 234 ? -2.899 -28.501 -18.935 1.000 81.613 0 240 GLU BBB N 1 ? 4 ATOM 3968 C CA . GLU B 1 234 ? -2.099 -28.183 -20.154 1.000 95.752 0 240 GLU BBB CA 1 ? 4 ATOM 3969 C C . GLU B 1 234 ? -0.850 -29.078 -20.178 1.000 100.675 0 240 GLU BBB C 1 ? 4 ATOM 3970 O O . GLU B 1 234 ? -0.371 -29.458 -19.093 1.000 105.700 0 240 GLU BBB O 1 ? 4 ATOM 3971 C CB . GLU B 1 234 ? -1.736 -26.693 -20.229 1.000 100.622 0 240 GLU BBB CB 1 ? 4 ATOM 3972 C CG . GLU B 1 234 ? -0.489 -26.301 -19.440 1.000 98.634 0 240 GLU BBB CG 1 ? 4 ATOM 3973 C CD . GLU B 1 234 ? 0.283 -25.103 -19.973 1.000 94.253 0 240 GLU BBB CD 1 ? 4 ATOM 3974 O OE1 . GLU B 1 234 ? 1.533 -25.179 -20.013 1.000 92.445 0 240 GLU BBB OE1 1 ? 4 ATOM 3975 O OE2 . GLU B 1 234 ? -0.361 -24.100 -20.346 1.000 88.429 0 240 GLU BBB OE2 1 ? 4 ATOM 3976 N N . SER B 1 235 ? -0.354 -29.406 -21.374 1.000 101.187 0 241 SER BBB N 1 ? 4 ATOM 3977 C CA . SER B 1 235 ? 0.856 -30.244 -21.594 1.000 101.902 0 241 SER BBB CA 1 ? 4 ATOM 3978 C C . SER B 1 235 ? 1.524 -29.839 -22.915 1.000 99.512 0 241 SER BBB C 1 ? 4 ATOM 3979 O O . SER B 1 235 ? 1.367 -28.672 -23.309 1.000 102.234 0 241 SER BBB O 1 ? 4 ATOM 3980 C CB . SER B 1 235 ? 0.499 -31.707 -21.554 1.000 100.423 0 241 SER BBB CB 1 ? 4 ATOM 3981 O OG . SER B 1 235 ? -0.175 -32.088 -22.740 1.000 97.316 0 241 SER BBB OG 1 ? 4 ATOM 3982 N N . ALA B 1 236 ? 2.268 -30.746 -23.554 1.000 99.557 0 242 ALA BBB N 1 ? 4 ATOM 3983 C CA . ALA B 1 236 ? 2.849 -30.559 -24.907 1.000 104.634 0 242 ALA BBB CA 1 ? 4 ATOM 3984 C C . ALA B 1 236 ? 1.999 -31.293 -25.953 1.000 102.314 0 242 ALA BBB C 1 ? 4 ATOM 3985 O O . ALA B 1 236 ? 1.906 -30.793 -27.087 1.000 99.525 0 242 ALA BBB O 1 ? 4 ATOM 3986 C CB . ALA B 1 236 ? 4.278 -31.038 -24.935 1.000 109.390 0 242 ALA BBB CB 1 ? 4 ATOM 3987 N N . SER B 1 237 ? 1.420 -32.439 -25.583 1.000 103.260 0 243 SER BBB N 1 ? 4 ATOM 3988 C CA . SER B 1 237 ? 0.523 -33.262 -26.435 1.000 104.186 0 243 SER BBB CA 1 ? 4 ATOM 3989 C C . SER B 1 237 ? -0.936 -32.866 -26.172 1.000 100.781 0 243 SER BBB C 1 ? 4 ATOM 3990 O O . SER B 1 237 ? -1.258 -32.516 -25.030 1.000 103.051 0 243 SER BBB O 1 ? 4 ATOM 3991 C CB . SER B 1 237 ? 0.768 -34.731 -26.194 1.000 108.695 0 243 SER BBB CB 1 ? 4 ATOM 3992 O OG . SER B 1 237 ? -0.128 -35.532 -26.947 1.000 115.139 0 243 SER BBB OG 1 ? 4 ATOM 3993 N N . HIS B 1 238 ? -1.779 -32.899 -27.205 1.000 101.795 0 244 HIS BBB N 1 ? 4 ATOM 3994 C CA . HIS B 1 238 ? -3.232 -32.595 -27.123 1.000 97.176 0 244 HIS BBB CA 1 ? 4 ATOM 3995 C C . HIS B 1 238 ? -3.971 -33.817 -26.576 1.000 91.957 0 244 HIS BBB C 1 ? 4 ATOM 3996 O O . HIS B 1 238 ? -4.868 -33.636 -25.743 1.000 87.350 0 244 HIS BBB O 1 ? 4 ATOM 3997 C CB . HIS B 1 238 ? -3.743 -32.134 -28.491 1.000 99.582 0 244 HIS BBB CB 1 ? 4 ATOM 3998 C CG . HIS B 1 238 ? -3.120 -30.844 -28.894 1.000 100.816 0 244 HIS BBB CG 1 ? 4 ATOM 3999 N ND1 . HIS B 1 238 ? -2.162 -30.761 -29.877 1.000 106.188 0 244 HIS BBB ND1 1 ? 4 ATOM 4000 C CD2 . HIS B 1 238 ? -3.262 -29.600 -28.392 1.000 101.467 0 244 HIS BBB CD2 1 ? 4 ATOM 4001 C CE1 . HIS B 1 238 ? -1.769 -29.509 -29.992 1.000 107.924 0 244 HIS BBB CE1 1 ? 4 ATOM 4002 N NE2 . HIS B 1 238 ? -2.433 -28.777 -29.098 1.000 102.906 0 244 HIS BBB NE2 1 ? 4 ATOM 4003 N N . SER B 1 239 ? -3.592 -35.007 -27.045 1.000 94.713 0 245 SER BBB N 1 ? 4 ATOM 4004 C CA . SER B 1 239 ? -4.079 -36.324 -26.555 1.000 95.314 0 245 SER BBB CA 1 ? 4 ATOM 4005 C C . SER B 1 239 ? -3.797 -36.456 -25.052 1.000 92.434 0 245 SER BBB C 1 ? 4 ATOM 4006 O O . SER B 1 239 ? -4.644 -37.044 -24.349 1.000 91.577 0 245 SER BBB O 1 ? 4 ATOM 4007 C CB . SER B 1 239 ? -3.455 -37.454 -27.343 1.000 98.984 0 245 SER BBB CB 1 ? 4 ATOM 4008 O OG . SER B 1 239 ? -3.666 -38.703 -26.701 1.000 100.539 0 245 SER BBB OG 1 ? 4 ATOM 4009 N N . GLU B 1 240 ? -2.653 -35.932 -24.587 1.000 89.837 0 246 GLU BBB N 1 ? 4 ATOM 4010 C CA . GLU B 1 240 ? -2.244 -35.913 -23.154 1.000 86.205 0 246 GLU BBB CA 1 ? 4 ATOM 4011 C C . GLU B 1 240 ? -3.226 -35.032 -22.374 1.000 81.413 0 246 GLU BBB C 1 ? 4 ATOM 4012 O O . GLU B 1 240 ? -3.908 -35.575 -21.488 1.000 80.853 0 246 GLU BBB O 1 ? 4 ATOM 4013 C CB . GLU B 1 240 ? -0.801 -35.421 -23.007 1.000 86.860 0 246 GLU BBB CB 1 ? 4 ATOM 4014 C CG . GLU B 1 240 ? -0.317 -35.302 -21.568 1.000 85.813 0 246 GLU BBB CG 1 ? 4 ATOM 4015 C CD . GLU B 1 240 ? 0.198 -36.586 -20.943 1.000 87.266 0 246 GLU BBB CD 1 ? 4 ATOM 4016 O OE1 . GLU B 1 240 ? 0.999 -37.288 -21.594 1.000 92.046 0 246 GLU BBB OE1 1 ? 4 ATOM 4017 O OE2 . GLU B 1 240 ? -0.203 -36.880 -19.803 1.000 83.989 0 246 GLU BBB OE2 1 ? 4 ATOM 4018 N N . THR B 1 241 ? -3.308 -33.737 -22.710 1.000 77.739 0 247 THR BBB N 1 ? 4 ATOM 4019 C CA . THR B 1 241 ? -4.246 -32.751 -22.097 1.000 73.637 0 247 THR BBB CA 1 ? 4 ATOM 4020 C C . THR B 1 241 ? -5.651 -33.368 -22.038 1.000 72.959 0 247 THR BBB C 1 ? 4 ATOM 4021 O O . THR B 1 241 ? -6.333 -33.195 -21.024 1.000 69.170 0 247 THR BBB O 1 ? 4 ATOM 4022 C CB . THR B 1 241 ? -4.219 -31.412 -22.852 1.000 70.277 0 247 THR BBB CB 1 ? 4 ATOM 4023 O OG1 . THR B 1 241 ? -2.914 -30.840 -22.765 1.000 68.432 0 247 THR BBB OG1 1 ? 4 ATOM 4024 C CG2 . THR B 1 241 ? -5.206 -30.401 -22.311 1.000 68.803 0 247 THR BBB CG2 1 ? 4 ATOM 4025 N N . TYR B 1 242 ? -6.047 -34.081 -23.092 1.000 80.164 0 248 TYR BBB N 1 ? 4 ATOM 4026 C CA . TYR B 1 242 ? -7.360 -34.762 -23.236 1.000 86.183 0 248 TYR BBB CA 1 ? 4 ATOM 4027 C C . TYR B 1 242 ? -7.504 -35.846 -22.155 1.000 83.923 0 248 TYR BBB C 1 ? 4 ATOM 4028 O O . TYR B 1 242 ? -8.553 -35.876 -21.480 1.000 80.519 0 248 TYR BBB O 1 ? 4 ATOM 4029 C CB . TYR B 1 242 ? -7.488 -35.300 -24.665 1.000 94.012 0 248 TYR BBB CB 1 ? 4 ATOM 4030 C CG . TYR B 1 242 ? -8.870 -35.739 -25.069 1.000 104.965 0 248 TYR BBB CG 1 ? 4 ATOM 4031 C CD1 . TYR B 1 242 ? -9.793 -34.834 -25.571 1.000 106.568 0 248 TYR BBB CD1 1 ? 4 ATOM 4032 C CD2 . TYR B 1 242 ? -9.246 -37.071 -24.980 1.000 117.185 0 248 TYR BBB CD2 1 ? 4 ATOM 4033 C CE1 . TYR B 1 242 ? -11.063 -35.240 -25.952 1.000 113.210 0 248 TYR BBB CE1 1 ? 4 ATOM 4034 C CE2 . TYR B 1 242 ? -10.509 -37.494 -25.361 1.000 121.031 0 248 TYR BBB CE2 1 ? 4 ATOM 4035 C CZ . TYR B 1 242 ? -11.420 -36.576 -25.851 1.000 121.808 0 248 TYR BBB CZ 1 ? 4 ATOM 4036 O OH . TYR B 1 242 ? -12.662 -37.004 -26.224 1.000 129.159 0 248 TYR BBB OH 1 ? 4 ATOM 4037 N N . ARG B 1 243 ? -6.480 -36.690 -21.986 1.000 86.584 0 249 ARG BBB N 1 ? 4 ATOM 4038 C CA . ARG B 1 243 ? -6.451 -37.823 -21.012 1.000 89.416 0 249 ARG BBB CA 1 ? 4 ATOM 4039 C C . ARG B 1 243 ? -6.534 -37.278 -19.576 1.000 86.636 0 249 ARG BBB C 1 ? 4 ATOM 4040 O O . ARG B 1 243 ? -7.373 -37.786 -18.801 1.000 85.806 0 249 ARG BBB O 1 ? 4 ATOM 4041 C CB . ARG B 1 243 ? -5.188 -38.668 -21.229 1.000 92.416 0 249 ARG BBB CB 1 ? 4 ATOM 4042 C CG . ARG B 1 243 ? -5.067 -39.897 -20.335 1.000 97.941 0 249 ARG BBB CG 1 ? 4 ATOM 4043 C CD . ARG B 1 243 ? -3.651 -40.448 -20.312 1.000 101.743 0 249 ARG BBB CD 1 ? 4 ATOM 4044 N NE . ARG B 1 243 ? -2.713 -39.445 -19.819 1.000 102.294 0 249 ARG BBB NE 1 ? 4 ATOM 4045 C CZ . ARG B 1 243 ? -2.409 -39.239 -18.540 1.000 102.386 0 249 ARG BBB CZ 1 ? 4 ATOM 4046 N NH1 . ARG B 1 243 ? -2.945 -39.984 -17.589 1.000 106.359 0 249 ARG BBB NH1 1 ? 4 ATOM 4047 N NH2 . ARG B 1 243 ? -1.556 -38.287 -18.209 1.000 101.264 0 249 ARG BBB NH2 1 ? 4 ATOM 4048 N N . ARG B 1 244 ? -5.702 -36.280 -19.247 1.000 83.026 0 250 ARG BBB N 1 ? 4 ATOM 4049 C CA . ARG B 1 244 ? -5.569 -35.681 -17.890 1.000 80.985 0 250 ARG BBB CA 1 ? 4 ATOM 4050 C C . ARG B 1 244 ? -6.909 -35.080 -17.438 1.000 78.819 0 250 ARG BBB C 1 ? 4 ATOM 4051 O O . ARG B 1 244 ? -7.218 -35.179 -16.223 1.000 79.489 0 250 ARG BBB O 1 ? 4 ATOM 4052 C CB . ARG B 1 244 ? -4.468 -34.613 -17.866 1.000 81.284 0 250 ARG BBB CB 1 ? 4 ATOM 4053 C CG . ARG B 1 244 ? -3.062 -35.144 -18.112 1.000 85.823 0 250 ARG BBB CG 1 ? 4 ATOM 4054 C CD . ARG B 1 244 ? -1.977 -34.167 -17.697 1.000 86.632 0 250 ARG BBB CD 1 ? 4 ATOM 4055 N NE . ARG B 1 244 ? -1.911 -34.055 -16.246 1.000 90.166 0 250 ARG BBB NE 1 ? 4 ATOM 4056 C CZ . ARG B 1 244 ? -1.321 -33.069 -15.576 1.000 94.112 0 250 ARG BBB CZ 1 ? 4 ATOM 4057 N NH1 . ARG B 1 244 ? -0.716 -32.084 -16.217 1.000 98.045 0 250 ARG BBB NH1 1 ? 4 ATOM 4058 N NH2 . ARG B 1 244 ? -1.340 -33.070 -14.256 1.000 94.737 0 250 ARG BBB NH2 1 ? 4 ATOM 4059 N N . ILE B 1 245 ? -7.668 -34.467 -18.356 1.000 73.567 0 251 ILE BBB N 1 ? 4 ATOM 4060 C CA . ILE B 1 245 ? -8.977 -33.826 -18.028 1.000 71.351 0 251 ILE BBB CA 1 ? 4 ATOM 4061 C C . ILE B 1 245 ? -9.971 -34.923 -17.624 1.000 73.711 0 251 ILE BBB C 1 ? 4 ATOM 4062 O O . ILE B 1 245 ? -10.543 -34.820 -16.520 1.000 75.149 0 251 ILE BBB O 1 ? 4 ATOM 4063 C CB . ILE B 1 245 ? -9.503 -32.959 -19.189 1.000 68.903 0 251 ILE BBB CB 1 ? 4 ATOM 4064 C CG1 . ILE B 1 245 ? -8.636 -31.719 -19.404 1.000 66.796 0 251 ILE BBB CG1 1 ? 4 ATOM 4065 C CG2 . ILE B 1 245 ? -10.958 -32.571 -18.961 1.000 68.263 0 251 ILE BBB CG2 1 ? 4 ATOM 4066 C CD1 . ILE B 1 245 ? -8.762 -31.123 -20.792 1.000 66.243 0 251 ILE BBB CD1 1 ? 4 ATOM 4067 N N . LEU B 1 246 ? -10.141 -35.941 -18.468 1.000 75.930 0 252 LEU BBB N 1 ? 4 ATOM 4068 C CA . LEU B 1 246 ? -11.167 -37.008 -18.296 1.000 79.819 0 252 LEU BBB CA 1 ? 4 ATOM 4069 C C . LEU B 1 246 ? -10.857 -37.852 -17.048 1.000 83.401 0 252 LEU BBB C 1 ? 4 ATOM 4070 O O . LEU B 1 246 ? -11.817 -38.364 -16.436 1.000 84.556 0 252 LEU BBB O 1 ? 4 ATOM 4071 C CB . LEU B 1 246 ? -11.224 -37.867 -19.568 1.000 81.089 0 252 LEU BBB CB 1 ? 4 ATOM 4072 C CG . LEU B 1 246 ? -12.391 -37.591 -20.523 1.000 81.501 0 252 LEU BBB CG 1 ? 4 ATOM 4073 C CD1 . LEU B 1 246 ? -12.515 -36.112 -20.865 1.000 78.021 0 252 LEU BBB CD1 1 ? 4 ATOM 4074 C CD2 . LEU B 1 246 ? -12.256 -38.419 -21.794 1.000 84.446 0 252 LEU BBB CD2 1 ? 4 ATOM 4075 N N . LYS B 1 247 ? -9.577 -38.001 -16.688 1.000 85.160 0 253 LYS BBB N 1 ? 4 ATOM 4076 C CA . LYS B 1 247 ? -9.137 -38.755 -15.481 1.000 88.773 0 253 LYS BBB CA 1 ? 4 ATOM 4077 C C . LYS B 1 247 ? -8.975 -37.784 -14.301 1.000 85.372 0 253 LYS BBB C 1 ? 4 ATOM 4078 O O . LYS B 1 247 ? -8.587 -38.255 -13.214 1.000 82.111 0 253 LYS BBB O 1 ? 4 ATOM 4079 C CB . LYS B 1 247 ? -7.838 -39.519 -15.764 1.000 93.356 0 253 LYS BBB CB 1 ? 4 ATOM 4080 C CG . LYS B 1 247 ? -7.896 -40.495 -16.937 1.000 98.225 0 253 LYS BBB CG 1 ? 4 ATOM 4081 C CD . LYS B 1 247 ? -7.108 -41.779 -16.746 1.000 103.680 0 253 LYS BBB CD 1 ? 4 ATOM 4082 C CE . LYS B 1 247 ? -5.631 -41.549 -16.506 1.000 107.599 0 253 LYS BBB CE 1 ? 4 ATOM 4083 N NZ . LYS B 1 247 ? -5.305 -41.420 -15.064 1.000 109.700 0 253 LYS BBB NZ 1 ? 4 ATOM 4084 N N . VAL B 1 248 ? -9.302 -36.499 -14.515 1.000 83.427 0 254 VAL BBB N 1 ? 4 ATOM 4085 C CA . VAL B 1 248 ? -9.096 -35.338 -13.591 1.000 81.622 0 254 VAL BBB CA 1 ? 4 ATOM 4086 C C . VAL B 1 248 ? -7.725 -35.452 -12.909 1.000 83.250 0 254 VAL BBB C 1 ? 4 ATOM 4087 O O . VAL B 1 248 ? -7.658 -35.243 -11.681 1.000 84.866 0 254 VAL BBB O 1 ? 4 ATOM 4088 C CB . VAL B 1 248 ? -10.240 -35.184 -12.565 1.000 81.046 0 254 VAL BBB CB 1 ? 4 ATOM 4089 C CG1 . VAL B 1 248 ? -11.512 -34.668 -13.214 1.000 78.828 0 254 VAL BBB CG1 1 ? 4 ATOM 4090 C CG2 . VAL B 1 248 ? -10.527 -36.467 -11.793 1.000 87.011 0 254 VAL BBB CG2 1 ? 4 ATOM 4091 N N . ASP B 1 249 ? -6.672 -35.714 -13.693 1.000 83.611 0 255 ASP BBB N 1 ? 4 ATOM 4092 C CA . ASP B 1 249 ? -5.264 -35.901 -13.234 1.000 83.990 0 255 ASP BBB CA 1 ? 4 ATOM 4093 C C . ASP B 1 249 ? -4.656 -34.532 -12.881 1.000 80.537 0 255 ASP BBB C 1 ? 4 ATOM 4094 O O . ASP B 1 249 ? -3.775 -34.057 -13.625 1.000 80.817 0 255 ASP BBB O 1 ? 4 ATOM 4095 C CB . ASP B 1 249 ? -4.472 -36.659 -14.307 1.000 87.384 0 255 ASP BBB CB 1 ? 4 ATOM 4096 C CG . ASP B 1 249 ? -3.044 -37.041 -13.953 1.000 89.450 0 255 ASP BBB CG 1 ? 4 ATOM 4097 O OD1 . ASP B 1 249 ? -2.570 -36.631 -12.872 1.000 87.057 0 255 ASP BBB OD1 1 ? 4 ATOM 4098 O OD2 . ASP B 1 249 ? -2.417 -37.750 -14.779 1.000 90.895 0 255 ASP BBB OD2 1 ? 4 ATOM 4099 N N . VAL B 1 250 ? -5.112 -33.926 -11.779 1.000 78.133 0 256 VAL BBB N 1 ? 4 ATOM 4100 C CA . VAL B 1 250 ? -4.616 -32.622 -11.247 1.000 75.973 0 256 VAL BBB CA 1 ? 4 ATOM 4101 C C . VAL B 1 250 ? -3.337 -32.898 -10.451 1.000 78.608 0 256 VAL BBB C 1 ? 4 ATOM 4102 O O . VAL B 1 250 ? -3.367 -33.813 -9.606 1.000 78.523 0 256 VAL BBB O 1 ? 4 ATOM 4103 C CB . VAL B 1 250 ? -5.678 -31.931 -10.370 1.000 75.702 0 256 VAL BBB CB 1 ? 4 ATOM 4104 C CG1 . VAL B 1 250 ? -5.209 -30.564 -9.885 1.000 73.938 0 256 VAL BBB CG1 1 ? 4 ATOM 4105 C CG2 . VAL B 1 250 ? -7.022 -31.817 -11.080 1.000 74.742 0 256 VAL BBB CG2 1 ? 4 ATOM 4106 N N . ARG B 1 251 ? -2.263 -32.147 -10.717 1.000 82.220 0 257 ARG BBB N 1 ? 4 ATOM 4107 C CA . ARG B 1 251 ? -0.950 -32.296 -10.030 1.000 91.439 0 257 ARG BBB CA 1 ? 4 ATOM 4108 C C . ARG B 1 251 ? -0.502 -30.930 -9.506 1.000 93.265 0 257 ARG BBB C 1 ? 4 ATOM 4109 O O . ARG B 1 251 ? -0.122 -30.077 -10.338 1.000 97.777 0 257 ARG BBB O 1 ? 4 ATOM 4110 C CB . ARG B 1 251 ? 0.105 -32.886 -10.969 1.000 98.156 0 257 ARG BBB CB 1 ? 4 ATOM 4111 C CG . ARG B 1 251 ? -0.143 -34.338 -11.355 1.000 103.427 0 257 ARG BBB CG 1 ? 4 ATOM 4112 C CD . ARG B 1 251 ? 0.993 -34.915 -12.180 1.000 108.272 0 257 ARG BBB CD 1 ? 4 ATOM 4113 N NE . ARG B 1 251 ? 0.507 -35.737 -13.283 1.000 113.898 0 257 ARG BBB NE 1 ? 4 ATOM 4114 C CZ . ARG B 1 251 ? 1.072 -35.827 -14.489 1.000 118.975 0 257 ARG BBB CZ 1 ? 4 ATOM 4115 N NH1 . ARG B 1 251 ? 2.161 -35.135 -14.784 1.000 120.535 0 257 ARG BBB NH1 1 ? 4 ATOM 4116 N NH2 . ARG B 1 251 ? 0.533 -36.607 -15.410 1.000 120.551 0 257 ARG BBB NH2 1 ? 4 ATOM 4117 N N . PHE B 1 252 ? -0.521 -30.761 -8.177 1.000 90.926 0 258 PHE BBB N 1 ? 4 ATOM 4118 C CA . PHE B 1 252 ? -0.260 -29.489 -7.454 1.000 86.554 0 258 PHE BBB CA 1 ? 4 ATOM 4119 C C . PHE B 1 252 ? 1.228 -29.359 -7.142 1.000 90.180 0 258 PHE BBB C 1 ? 4 ATOM 4120 O O . PHE B 1 252 ? 1.845 -30.317 -6.679 1.000 94.491 0 258 PHE BBB O 1 ? 4 ATOM 4121 C CB . PHE B 1 252 ? -1.070 -29.440 -6.156 1.000 83.281 0 258 PHE BBB CB 1 ? 4 ATOM 4122 C CG . PHE B 1 252 ? -2.558 -29.597 -6.336 1.000 80.205 0 258 PHE BBB CG 1 ? 4 ATOM 4123 C CD1 . PHE B 1 252 ? -3.361 -28.509 -6.653 1.000 77.085 0 258 PHE BBB CD1 1 ? 4 ATOM 4124 C CD2 . PHE B 1 252 ? -3.161 -30.837 -6.187 1.000 80.346 0 258 PHE BBB CD2 1 ? 4 ATOM 4125 C CE1 . PHE B 1 252 ? -4.729 -28.663 -6.820 1.000 74.891 0 258 PHE BBB CE1 1 ? 4 ATOM 4126 C CE2 . PHE B 1 252 ? -4.531 -30.986 -6.347 1.000 77.918 0 258 PHE BBB CE2 1 ? 4 ATOM 4127 C CZ . PHE B 1 252 ? -5.314 -29.900 -6.660 1.000 74.991 0 258 PHE BBB CZ 1 ? 4 ATOM 4128 N N . PRO B 1 253 ? 1.849 -28.176 -7.369 1.000 89.909 0 259 PRO BBB N 1 ? 4 ATOM 4129 C CA . PRO B 1 253 ? 3.247 -27.965 -7.006 1.000 93.008 0 259 PRO BBB CA 1 ? 4 ATOM 4130 C C . PRO B 1 253 ? 3.345 -27.951 -5.477 1.000 101.038 0 259 PRO BBB C 1 ? 4 ATOM 4131 O O . PRO B 1 253 ? 2.458 -27.401 -4.844 1.000 96.106 0 259 PRO BBB O 1 ? 4 ATOM 4132 C CB . PRO B 1 253 ? 3.608 -26.608 -7.629 1.000 88.335 0 259 PRO BBB CB 1 ? 4 ATOM 4133 C CG . PRO B 1 253 ? 2.283 -25.883 -7.731 1.000 86.378 0 259 PRO BBB CG 1 ? 4 ATOM 4134 C CD . PRO B 1 253 ? 1.244 -26.968 -7.950 1.000 87.755 0 259 PRO BBB CD 1 ? 4 ATOM 4135 N N . LEU B 1 254 ? 4.406 -28.544 -4.928 1.000 110.695 0 260 LEU BBB N 1 ? 4 ATOM 4136 C CA . LEU B 1 254 ? 4.545 -28.773 -3.463 1.000 117.849 0 260 LEU BBB CA 1 ? 4 ATOM 4137 C C . LEU B 1 254 ? 4.544 -27.415 -2.745 1.000 113.746 0 260 LEU BBB C 1 ? 4 ATOM 4138 O O . LEU B 1 254 ? 4.204 -27.377 -1.552 1.000 116.722 0 260 LEU BBB O 1 ? 4 ATOM 4139 C CB . LEU B 1 254 ? 5.825 -29.571 -3.177 1.000 130.803 0 260 LEU BBB CB 1 ? 4 ATOM 4140 C CG . LEU B 1 254 ? 5.783 -31.076 -3.470 1.000 137.400 0 260 LEU BBB CG 1 ? 4 ATOM 4141 C CD1 . LEU B 1 254 ? 4.718 -31.776 -2.635 1.000 136.578 0 260 LEU BBB CD1 1 ? 4 ATOM 4142 C CD2 . LEU B 1 254 ? 5.576 -31.362 -4.955 1.000 132.781 0 260 LEU BBB CD2 1 ? 4 ATOM 4143 N N . SER B 1 255 ? 4.865 -26.334 -3.464 1.000 112.028 0 261 SER BBB N 1 ? 4 ATOM 4144 C CA . SER B 1 255 ? 4.835 -24.932 -2.975 1.000 110.650 0 261 SER BBB CA 1 ? 4 ATOM 4145 C C . SER B 1 255 ? 3.392 -24.443 -2.773 1.000 101.200 0 261 SER BBB C 1 ? 4 ATOM 4146 O O . SER B 1 255 ? 3.225 -23.377 -2.157 1.000 94.769 0 261 SER BBB O 1 ? 4 ATOM 4147 C CB . SER B 1 255 ? 5.581 -24.040 -3.933 1.000 115.970 0 261 SER BBB CB 1 ? 4 ATOM 4148 O OG . SER B 1 255 ? 5.766 -22.750 -3.376 1.000 122.183 0 261 SER BBB OG 1 ? 4 ATOM 4149 N N . MET B 1 256 ? 2.393 -25.175 -3.281 1.000 99.473 0 262 MET BBB N 1 ? 4 ATOM 4150 C CA . MET B 1 256 ? 0.954 -24.784 -3.268 1.000 91.911 0 262 MET BBB CA 1 ? 4 ATOM 4151 C C . MET B 1 256 ? 0.453 -24.661 -1.830 1.000 83.747 0 262 MET BBB C 1 ? 4 ATOM 4152 O O . MET B 1 256 ? 0.643 -25.574 -1.028 1.000 80.553 0 262 MET BBB O 1 ? 4 ATOM 4153 C CB . MET B 1 256 ? 0.103 -25.827 -4.001 1.000 93.152 0 262 MET BBB CB 1 ? 4 ATOM 4154 C CG . MET B 1 256 ? -1.371 -25.497 -4.046 1.000 93.105 0 262 MET BBB CG 1 ? 4 ATOM 4155 S SD . MET B 1 256 ? -1.753 -24.384 -5.409 1.000 97.856 0 262 MET BBB SD 1 ? 4 ATOM 4156 C CE . MET B 1 256 ? -3.486 -24.764 -5.654 1.000 94.087 0 262 MET BBB CE 1 ? 4 ATOM 4157 N N . PRO B 1 257 ? -0.200 -23.533 -1.465 1.000 78.527 0 263 PRO BBB N 1 ? 4 ATOM 4158 C CA . PRO B 1 257 ? -0.978 -23.442 -0.226 1.000 77.536 0 263 PRO BBB CA 1 ? 4 ATOM 4159 C C . PRO B 1 257 ? -2.071 -24.516 -0.091 1.000 77.659 0 263 PRO BBB C 1 ? 4 ATOM 4160 O O . PRO B 1 257 ? -2.790 -24.732 -1.048 1.000 74.538 0 263 PRO BBB O 1 ? 4 ATOM 4161 C CB . PRO B 1 257 ? -1.636 -22.055 -0.312 1.000 75.004 0 263 PRO BBB CB 1 ? 4 ATOM 4162 C CG . PRO B 1 257 ? -0.694 -21.255 -1.184 1.000 76.194 0 263 PRO BBB CG 1 ? 4 ATOM 4163 C CD . PRO B 1 257 ? -0.170 -22.257 -2.196 1.000 76.991 0 263 PRO BBB CD 1 ? 4 ATOM 4164 N N . LEU B 1 258 ? -2.183 -25.128 1.096 1.000 81.320 0 264 LEU BBB N 1 ? 4 ATOM 4165 C CA . LEU B 1 258 ? -3.060 -26.302 1.364 1.000 81.853 0 264 LEU BBB CA 1 ? 4 ATOM 4166 C C . LEU B 1 258 ? -4.530 -25.903 1.196 1.000 79.293 0 264 LEU BBB C 1 ? 4 ATOM 4167 O O . LEU B 1 258 ? -5.258 -26.628 0.490 1.000 76.863 0 264 LEU BBB O 1 ? 4 ATOM 4168 C CB . LEU B 1 258 ? -2.771 -26.841 2.768 1.000 87.154 0 264 LEU BBB CB 1 ? 4 ATOM 4169 C CG . LEU B 1 258 ? -1.383 -27.459 2.958 1.000 91.419 0 264 LEU BBB CG 1 ? 4 ATOM 4170 C CD1 . LEU B 1 258 ? -1.272 -28.167 4.307 1.000 91.825 0 264 LEU BBB CD1 1 ? 4 ATOM 4171 C CD2 . LEU B 1 258 ? -1.048 -28.419 1.818 1.000 90.211 0 264 LEU BBB CD2 1 ? 4 ATOM 4172 N N . GLY B 1 259 ? -4.941 -24.784 1.800 1.000 79.012 0 265 GLY BBB N 1 ? 4 ATOM 4173 C CA . GLY B 1 259 ? -6.292 -24.208 1.638 1.000 78.215 0 265 GLY BBB CA 1 ? 4 ATOM 4174 C C . GLY B 1 259 ? -6.738 -24.172 0.180 1.000 74.647 0 265 GLY BBB C 1 ? 4 ATOM 4175 O O . GLY B 1 259 ? -7.874 -24.596 -0.094 1.000 74.678 0 265 GLY BBB O 1 ? 4 ATOM 4176 N N . ALA B 1 260 ? -5.880 -23.695 -0.728 1.000 72.174 0 266 ALA BBB N 1 ? 4 ATOM 4177 C CA . ALA B 1 260 ? -6.158 -23.564 -2.181 1.000 72.225 0 266 ALA BBB CA 1 ? 4 ATOM 4178 C C . ALA B 1 260 ? -6.289 -24.950 -2.834 1.000 72.523 0 266 ALA BBB C 1 ? 4 ATOM 4179 O O . ALA B 1 260 ? -7.306 -25.188 -3.518 1.000 71.704 0 266 ALA BBB O 1 ? 4 ATOM 4180 C CB . ALA B 1 260 ? -5.080 -22.746 -2.846 1.000 71.465 0 266 ALA BBB CB 1 ? 4 ATOM 4181 N N . ARG B 1 261 ? -5.297 -25.825 -2.640 1.000 74.074 0 267 ARG BBB N 1 ? 4 ATOM 4182 C CA . ARG B 1 261 ? -5.317 -27.235 -3.120 1.000 75.488 0 267 ARG BBB CA 1 ? 4 ATOM 4183 C C . ARG B 1 261 ? -6.675 -27.866 -2.782 1.000 75.784 0 267 ARG BBB C 1 ? 4 ATOM 4184 O O . ARG B 1 261 ? -7.237 -28.551 -3.652 1.000 77.517 0 267 ARG BBB O 1 ? 4 ATOM 4185 C CB . ARG B 1 261 ? -4.164 -28.035 -2.503 1.000 80.668 0 267 ARG BBB CB 1 ? 4 ATOM 4186 C CG . ARG B 1 261 ? -4.181 -29.521 -2.837 1.000 85.921 0 267 ARG BBB CG 1 ? 4 ATOM 4187 C CD . ARG B 1 261 ? -2.876 -30.241 -2.532 1.000 91.624 0 267 ARG BBB CD 1 ? 4 ATOM 4188 N NE . ARG B 1 261 ? -3.064 -31.378 -1.635 1.000 100.401 0 267 ARG BBB NE 1 ? 4 ATOM 4189 C CZ . ARG B 1 261 ? -3.576 -32.565 -1.971 1.000 105.617 0 267 ARG BBB CZ 1 ? 4 ATOM 4190 N NH1 . ARG B 1 261 ? -3.697 -33.507 -1.049 1.000 111.695 0 267 ARG BBB NH1 1 ? 4 ATOM 4191 N NH2 . ARG B 1 261 ? -3.977 -32.809 -3.209 1.000 99.638 0 267 ARG BBB NH2 1 ? 4 ATOM 4192 N N . ASP B 1 262 ? -7.184 -27.635 -1.567 1.000 77.713 0 268 ASP BBB N 1 ? 4 ATOM 4193 C CA . ASP B 1 262 ? -8.473 -28.194 -1.071 1.000 76.464 0 268 ASP BBB CA 1 ? 4 ATOM 4194 C C . ASP B 1 262 ? -9.615 -27.716 -1.974 1.000 74.697 0 268 ASP BBB C 1 ? 4 ATOM 4195 O O . ASP B 1 262 ? -10.359 -28.574 -2.481 1.000 78.462 0 268 ASP BBB O 1 ? 4 ATOM 4196 C CB . ASP B 1 262 ? -8.729 -27.800 0.387 1.000 74.904 0 268 ASP BBB CB 1 ? 4 ATOM 4197 C CG . ASP B 1 262 ? -9.911 -28.507 1.027 1.000 75.319 0 268 ASP BBB CG 1 ? 4 ATOM 4198 O OD1 . ASP B 1 262 ? -11.067 -28.066 0.816 1.000 72.408 0 268 ASP BBB OD1 1 ? 4 ATOM 4199 O OD2 . ASP B 1 262 ? -9.665 -29.481 1.748 1.000 77.537 0 268 ASP BBB OD2 1 ? 4 ATOM 4200 N N . LEU B 1 263 ? -9.738 -26.398 -2.162 1.000 69.909 0 269 LEU BBB N 1 ? 4 ATOM 4201 C CA . LEU B 1 263 ? -10.848 -25.762 -2.922 1.000 70.317 0 269 LEU BBB CA 1 ? 4 ATOM 4202 C C . LEU B 1 263 ? -10.870 -26.315 -4.357 1.000 71.152 0 269 LEU BBB C 1 ? 4 ATOM 4203 O O . LEU B 1 263 ? -11.960 -26.684 -4.842 1.000 72.016 0 269 LEU BBB O 1 ? 4 ATOM 4204 C CB . LEU B 1 263 ? -10.657 -24.239 -2.893 1.000 67.709 0 269 LEU BBB CB 1 ? 4 ATOM 4205 C CG . LEU B 1 263 ? -11.668 -23.408 -3.689 1.000 64.708 0 269 LEU BBB CG 1 ? 4 ATOM 4206 C CD1 . LEU B 1 263 ? -13.099 -23.710 -3.267 1.000 63.889 0 269 LEU BBB CD1 1 ? 4 ATOM 4207 C CD2 . LEU B 1 263 ? -11.381 -21.922 -3.529 1.000 63.729 0 269 LEU BBB CD2 1 ? 4 ATOM 4208 N N . ILE B 1 264 ? -9.704 -26.390 -5.002 1.000 70.513 0 270 ILE BBB N 1 ? 4 ATOM 4209 C CA . ILE B 1 264 ? -9.545 -26.837 -6.420 1.000 68.031 0 270 ILE BBB CA 1 ? 4 ATOM 4210 C C . ILE B 1 264 ? -9.889 -28.328 -6.514 1.000 70.821 0 270 ILE BBB C 1 ? 4 ATOM 4211 O O . ILE B 1 264 ? -10.483 -28.727 -7.528 1.000 67.392 0 270 ILE BBB O 1 ? 4 ATOM 4212 C CB . ILE B 1 264 ? -8.125 -26.516 -6.922 1.000 64.198 0 270 ILE BBB CB 1 ? 4 ATOM 4213 C CG1 . ILE B 1 264 ? -7.912 -25.005 -7.024 1.000 63.684 0 270 ILE BBB CG1 1 ? 4 ATOM 4214 C CG2 . ILE B 1 264 ? -7.834 -27.202 -8.239 1.000 64.261 0 270 ILE BBB CG2 1 ? 4 ATOM 4215 C CD1 . ILE B 1 264 ? -6.482 -24.572 -6.816 1.000 67.285 0 270 ILE BBB CD1 1 ? 4 ATOM 4216 N N . SER B 1 265 ? -9.553 -29.109 -5.482 1.000 75.349 0 271 SER BBB N 1 ? 4 ATOM 4217 C CA . SER B 1 265 ? -9.865 -30.560 -5.387 1.000 81.388 0 271 SER BBB CA 1 ? 4 ATOM 4218 C C . SER B 1 265 ? -11.384 -30.772 -5.345 1.000 85.590 0 271 SER BBB C 1 ? 4 ATOM 4219 O O . SER B 1 265 ? -11.857 -31.788 -5.903 1.000 93.123 0 271 SER BBB O 1 ? 4 ATOM 4220 C CB . SER B 1 265 ? -9.192 -31.195 -4.198 1.000 80.046 0 271 SER BBB CB 1 ? 4 ATOM 4221 O OG . SER B 1 265 ? -7.785 -31.203 -4.369 1.000 77.952 0 271 SER BBB OG 1 ? 4 ATOM 4222 N N . ARG B 1 266 ? -12.114 -29.842 -4.724 1.000 82.429 0 272 ARG BBB N 1 ? 4 ATOM 4223 C CA . ARG B 1 266 ? -13.576 -29.956 -4.481 1.000 83.181 0 272 ARG BBB CA 1 ? 4 ATOM 4224 C C . ARG B 1 266 ? -14.370 -29.407 -5.672 1.000 77.070 0 272 ARG BBB C 1 ? 4 ATOM 4225 O O . ARG B 1 266 ? -15.563 -29.766 -5.778 1.000 74.810 0 272 ARG BBB O 1 ? 4 ATOM 4226 C CB . ARG B 1 266 ? -13.948 -29.204 -3.200 1.000 85.100 0 272 ARG BBB CB 1 ? 4 ATOM 4227 C CG . ARG B 1 266 ? -13.253 -29.714 -1.948 1.000 85.101 0 272 ARG BBB CG 1 ? 4 ATOM 4228 C CD . ARG B 1 266 ? -14.099 -29.342 -0.747 1.000 90.164 0 272 ARG BBB CD 1 ? 4 ATOM 4229 N NE . ARG B 1 266 ? -13.327 -29.424 0.478 1.000 94.797 0 272 ARG BBB NE 1 ? 4 ATOM 4230 C CZ . ARG B 1 266 ? -13.061 -30.547 1.133 1.000 97.440 0 272 ARG BBB CZ 1 ? 4 ATOM 4231 N NH1 . ARG B 1 266 ? -13.509 -31.711 0.689 1.000 98.585 0 272 ARG BBB NH1 1 ? 4 ATOM 4232 N NH2 . ARG B 1 266 ? -12.343 -30.501 2.241 1.000 100.201 0 272 ARG BBB NH2 1 ? 4 ATOM 4233 N N . LEU B 1 267 ? -13.742 -28.561 -6.502 1.000 73.639 0 273 LEU BBB N 1 ? 4 ATOM 4234 C CA . LEU B 1 267 ? -14.344 -27.950 -7.721 1.000 68.684 0 273 LEU BBB CA 1 ? 4 ATOM 4235 C C . LEU B 1 267 ? -14.065 -28.844 -8.938 1.000 69.203 0 273 LEU BBB C 1 ? 4 ATOM 4236 O O . LEU B 1 267 ? -15.034 -29.181 -9.630 1.000 69.907 0 273 LEU BBB O 1 ? 4 ATOM 4237 C CB . LEU B 1 267 ? -13.778 -26.539 -7.925 1.000 64.612 0 273 LEU BBB CB 1 ? 4 ATOM 4238 C CG . LEU B 1 267 ? -14.279 -25.467 -6.955 1.000 61.559 0 273 LEU BBB CG 1 ? 4 ATOM 4239 C CD1 . LEU B 1 267 ? -13.446 -24.199 -7.068 1.000 58.922 0 273 LEU BBB CD1 1 ? 4 ATOM 4240 C CD2 . LEU B 1 267 ? -15.743 -25.138 -7.193 1.000 61.306 0 273 LEU BBB CD2 1 ? 4 ATOM 4241 N N . LEU B 1 268 ? -12.795 -29.202 -9.184 1.000 71.872 0 274 LEU BBB N 1 ? 4 ATOM 4242 C CA . LEU B 1 268 ? -12.340 -30.080 -10.309 1.000 70.213 0 274 LEU BBB CA 1 ? 4 ATOM 4243 C C . LEU B 1 268 ? -12.657 -31.547 -9.989 1.000 72.987 0 274 LEU BBB C 1 ? 4 ATOM 4244 O O . LEU B 1 268 ? -11.724 -32.305 -9.647 1.000 75.332 0 274 LEU BBB O 1 ? 4 ATOM 4245 C CB . LEU B 1 268 ? -10.832 -29.914 -10.535 1.000 68.554 0 274 LEU BBB CB 1 ? 4 ATOM 4246 C CG . LEU B 1 268 ? -10.406 -28.847 -11.536 1.000 67.758 0 274 LEU BBB CG 1 ? 4 ATOM 4247 C CD1 . LEU B 1 268 ? -11.159 -27.551 -11.314 1.000 66.971 0 274 LEU BBB CD1 1 ? 4 ATOM 4248 C CD2 . LEU B 1 268 ? -8.905 -28.625 -11.456 1.000 68.853 0 274 LEU BBB CD2 1 ? 4 ATOM 4249 N N . ARG B 1 269 ? -13.923 -31.931 -10.107 1.000 73.182 0 275 ARG BBB N 1 ? 4 ATOM 4250 C CA . ARG B 1 269 ? -14.371 -33.331 -9.932 1.000 78.407 0 275 ARG BBB CA 1 ? 4 ATOM 4251 C C . ARG B 1 269 ? -15.125 -33.740 -11.197 1.000 80.267 0 275 ARG BBB C 1 ? 4 ATOM 4252 O O . ARG B 1 269 ? -15.858 -32.891 -11.747 1.000 78.180 0 275 ARG BBB O 1 ? 4 ATOM 4253 C CB . ARG B 1 269 ? -15.209 -33.459 -8.656 1.000 82.410 0 275 ARG BBB CB 1 ? 4 ATOM 4254 C CG . ARG B 1 269 ? -14.446 -33.132 -7.378 1.000 84.766 0 275 ARG BBB CG 1 ? 4 ATOM 4255 C CD . ARG B 1 269 ? -14.627 -34.201 -6.315 1.000 89.938 0 275 ARG BBB CD 1 ? 4 ATOM 4256 N NE . ARG B 1 269 ? -13.923 -35.430 -6.665 1.000 92.856 0 275 ARG BBB NE 1 ? 4 ATOM 4257 C CZ . ARG B 1 269 ? -14.236 -36.657 -6.242 1.000 96.668 0 275 ARG BBB CZ 1 ? 4 ATOM 4258 N NH1 . ARG B 1 269 ? -13.509 -37.687 -6.642 1.000 97.307 0 275 ARG BBB NH1 1 ? 4 ATOM 4259 N NH2 . ARG B 1 269 ? -15.273 -36.863 -5.447 1.000 99.947 0 275 ARG BBB NH2 1 ? 4 ATOM 4260 N N . TYR B 1 270 ? -14.912 -34.977 -11.656 1.000 84.558 0 276 TYR BBB N 1 ? 4 ATOM 4261 C CA . TYR B 1 270 ? -15.543 -35.539 -12.878 1.000 88.515 0 276 TYR BBB CA 1 ? 4 ATOM 4262 C C . TYR B 1 270 ? -17.061 -35.336 -12.805 1.000 89.096 0 276 TYR BBB C 1 ? 4 ATOM 4263 O O . TYR B 1 270 ? -17.643 -34.738 -13.732 1.000 85.488 0 276 TYR BBB O 1 ? 4 ATOM 4264 C CB . TYR B 1 270 ? -15.192 -37.019 -13.047 1.000 91.796 0 276 TYR BBB CB 1 ? 4 ATOM 4265 C CG . TYR B 1 270 ? -15.663 -37.596 -14.356 1.000 93.007 0 276 TYR BBB CG 1 ? 4 ATOM 4266 C CD1 . TYR B 1 270 ? -16.975 -38.006 -14.520 1.000 96.989 0 276 TYR BBB CD1 1 ? 4 ATOM 4267 C CD2 . TYR B 1 270 ? -14.813 -37.688 -15.445 1.000 94.232 0 276 TYR BBB CD2 1 ? 4 ATOM 4268 C CE1 . TYR B 1 270 ? -17.428 -38.518 -15.724 1.000 99.155 0 276 TYR BBB CE1 1 ? 4 ATOM 4269 C CE2 . TYR B 1 270 ? -15.250 -38.195 -16.658 1.000 98.866 0 276 TYR BBB CE2 1 ? 4 ATOM 4270 C CZ . TYR B 1 270 ? -16.563 -38.613 -16.798 1.000 99.977 0 276 TYR BBB CZ 1 ? 4 ATOM 4271 O OH . TYR B 1 270 ? -17.016 -39.117 -17.982 1.000 101.566 0 276 TYR BBB OH 1 ? 4 ATOM 4272 N N . GLN B 1 271 ? -17.675 -35.820 -11.723 1.000 94.087 0 277 GLN BBB N 1 ? 4 ATOM 4273 C CA . GLN B 1 271 ? -19.142 -35.750 -11.495 1.000 97.098 0 277 GLN BBB CA 1 ? 4 ATOM 4274 C C . GLN B 1 271 ? -19.536 -34.289 -11.273 1.000 90.727 0 277 GLN BBB C 1 ? 4 ATOM 4275 O O . GLN B 1 271 ? -19.058 -33.656 -10.333 1.000 87.058 0 277 GLN BBB O 1 ? 4 ATOM 4276 C CB . GLN B 1 271 ? -19.543 -36.650 -10.321 1.000 102.684 0 277 GLN BBB CB 1 ? 4 ATOM 4277 C CG . GLN B 1 271 ? -20.950 -37.227 -10.443 1.000 108.965 0 277 GLN BBB CG 1 ? 4 ATOM 4278 C CD . GLN B 1 271 ? -21.246 -37.785 -11.815 1.000 113.605 0 277 GLN BBB CD 1 ? 4 ATOM 4279 O OE1 . GLN B 1 271 ? -22.164 -37.332 -12.497 1.000 113.754 0 277 GLN BBB OE1 1 ? 4 ATOM 4280 N NE2 . GLN B 1 271 ? -20.446 -38.747 -12.250 1.000 113.485 0 277 GLN BBB NE2 1 ? 4 ATOM 4281 N N . PRO B 1 272 ? -20.399 -33.703 -12.139 1.000 87.142 0 278 PRO BBB N 1 ? 4 ATOM 4282 C CA . PRO B 1 272 ? -20.892 -32.340 -11.935 1.000 84.304 0 278 PRO BBB CA 1 ? 4 ATOM 4283 C C . PRO B 1 272 ? -21.670 -32.149 -10.623 1.000 85.525 0 278 PRO BBB C 1 ? 4 ATOM 4284 O O . PRO B 1 272 ? -21.513 -31.118 -10.005 1.000 84.385 0 278 PRO BBB O 1 ? 4 ATOM 4285 C CB . PRO B 1 272 ? -21.834 -32.094 -13.125 1.000 84.670 0 278 PRO BBB CB 1 ? 4 ATOM 4286 C CG . PRO B 1 272 ? -21.400 -33.098 -14.166 1.000 85.601 0 278 PRO BBB CG 1 ? 4 ATOM 4287 C CD . PRO B 1 272 ? -20.922 -34.298 -13.378 1.000 87.539 0 278 PRO BBB CD 1 ? 4 ATOM 4288 N N . LEU B 1 273 ? -22.454 -33.156 -10.221 1.000 89.704 0 279 LEU BBB N 1 ? 4 ATOM 4289 C CA . LEU B 1 273 ? -23.448 -33.069 -9.117 1.000 91.083 0 279 LEU BBB CA 1 ? 4 ATOM 4290 C C . LEU B 1 273 ? -22.747 -33.063 -7.752 1.000 90.419 0 279 LEU BBB C 1 ? 4 ATOM 4291 O O . LEU B 1 273 ? -23.449 -32.830 -6.753 1.000 92.160 0 279 LEU BBB O 1 ? 4 ATOM 4292 C CB . LEU B 1 273 ? -24.436 -34.238 -9.219 1.000 96.273 0 279 LEU BBB CB 1 ? 4 ATOM 4293 C CG . LEU B 1 273 ? -25.390 -34.215 -10.419 1.000 100.197 0 279 LEU BBB CG 1 ? 4 ATOM 4294 C CD1 . LEU B 1 273 ? -24.815 -34.980 -11.610 1.000 101.667 0 279 LEU BBB CD1 1 ? 4 ATOM 4295 C CD2 . LEU B 1 273 ? -26.759 -34.784 -10.052 1.000 102.583 0 279 LEU BBB CD2 1 ? 4 ATOM 4296 N N . GLU B 1 274 ? -21.431 -33.308 -7.694 1.000 88.399 0 280 GLU BBB N 1 ? 4 ATOM 4297 C CA . GLU B 1 274 ? -20.649 -33.292 -6.426 1.000 89.456 0 280 GLU BBB CA 1 ? 4 ATOM 4298 C C . GLU B 1 274 ? -19.532 -32.243 -6.516 1.000 88.062 0 280 GLU BBB C 1 ? 4 ATOM 4299 O O . GLU B 1 274 ? -18.456 -32.476 -5.936 1.000 87.712 0 280 GLU BBB O 1 ? 4 ATOM 4300 C CB . GLU B 1 274 ? -20.137 -34.699 -6.091 1.000 91.109 0 280 GLU BBB CB 1 ? 4 ATOM 4301 C CG . GLU B 1 274 ? -19.049 -35.228 -7.012 1.000 89.438 0 280 GLU BBB CG 1 ? 4 ATOM 4302 C CD . GLU B 1 274 ? -18.748 -36.715 -6.878 1.000 92.508 0 280 GLU BBB CD 1 ? 4 ATOM 4303 O OE1 . GLU B 1 274 ? -19.693 -37.497 -6.641 1.000 94.268 0 280 GLU BBB OE1 1 ? 4 ATOM 4304 O OE2 . GLU B 1 274 ? -17.557 -37.090 -6.998 1.000 90.676 0 280 GLU BBB OE2 1 ? 4 ATOM 4305 N N . ARG B 1 275 ? -19.797 -31.108 -7.171 1.000 88.207 0 281 ARG BBB N 1 ? 4 ATOM 4306 C CA . ARG B 1 275 ? -18.843 -29.970 -7.300 1.000 85.716 0 281 ARG BBB CA 1 ? 4 ATOM 4307 C C . ARG B 1 275 ? -19.234 -28.866 -6.313 1.000 84.483 0 281 ARG BBB C 1 ? 4 ATOM 4308 O O . ARG B 1 275 ? -20.410 -28.462 -6.327 1.000 88.209 0 281 ARG BBB O 1 ? 4 ATOM 4309 C CB . ARG B 1 275 ? -18.848 -29.415 -8.727 1.000 85.070 0 281 ARG BBB CB 1 ? 4 ATOM 4310 C CG . ARG B 1 275 ? -18.157 -30.307 -9.745 1.000 86.173 0 281 ARG BBB CG 1 ? 4 ATOM 4311 C CD . ARG B 1 275 ? -17.747 -29.530 -10.984 1.000 85.590 0 281 ARG BBB CD 1 ? 4 ATOM 4312 N NE . ARG B 1 275 ? -17.143 -30.427 -11.961 1.000 85.011 0 281 ARG BBB NE 1 ? 4 ATOM 4313 C CZ . ARG B 1 275 ? -17.611 -30.672 -13.183 1.000 85.975 0 281 ARG BBB CZ 1 ? 4 ATOM 4314 N NH1 . ARG B 1 275 ? -16.971 -31.532 -13.959 1.000 86.493 0 281 ARG BBB NH1 1 ? 4 ATOM 4315 N NH2 . ARG B 1 275 ? -18.694 -30.058 -13.637 1.000 86.233 0 281 ARG BBB NH2 1 ? 4 ATOM 4316 N N . LEU B 1 276 ? -18.279 -28.385 -5.514 1.000 81.295 0 282 LEU BBB N 1 ? 4 ATOM 4317 C CA . LEU B 1 276 ? -18.528 -27.411 -4.416 1.000 80.743 0 282 LEU BBB CA 1 ? 4 ATOM 4318 C C . LEU B 1 276 ? -19.395 -26.275 -4.956 1.000 77.211 0 282 LEU BBB C 1 ? 4 ATOM 4319 O O . LEU B 1 276 ? -18.941 -25.512 -5.800 1.000 75.486 0 282 LEU BBB O 1 ? 4 ATOM 4320 C CB . LEU B 1 276 ? -17.189 -26.903 -3.868 1.000 80.904 0 282 LEU BBB CB 1 ? 4 ATOM 4321 C CG . LEU B 1 276 ? -17.243 -26.249 -2.486 1.000 81.793 0 282 LEU BBB CG 1 ? 4 ATOM 4322 C CD1 . LEU B 1 276 ? -17.516 -27.273 -1.393 1.000 82.504 0 282 LEU BBB CD1 1 ? 4 ATOM 4323 C CD2 . LEU B 1 276 ? -15.954 -25.503 -2.191 1.000 80.999 0 282 LEU BBB CD2 1 ? 4 ATOM 4324 N N . PRO B 1 277 ? -20.681 -26.171 -4.535 1.000 77.077 0 283 PRO BBB N 1 ? 4 ATOM 4325 C CA . PRO B 1 277 ? -21.574 -25.097 -4.982 1.000 74.329 0 283 PRO BBB CA 1 ? 4 ATOM 4326 C C . PRO B 1 277 ? -21.086 -23.678 -4.655 1.000 70.430 0 283 PRO BBB C 1 ? 4 ATOM 4327 O O . PRO B 1 277 ? -20.251 -23.534 -3.773 1.000 65.443 0 283 PRO BBB O 1 ? 4 ATOM 4328 C CB . PRO B 1 277 ? -22.875 -25.335 -4.199 1.000 78.788 0 283 PRO BBB CB 1 ? 4 ATOM 4329 C CG . PRO B 1 277 ? -22.832 -26.803 -3.822 1.000 81.096 0 283 PRO BBB CG 1 ? 4 ATOM 4330 C CD . PRO B 1 277 ? -21.362 -27.115 -3.633 1.000 79.635 0 283 PRO BBB CD 1 ? 4 ATOM 4331 N N . LEU B 1 278 ? -21.640 -22.683 -5.358 1.000 70.189 0 284 LEU BBB N 1 ? 4 ATOM 4332 C CA . LEU B 1 278 ? -21.262 -21.246 -5.249 1.000 69.922 0 284 LEU BBB CA 1 ? 4 ATOM 4333 C C . LEU B 1 278 ? -21.362 -20.807 -3.787 1.000 71.368 0 284 LEU BBB C 1 ? 4 ATOM 4334 O O . LEU B 1 278 ? -20.372 -20.251 -3.262 1.000 72.293 0 284 LEU BBB O 1 ? 4 ATOM 4335 C CB . LEU B 1 278 ? -22.191 -20.384 -6.110 1.000 70.895 0 284 LEU BBB CB 1 ? 4 ATOM 4336 C CG . LEU B 1 278 ? -22.077 -20.540 -7.625 1.000 70.701 0 284 LEU BBB CG 1 ? 4 ATOM 4337 C CD1 . LEU B 1 278 ? -23.148 -19.711 -8.317 1.000 71.332 0 284 LEU BBB CD1 1 ? 4 ATOM 4338 C CD2 . LEU B 1 278 ? -20.697 -20.139 -8.120 1.000 69.418 0 284 LEU BBB CD2 1 ? 4 ATOM 4339 N N . ALA B 1 279 ? -22.519 -21.046 -3.160 1.000 72.589 0 285 ALA BBB N 1 ? 4 ATOM 4340 C CA . ALA B 1 279 ? -22.813 -20.669 -1.757 1.000 72.023 0 285 ALA BBB CA 1 ? 4 ATOM 4341 C C . ALA B 1 279 ? -21.649 -21.078 -0.841 1.000 72.404 0 285 ALA BBB C 1 ? 4 ATOM 4342 O O . ALA B 1 279 ? -21.350 -20.305 0.086 1.000 72.271 0 285 ALA BBB O 1 ? 4 ATOM 4343 C CB . ALA B 1 279 ? -24.113 -21.294 -1.325 1.000 73.607 0 285 ALA BBB CB 1 ? 4 ATOM 4344 N N . GLN B 1 280 ? -21.003 -22.223 -1.114 1.000 75.605 0 286 GLN BBB N 1 ? 4 ATOM 4345 C CA . GLN B 1 280 ? -19.922 -22.827 -0.279 1.000 79.155 0 286 GLN BBB CA 1 ? 4 ATOM 4346 C C . GLN B 1 280 ? -18.519 -22.412 -0.756 1.000 76.665 0 286 GLN BBB C 1 ? 4 ATOM 4347 O O . GLN B 1 280 ? -17.570 -22.605 0.027 1.000 76.817 0 286 GLN BBB O 1 ? 4 ATOM 4348 C CB . GLN B 1 280 ? -20.004 -24.356 -0.283 1.000 84.109 0 286 GLN BBB CB 1 ? 4 ATOM 4349 C CG . GLN B 1 280 ? -21.079 -24.925 0.629 1.000 92.100 0 286 GLN BBB CG 1 ? 4 ATOM 4350 C CD . GLN B 1 280 ? -21.235 -26.411 0.417 1.000 99.406 0 286 GLN BBB CD 1 ? 4 ATOM 4351 O OE1 . GLN B 1 280 ? -20.437 -27.217 0.897 1.000 110.231 0 286 GLN BBB OE1 1 ? 4 ATOM 4352 N NE2 . GLN B 1 280 ? -22.273 -26.790 -0.311 1.000 97.455 0 286 GLN BBB NE2 1 ? 4 ATOM 4353 N N . ILE B 1 281 ? -18.357 -21.905 -1.984 1.000 74.606 0 287 ILE BBB N 1 ? 4 ATOM 4354 C CA . ILE B 1 281 ? -17.059 -21.308 -2.430 1.000 70.931 0 287 ILE BBB CA 1 ? 4 ATOM 4355 C C . ILE B 1 281 ? -16.833 -20.044 -1.599 1.000 69.889 0 287 ILE BBB C 1 ? 4 ATOM 4356 O O . ILE B 1 281 ? -15.698 -19.845 -1.127 1.000 69.279 0 287 ILE BBB O 1 ? 4 ATOM 4357 C CB . ILE B 1 281 ? -17.022 -21.000 -3.938 1.000 67.325 0 287 ILE BBB CB 1 ? 4 ATOM 4358 C CG1 . ILE B 1 281 ? -17.185 -22.256 -4.797 1.000 68.466 0 287 ILE BBB CG1 1 ? 4 ATOM 4359 C CG2 . ILE B 1 281 ? -15.740 -20.258 -4.282 1.000 65.789 0 287 ILE BBB CG2 1 ? 4 ATOM 4360 C CD1 . ILE B 1 281 ? -17.535 -21.966 -6.240 1.000 67.430 0 287 ILE BBB CD1 1 ? 4 ATOM 4361 N N . LEU B 1 282 ? -17.889 -19.239 -1.439 1.000 69.326 0 288 LEU BBB N 1 ? 4 ATOM 4362 C CA . LEU B 1 282 ? -17.917 -18.022 -0.582 1.000 69.526 0 288 LEU BBB CA 1 ? 4 ATOM 4363 C C . LEU B 1 282 ? -17.504 -18.407 0.848 1.000 75.034 0 288 LEU BBB C 1 ? 4 ATOM 4364 O O . LEU B 1 282 ? -16.653 -17.702 1.435 1.000 74.414 0 288 LEU BBB O 1 ? 4 ATOM 4365 C CB . LEU B 1 282 ? -19.331 -17.427 -0.603 1.000 68.521 0 288 LEU BBB CB 1 ? 4 ATOM 4366 C CG . LEU B 1 282 ? -19.843 -16.956 -1.964 1.000 67.202 0 288 LEU BBB CG 1 ? 4 ATOM 4367 C CD1 . LEU B 1 282 ? -21.333 -16.651 -1.910 1.000 67.276 0 288 LEU BBB CD1 1 ? 4 ATOM 4368 C CD2 . LEU B 1 282 ? -19.060 -15.742 -2.445 1.000 64.872 0 288 LEU BBB CD2 1 ? 4 ATOM 4369 N N . LYS B 1 283 ? -18.068 -19.506 1.367 1.000 76.201 0 289 LYS BBB N 1 ? 4 ATOM 4370 C CA . LYS B 1 283 ? -17.943 -19.944 2.784 1.000 75.875 0 289 LYS BBB CA 1 ? 4 ATOM 4371 C C . LYS B 1 283 ? -16.661 -20.754 2.989 1.000 73.835 0 289 LYS BBB C 1 ? 4 ATOM 4372 O O . LYS B 1 283 ? -16.370 -21.097 4.150 1.000 74.556 0 289 LYS BBB O 1 ? 4 ATOM 4373 C CB . LYS B 1 283 ? -19.161 -20.779 3.191 1.000 79.933 0 289 LYS BBB CB 1 ? 4 ATOM 4374 C CG . LYS B 1 283 ? -20.462 -19.997 3.320 1.000 81.995 0 289 LYS BBB CG 1 ? 4 ATOM 4375 C CD . LYS B 1 283 ? -21.663 -20.866 3.629 1.000 85.482 0 289 LYS BBB CD 1 ? 4 ATOM 4376 C CE . LYS B 1 283 ? -22.898 -20.054 3.954 1.000 87.658 0 289 LYS BBB CE 1 ? 4 ATOM 4377 N NZ . LYS B 1 283 ? -23.892 -20.842 4.720 1.000 90.431 0 289 LYS BBB NZ 1 ? 4 ATOM 4378 N N . HIS B 1 284 ? -15.917 -21.059 1.924 1.000 72.334 0 290 HIS BBB N 1 ? 4 ATOM 4379 C CA . HIS B 1 284 ? -14.737 -21.956 2.019 1.000 70.643 0 290 HIS BBB CA 1 ? 4 ATOM 4380 C C . HIS B 1 284 ? -13.669 -21.296 2.883 1.000 68.483 0 290 HIS BBB C 1 ? 4 ATOM 4381 O O . HIS B 1 284 ? -13.319 -20.140 2.652 1.000 66.089 0 290 HIS BBB O 1 ? 4 ATOM 4382 C CB . HIS B 1 284 ? -14.161 -22.332 0.654 1.000 69.160 0 290 HIS BBB CB 1 ? 4 ATOM 4383 C CG . HIS B 1 284 ? -13.088 -23.362 0.808 1.000 68.454 0 290 HIS BBB CG 1 ? 4 ATOM 4384 N ND1 . HIS B 1 284 ? -11.763 -23.023 1.006 1.000 66.241 0 290 HIS BBB ND1 1 ? 4 ATOM 4385 C CD2 . HIS B 1 284 ? -13.148 -24.716 0.883 1.000 68.487 0 290 HIS BBB CD2 1 ? 4 ATOM 4386 C CE1 . HIS B 1 284 ? -11.045 -24.126 1.144 1.000 67.290 0 290 HIS BBB CE1 1 ? 4 ATOM 4387 N NE2 . HIS B 1 284 ? -11.871 -25.180 1.072 1.000 68.243 0 290 HIS BBB NE2 1 ? 4 ATOM 4388 N N . PRO B 1 285 ? -13.106 -22.027 3.875 1.000 68.627 0 291 PRO BBB N 1 ? 4 ATOM 4389 C CA . PRO B 1 285 ? -12.142 -21.462 4.819 1.000 66.352 0 291 PRO BBB CA 1 ? 4 ATOM 4390 C C . PRO B 1 285 ? -11.048 -20.608 4.159 1.000 64.469 0 291 PRO BBB C 1 ? 4 ATOM 4391 O O . PRO B 1 285 ? -10.847 -19.500 4.613 1.000 64.009 0 291 PRO BBB O 1 ? 4 ATOM 4392 C CB . PRO B 1 285 ? -11.521 -22.693 5.503 1.000 68.848 0 291 PRO BBB CB 1 ? 4 ATOM 4393 C CG . PRO B 1 285 ? -11.978 -23.888 4.683 1.000 70.384 0 291 PRO BBB CG 1 ? 4 ATOM 4394 C CD . PRO B 1 285 ? -13.313 -23.464 4.112 1.000 71.239 0 291 PRO BBB CD 1 ? 4 ATOM 4395 N N . TRP B 1 286 ? -10.392 -21.128 3.110 1.000 65.289 0 292 TRP BBB N 1 ? 4 ATOM 4396 C CA . TRP B 1 286 ? -9.225 -20.499 2.425 1.000 63.765 0 292 TRP BBB CA 1 ? 4 ATOM 4397 C C . TRP B 1 286 ? -9.591 -19.121 1.863 1.000 61.947 0 292 TRP BBB C 1 ? 4 ATOM 4398 O O . TRP B 1 286 ? -8.778 -18.184 2.023 1.000 60.821 0 292 TRP BBB O 1 ? 4 ATOM 4399 C CB . TRP B 1 286 ? -8.663 -21.395 1.316 1.000 63.681 0 292 TRP BBB CB 1 ? 4 ATOM 4400 C CG . TRP B 1 286 ? -7.489 -20.756 0.645 1.000 62.397 0 292 TRP BBB CG 1 ? 4 ATOM 4401 C CD1 . TRP B 1 286 ? -6.241 -20.594 1.169 1.000 63.412 0 292 TRP BBB CD1 1 ? 4 ATOM 4402 C CD2 . TRP B 1 286 ? -7.470 -20.119 -0.643 1.000 61.426 0 292 TRP BBB CD2 1 ? 4 ATOM 4403 N NE1 . TRP B 1 286 ? -5.439 -19.924 0.290 1.000 63.098 0 292 TRP BBB NE1 1 ? 4 ATOM 4404 C CE2 . TRP B 1 286 ? -6.164 -19.621 -0.833 1.000 61.611 0 292 TRP BBB CE2 1 ? 4 ATOM 4405 C CE3 . TRP B 1 286 ? -8.419 -19.929 -1.654 1.000 60.599 0 292 TRP BBB CE3 1 ? 4 ATOM 4406 C CZ2 . TRP B 1 286 ? -5.791 -18.938 -1.989 1.000 59.472 0 292 TRP BBB CZ2 1 ? 4 ATOM 4407 C CZ3 . TRP B 1 286 ? -8.049 -19.259 -2.799 1.000 58.679 0 292 TRP BBB CZ3 1 ? 4 ATOM 4408 C CH2 . TRP B 1 286 ? -6.752 -18.768 -2.958 1.000 58.767 0 292 TRP BBB CH2 1 ? 4 ATOM 4409 N N . VAL B 1 287 ? -10.744 -19.019 1.196 1.000 63.606 0 293 VAL BBB N 1 ? 4 ATOM 4410 C CA . VAL B 1 287 ? -11.294 -17.743 0.649 1.000 64.690 0 293 VAL BBB CA 1 ? 4 ATOM 4411 C C . VAL B 1 287 ? -11.416 -16.754 1.808 1.000 67.725 0 293 VAL BBB C 1 ? 4 ATOM 4412 O O . VAL B 1 287 ? -10.777 -15.687 1.762 1.000 68.185 0 293 VAL BBB O 1 ? 4 ATOM 4413 C CB . VAL B 1 287 ? -12.656 -17.965 -0.037 1.000 66.950 0 293 VAL BBB CB 1 ? 4 ATOM 4414 C CG1 . VAL B 1 287 ? -13.391 -16.652 -0.262 1.000 67.952 0 293 VAL BBB CG1 1 ? 4 ATOM 4415 C CG2 . VAL B 1 287 ? -12.515 -18.738 -1.342 1.000 67.369 0 293 VAL BBB CG2 1 ? 4 ATOM 4416 N N . GLN B 1 288 ? -12.198 -17.141 2.817 1.000 71.022 0 294 GLN BBB N 1 ? 4 ATOM 4417 C CA . GLN B 1 288 ? -12.450 -16.370 4.057 1.000 70.767 0 294 GLN BBB CA 1 ? 4 ATOM 4418 C C . GLN B 1 288 ? -11.126 -15.784 4.563 1.000 67.924 0 294 GLN BBB C 1 ? 4 ATOM 4419 O O . GLN B 1 288 ? -11.100 -14.580 4.919 1.000 69.711 0 294 GLN BBB O 1 ? 4 ATOM 4420 C CB . GLN B 1 288 ? -13.138 -17.289 5.070 1.000 75.978 0 294 GLN BBB CB 1 ? 4 ATOM 4421 C CG . GLN B 1 288 ? -14.593 -17.576 4.722 1.000 78.111 0 294 GLN BBB CG 1 ? 4 ATOM 4422 C CD . GLN B 1 288 ? -15.443 -16.332 4.822 1.000 82.013 0 294 GLN BBB CD 1 ? 4 ATOM 4423 O OE1 . GLN B 1 288 ? -15.259 -15.516 5.723 1.000 85.666 0 294 GLN BBB OE1 1 ? 4 ATOM 4424 N NE2 . GLN B 1 288 ? -16.388 -16.175 3.907 1.000 81.449 0 294 GLN BBB NE2 1 ? 4 ATOM 4425 N N . ALA B 1 289 ? -10.063 -16.592 4.565 1.000 64.619 0 295 ALA BBB N 1 ? 4 ATOM 4426 C CA . ALA B 1 289 ? -8.781 -16.289 5.244 1.000 66.499 0 295 ALA BBB CA 1 ? 4 ATOM 4427 C C . ALA B 1 289 ? -7.953 -15.271 4.447 1.000 68.320 0 295 ALA BBB C 1 ? 4 ATOM 4428 O O . ALA B 1 289 ? -7.074 -14.638 5.074 1.000 71.555 0 295 ALA BBB O 1 ? 4 ATOM 4429 C CB . ALA B 1 289 ? -8.007 -17.565 5.474 1.000 66.512 0 295 ALA BBB CB 1 ? 4 ATOM 4430 N N . HIS B 1 290 ? -8.195 -15.124 3.134 1.000 65.914 0 296 HIS BBB N 1 ? 4 ATOM 4431 C CA . HIS B 1 290 ? -7.292 -14.394 2.194 1.000 63.694 0 296 HIS BBB CA 1 ? 4 ATOM 4432 C C . HIS B 1 290 ? -8.015 -13.357 1.312 1.000 61.665 0 296 HIS BBB C 1 ? 4 ATOM 4433 O O . HIS B 1 290 ? -7.318 -12.479 0.735 1.000 61.456 0 296 HIS BBB O 1 ? 4 ATOM 4434 C CB . HIS B 1 290 ? -6.534 -15.394 1.321 1.000 60.609 0 296 HIS BBB CB 1 ? 4 ATOM 4435 C CG . HIS B 1 290 ? -5.599 -16.256 2.098 1.000 61.199 0 296 HIS BBB CG 1 ? 4 ATOM 4436 N ND1 . HIS B 1 290 ? -5.973 -17.485 2.590 1.000 61.313 0 296 HIS BBB ND1 1 ? 4 ATOM 4437 C CD2 . HIS B 1 290 ? -4.313 -16.069 2.465 1.000 62.351 0 296 HIS BBB CD2 1 ? 4 ATOM 4438 C CE1 . HIS B 1 290 ? -4.957 -18.019 3.235 1.000 64.863 0 296 HIS BBB CE1 1 ? 4 ATOM 4439 N NE2 . HIS B 1 290 ? -3.925 -17.171 3.172 1.000 64.286 0 296 HIS BBB NE2 1 ? 4 ATOM 4440 N N . SER B 1 291 ? -9.337 -13.444 1.164 1.000 59.580 0 297 SER BBB N 1 ? 4 ATOM 4441 C CA . SER B 1 291 ? -10.128 -12.474 0.366 1.000 57.443 0 297 SER BBB CA 1 ? 4 ATOM 4442 C C . SER B 1 291 ? -10.068 -11.100 1.044 1.000 56.898 0 297 SER BBB C 1 ? 4 ATOM 4443 O O . SER B 1 291 ? -10.202 -11.052 2.286 1.000 60.521 0 297 SER BBB O 1 ? 4 ATOM 4444 C CB . SER B 1 291 ? -11.548 -12.962 0.171 1.000 59.040 0 297 SER BBB CB 1 ? 4 ATOM 4445 O OG . SER B 1 291 ? -12.312 -12.036 -0.596 1.000 59.761 0 297 SER BBB OG 1 ? 4 ATOM 4446 N N . ARG B 1 292 ? -9.829 -10.039 0.266 1.000 54.107 0 298 ARG BBB N 1 ? 4 ATOM 4447 C CA . ARG B 1 292 ? -9.895 -8.621 0.722 1.000 55.224 0 298 ARG BBB CA 1 ? 4 ATOM 4448 C C . ARG B 1 292 ? -10.908 -7.869 -0.150 1.000 52.295 0 298 ARG BBB C 1 ? 4 ATOM 4449 O O . ARG B 1 292 ? -10.634 -6.703 -0.526 1.000 52.487 0 298 ARG BBB O 1 ? 4 ATOM 4450 C CB . ARG B 1 292 ? -8.525 -7.934 0.645 1.000 56.549 0 298 ARG BBB CB 1 ? 4 ATOM 4451 C CG . ARG B 1 292 ? -7.398 -8.678 1.341 1.000 60.118 0 298 ARG BBB CG 1 ? 4 ATOM 4452 C CD . ARG B 1 292 ? -7.455 -8.531 2.847 1.000 66.733 0 298 ARG BBB CD 1 ? 4 ATOM 4453 N NE . ARG B 1 292 ? -6.418 -9.309 3.520 1.000 73.380 0 298 ARG BBB NE 1 ? 4 ATOM 4454 C CZ . ARG B 1 292 ? -6.555 -10.554 3.990 1.000 73.060 0 298 ARG BBB CZ 1 ? 4 ATOM 4455 N NH1 . ARG B 1 292 ? -7.701 -11.212 3.884 1.000 67.311 0 298 ARG BBB NH1 1 ? 4 ATOM 4456 N NH2 . ARG B 1 292 ? -5.526 -11.139 4.574 1.000 78.436 0 298 ARG BBB NH2 1 ? 4 ATOM 4457 N N A ARG B 1 293 ? -12.034 -8.514 -0.469 0.600 51.089 0 299 ARG BBB N 1 ? 4 ATOM 4458 N N B ARG B 1 293 ? -12.048 -8.507 -0.447 0.400 50.915 0 299 ARG BBB N 1 ? 4 ATOM 4459 C CA A ARG B 1 293 ? -13.098 -7.939 -1.333 0.600 51.254 0 299 ARG BBB CA 1 ? 4 ATOM 4460 C CA B ARG B 1 293 ? -13.130 -7.960 -1.313 0.400 50.282 0 299 ARG BBB CA 1 ? 4 ATOM 4461 C C A ARG B 1 293 ? -13.721 -6.719 -0.647 0.600 54.697 0 299 ARG BBB C 1 ? 4 ATOM 4462 C C B ARG B 1 293 ? -13.752 -6.727 -0.649 0.400 53.728 0 299 ARG BBB C 1 ? 4 ATOM 4463 O O A ARG B 1 293 ? -14.082 -6.810 0.556 0.600 56.574 0 299 ARG BBB O 1 ? 4 ATOM 4464 O O B ARG B 1 293 ? -14.124 -6.809 0.550 0.400 55.443 0 299 ARG BBB O 1 ? 4 ATOM 4465 C CB A ARG B 1 293 ? -14.190 -8.967 -1.630 0.600 51.509 0 299 ARG BBB CB 1 ? 4 ATOM 4466 C CB B ARG B 1 293 ? -14.207 -9.018 -1.572 0.400 49.267 0 299 ARG BBB CB 1 ? 4 ATOM 4467 C CG A ARG B 1 293 ? -15.448 -8.371 -2.245 0.600 51.750 0 299 ARG BBB CG 1 ? 4 ATOM 4468 C CG B ARG B 1 293 ? -15.166 -8.677 -2.705 0.400 47.596 0 299 ARG BBB CG 1 ? 4 ATOM 4469 C CD A ARG B 1 293 ? -16.387 -9.468 -2.701 0.600 53.921 0 299 ARG BBB CD 1 ? 4 ATOM 4470 C CD B ARG B 1 293 ? -16.468 -8.035 -2.259 0.400 48.088 0 299 ARG BBB CD 1 ? 4 ATOM 4471 N NE A ARG B 1 293 ? -17.779 -9.035 -2.673 0.600 56.086 0 299 ARG BBB NE 1 ? 4 ATOM 4472 N NE B ARG B 1 293 ? -17.613 -8.475 -3.054 0.400 47.821 0 299 ARG BBB NE 1 ? 4 ATOM 4473 C CZ A ARG B 1 293 ? -18.799 -9.742 -2.195 0.600 56.789 0 299 ARG BBB CZ 1 ? 4 ATOM 4474 C CZ B ARG B 1 293 ? -17.954 -7.990 -4.245 0.400 45.638 0 299 ARG BBB CZ 1 ? 4 ATOM 4475 N NH1 A ARG B 1 293 ? -18.617 -10.942 -1.667 0.600 56.007 0 299 ARG BBB NH1 1 ? 4 ATOM 4476 N NH1 B ARG B 1 293 ? -17.240 -7.032 -4.812 0.400 43.967 0 299 ARG BBB NH1 1 ? 4 ATOM 4477 N NH2 A ARG B 1 293 ? -20.012 -9.226 -2.237 0.600 59.840 0 299 ARG BBB NH2 1 ? 4 ATOM 4478 N NH2 B ARG B 1 293 ? -19.014 -8.469 -4.867 0.400 46.017 0 299 ARG BBB NH2 1 ? 4 ATOM 4479 N N . VAL B 1 294 ? -13.868 -5.632 -1.404 1.000 54.616 0 300 VAL BBB N 1 ? 4 ATOM 4480 C CA . VAL B 1 294 ? -14.520 -4.377 -0.935 1.000 58.190 0 300 VAL BBB CA 1 ? 4 ATOM 4481 C C . VAL B 1 294 ? -15.230 -3.734 -2.134 1.000 54.650 0 300 VAL BBB C 1 ? 4 ATOM 4482 O O . VAL B 1 294 ? -14.575 -3.514 -3.166 1.000 57.579 0 300 VAL BBB O 1 ? 4 ATOM 4483 C CB . VAL B 1 294 ? -13.506 -3.439 -0.256 1.000 62.737 0 300 VAL BBB CB 1 ? 4 ATOM 4484 C CG1 . VAL B 1 294 ? -12.302 -3.171 -1.145 1.000 65.013 0 300 VAL BBB CG1 1 ? 4 ATOM 4485 C CG2 . VAL B 1 294 ? -14.151 -2.136 0.198 1.000 67.156 0 300 VAL BBB CG2 1 ? 4 ATOM 4486 N N . LEU B 1 295 ? -16.539 -3.497 -1.997 1.000 53.036 0 301 LEU BBB N 1 ? 4 ATOM 4487 C CA . LEU B 1 295 ? -17.391 -2.833 -3.011 1.000 53.291 0 301 LEU BBB CA 1 ? 4 ATOM 4488 C C . LEU B 1 295 ? -16.752 -1.504 -3.396 1.000 53.051 0 301 LEU BBB C 1 ? 4 ATOM 4489 O O . LEU B 1 295 ? -16.240 -0.782 -2.544 1.000 54.879 0 301 LEU BBB O 1 ? 4 ATOM 4490 C CB . LEU B 1 295 ? -18.804 -2.595 -2.462 1.000 54.789 0 301 LEU BBB CB 1 ? 4 ATOM 4491 C CG . LEU B 1 295 ? -19.581 -3.822 -1.984 1.000 56.210 0 301 LEU BBB CG 1 ? 4 ATOM 4492 C CD1 . LEU B 1 295 ? -21.072 -3.525 -1.933 1.000 57.992 0 301 LEU BBB CD1 1 ? 4 ATOM 4493 C CD2 . LEU B 1 295 ? -19.322 -5.036 -2.859 1.000 57.520 0 301 LEU BBB CD2 1 ? 4 ATOM 4494 N N . PRO B 1 296 ? -16.766 -1.146 -4.696 1.000 51.217 0 302 PRO BBB N 1 ? 4 ATOM 4495 C CA . PRO B 1 296 ? -16.322 0.178 -5.120 1.000 51.204 0 302 PRO BBB CA 1 ? 4 ATOM 4496 C C . PRO B 1 296 ? -17.357 1.244 -4.768 1.000 52.153 0 302 PRO BBB C 1 ? 4 ATOM 4497 O O . PRO B 1 296 ? -18.541 0.940 -4.637 1.000 56.269 0 302 PRO BBB O 1 ? 4 ATOM 4498 C CB . PRO B 1 296 ? -16.148 -0.009 -6.632 1.000 51.457 0 302 PRO BBB CB 1 ? 4 ATOM 4499 C CG . PRO B 1 296 ? -17.175 -1.057 -6.996 1.000 51.500 0 302 PRO BBB CG 1 ? 4 ATOM 4500 C CD . PRO B 1 296 ? -17.204 -1.997 -5.813 1.000 50.141 0 302 PRO BBB CD 1 ? 4 ATOM 4501 N N . PRO B 1 297 ? -16.946 2.518 -4.576 1.000 49.556 0 303 PRO BBB N 1 ? 4 ATOM 4502 C CA . PRO B 1 297 ? -17.883 3.597 -4.253 1.000 51.725 0 303 PRO BBB CA 1 ? 4 ATOM 4503 C C . PRO B 1 297 ? -19.041 3.779 -5.247 1.000 55.609 0 303 PRO BBB C 1 ? 4 ATOM 4504 O O . PRO B 1 297 ? -18.788 3.784 -6.433 1.000 59.202 0 303 PRO BBB O 1 ? 4 ATOM 4505 C CB . PRO B 1 297 ? -17.010 4.860 -4.292 1.000 50.432 0 303 PRO BBB CB 1 ? 4 ATOM 4506 C CG . PRO B 1 297 ? -15.609 4.363 -4.027 1.000 48.556 0 303 PRO BBB CG 1 ? 4 ATOM 4507 C CD . PRO B 1 297 ? -15.551 2.976 -4.621 1.000 47.504 0 303 PRO BBB CD 1 ? 4 ATOM 4508 N N . CYS B 1 298 ? -20.267 3.914 -4.731 1.000 60.045 0 304 CYS BBB N 1 ? 4 ATOM 4509 C CA . CYS B 1 298 ? -21.487 4.352 -5.461 1.000 64.250 0 304 CYS BBB CA 1 ? 4 ATOM 4510 C C . CYS B 1 298 ? -21.875 5.760 -5.005 1.000 72.225 0 304 CYS BBB C 1 ? 4 ATOM 4511 O O . CYS B 1 298 ? -21.261 6.265 -4.041 1.000 76.751 0 304 CYS BBB O 1 ? 4 ATOM 4512 C CB . CYS B 1 298 ? -22.668 3.434 -5.184 1.000 64.518 0 304 CYS BBB CB 1 ? 4 ATOM 4513 S SG . CYS B 1 298 ? -22.252 1.677 -5.309 1.000 63.133 0 304 CYS BBB SG 1 ? 4 ATOM 4514 N N . ALA B 1 299 ? -22.869 6.358 -5.663 1.000 76.518 0 305 ALA BBB N 1 ? 4 ATOM 4515 C CA . ALA B 1 299 ? -23.496 7.634 -5.254 1.000 81.773 0 305 ALA BBB CA 1 ? 4 ATOM 4516 C C . ALA B 1 299 ? -24.909 7.337 -4.749 1.000 89.002 0 305 ALA BBB C 1 ? 4 ATOM 4517 O O . ALA B 1 299 ? -25.375 6.195 -4.966 1.000 86.027 0 305 ALA BBB O 1 ? 4 ATOM 4518 C CB . ALA B 1 299 ? -23.502 8.607 -6.409 1.000 81.668 0 305 ALA BBB CB 1 ? 4 ATOM 4519 N N . GLN B 1 300 ? -25.527 8.318 -4.076 1.000 99.313 0 306 GLN BBB N 1 ? 4 ATOM 4520 C CA . GLN B 1 300 ? -26.967 8.337 -3.695 1.000 107.060 0 306 GLN BBB CA 1 ? 4 ATOM 4521 C C . GLN B 1 300 ? -27.291 7.086 -2.870 1.000 109.506 0 306 GLN BBB C 1 ? 4 ATOM 4522 O O . GLN B 1 300 ? -28.075 7.188 -1.928 1.000 114.519 0 306 GLN BBB O 1 ? 4 ATOM 4523 C CB . GLN B 1 300 ? -27.816 8.492 -4.959 1.000 108.597 0 306 GLN BBB CB 1 ? 4 ATOM 4524 C CG . GLN B 1 300 ? -29.282 8.130 -4.782 1.000 110.055 0 306 GLN BBB CG 1 ? 4 ATOM 4525 C CD . GLN B 1 300 ? -29.509 6.665 -5.057 1.000 106.427 0 306 GLN BBB CD 1 ? 4 ATOM 4526 O OE1 . GLN B 1 300 ? -29.376 6.204 -6.187 1.000 99.818 0 306 GLN BBB OE1 1 ? 4 ATOM 4527 N NE2 . GLN B 1 300 ? -29.841 5.918 -4.018 1.000 107.475 0 306 GLN BBB NE2 1 ? 4 ATOM 4528 N N . PRO C 2 8 ? -11.754 -39.413 -34.590 1.000 115.984 0 841 PRO CCC N 1 ? 5 ATOM 4529 C CA . PRO C 2 8 ? -13.001 -38.925 -35.199 1.000 113.330 0 841 PRO CCC CA 1 ? 5 ATOM 4530 C C . PRO C 2 8 ? -12.752 -37.745 -36.154 1.000 105.237 0 841 PRO CCC C 1 ? 5 ATOM 4531 O O . PRO C 2 8 ? -13.266 -36.668 -35.909 1.000 104.970 0 841 PRO CCC O 1 ? 5 ATOM 4532 C CB . PRO C 2 8 ? -13.844 -38.519 -33.981 1.000 117.389 0 841 PRO CCC CB 1 ? 5 ATOM 4533 C CG . PRO C 2 8 ? -12.820 -38.002 -33.004 1.000 113.500 0 841 PRO CCC CG 1 ? 5 ATOM 4534 C CD . PRO C 2 8 ? -11.613 -38.892 -33.222 1.000 113.880 0 841 PRO CCC CD 1 ? 5 ATOM 4535 N N . ILE C 2 9 ? -11.974 -37.985 -37.217 1.000 101.617 0 842 ILE CCC N 1 ? 5 ATOM 4536 C CA . ILE C 2 9 ? -11.611 -36.997 -38.285 1.000 97.675 0 842 ILE CCC CA 1 ? 5 ATOM 4537 C C . ILE C 2 9 ? -12.847 -36.724 -39.147 1.000 88.317 0 842 ILE CCC C 1 ? 5 ATOM 4538 O O . ILE C 2 9 ? -13.503 -37.668 -39.590 1.000 87.229 0 842 ILE CCC O 1 ? 5 ATOM 4539 C CB . ILE C 2 9 ? -10.419 -37.513 -39.131 1.000 99.336 0 842 ILE CCC CB 1 ? 5 ATOM 4540 C CG1 . ILE C 2 9 ? -9.119 -37.598 -38.321 1.000 106.759 0 842 ILE CCC CG1 1 ? 5 ATOM 4541 C CG2 . ILE C 2 9 ? -10.229 -36.694 -40.400 1.000 92.090 0 842 ILE CCC CG2 1 ? 5 ATOM 4542 C CD1 . ILE C 2 9 ? -8.667 -36.290 -37.702 1.000 104.782 0 842 ILE CCC CD1 1 ? 5 ATOM 4543 N N . PRO C 2 10 ? -13.208 -35.444 -39.426 1.000 80.133 0 843 PRO CCC N 1 ? 5 ATOM 4544 C CA . PRO C 2 10 ? -14.399 -35.144 -40.220 1.000 80.454 0 843 PRO CCC CA 1 ? 5 ATOM 4545 C C . PRO C 2 10 ? -14.237 -35.688 -41.651 1.000 80.862 0 843 PRO CCC C 1 ? 5 ATOM 4546 O O . PRO C 2 10 ? -13.107 -35.759 -42.114 1.000 80.598 0 843 PRO CCC O 1 ? 5 ATOM 4547 C CB . PRO C 2 10 ? -14.521 -33.606 -40.199 1.000 76.441 0 843 PRO CCC CB 1 ? 5 ATOM 4548 C CG . PRO C 2 10 ? -13.532 -33.123 -39.152 1.000 72.020 0 843 PRO CCC CG 1 ? 5 ATOM 4549 C CD . PRO C 2 10 ? -12.494 -34.221 -39.022 1.000 73.921 0 843 PRO CCC CD 1 ? 5 ATOM 4550 N N . THR C 2 11 ? -15.347 -36.059 -42.303 1.000 82.303 0 844 THR CCC N 1 ? 5 ATOM 4551 C CA . THR C 2 11 ? -15.377 -36.780 -43.607 1.000 79.752 0 844 THR CCC CA 1 ? 5 ATOM 4552 C C . THR C 2 11 ? -14.576 -36.005 -44.666 1.000 80.390 0 844 THR CCC C 1 ? 5 ATOM 4553 O O . THR C 2 11 ? -13.852 -36.653 -45.454 1.000 84.711 0 844 THR CCC O 1 ? 5 ATOM 4554 C CB . THR C 2 11 ? -16.813 -37.013 -44.095 1.000 77.629 0 844 THR CCC CB 1 ? 5 ATOM 4555 O OG1 . THR C 2 11 ? -17.642 -37.430 -43.014 1.000 79.668 0 844 THR CCC OG1 1 ? 5 ATOM 4556 C CG2 . THR C 2 11 ? -16.891 -38.057 -45.185 1.000 81.100 0 844 THR CCC CG2 1 ? 5 ATOM 4557 N N . TRP C 2 12 ? -14.699 -34.673 -44.680 1.000 77.389 0 845 TRP CCC N 1 ? 5 ATOM 4558 C CA . TRP C 2 12 ? -14.155 -33.778 -45.737 1.000 74.424 0 845 TRP CCC CA 1 ? 5 ATOM 4559 C C . TRP C 2 12 ? -12.621 -33.810 -45.755 1.000 78.108 0 845 TRP CCC C 1 ? 5 ATOM 4560 O O . TRP C 2 12 ? -12.056 -33.630 -46.850 1.000 88.975 0 845 TRP CCC O 1 ? 5 ATOM 4561 C CB . TRP C 2 12 ? -14.685 -32.347 -45.567 1.000 72.058 0 845 TRP CCC CB 1 ? 5 ATOM 4562 C CG . TRP C 2 12 ? -14.183 -31.636 -44.348 1.000 70.501 0 845 TRP CCC CG 1 ? 5 ATOM 4563 C CD1 . TRP C 2 12 ? -14.802 -31.548 -43.135 1.000 71.284 0 845 TRP CCC CD1 1 ? 5 ATOM 4564 C CD2 . TRP C 2 12 ? -12.949 -30.907 -44.225 1.000 69.062 0 845 TRP CCC CD2 1 ? 5 ATOM 4565 N NE1 . TRP C 2 12 ? -14.033 -30.827 -42.261 1.000 72.443 0 845 TRP CCC NE1 1 ? 5 ATOM 4566 C CE2 . TRP C 2 12 ? -12.891 -30.420 -42.899 1.000 69.747 0 845 TRP CCC CE2 1 ? 5 ATOM 4567 C CE3 . TRP C 2 12 ? -11.885 -30.634 -45.092 1.000 64.861 0 845 TRP CCC CE3 1 ? 5 ATOM 4568 C CZ2 . TRP C 2 12 ? -11.815 -29.668 -42.429 1.000 66.497 0 845 TRP CCC CZ2 1 ? 5 ATOM 4569 C CZ3 . TRP C 2 12 ? -10.824 -29.890 -44.626 1.000 66.953 0 845 TRP CCC CZ3 1 ? 5 ATOM 4570 C CH2 . TRP C 2 12 ? -10.792 -29.412 -43.314 1.000 66.468 0 845 TRP CCC CH2 1 ? 5 ATOM 4571 N N . ALA C 2 13 ? -11.978 -34.022 -44.603 1.000 79.830 0 846 ALA CCC N 1 ? 5 ATOM 4572 C CA . ALA C 2 13 ? -10.510 -33.924 -44.412 1.000 80.033 0 846 ALA CCC CA 1 ? 5 ATOM 4573 C C . ALA C 2 13 ? -9.858 -35.313 -44.499 1.000 79.839 0 846 ALA CCC C 1 ? 5 ATOM 4574 O O . ALA C 2 13 ? -8.838 -35.528 -43.816 1.000 77.707 0 846 ALA CCC O 1 ? 5 ATOM 4575 C CB . ALA C 2 13 ? -10.216 -33.261 -43.087 1.000 79.395 0 846 ALA CCC CB 1 ? 5 ATOM 4576 N N . ARG C 2 14 ? -10.411 -36.211 -45.321 1.000 82.953 0 847 ARG CCC N 1 ? 5 ATOM 4577 C CA . ARG C 2 14 ? -9.961 -37.624 -45.459 1.000 87.545 0 847 ARG CCC CA 1 ? 5 ATOM 4578 C C . ARG C 2 14 ? -10.407 -38.162 -46.824 1.000 84.971 0 847 ARG CCC C 1 ? 5 ATOM 4579 O O . ARG C 2 14 ? -11.371 -37.605 -47.379 1.000 80.665 0 847 ARG CCC O 1 ? 5 ATOM 4580 C CB . ARG C 2 14 ? -10.558 -38.460 -44.324 1.000 96.325 0 847 ARG CCC CB 1 ? 5 ATOM 4581 C CG . ARG C 2 14 ? -9.871 -39.795 -44.082 1.000 109.456 0 847 ARG CCC CG 1 ? 5 ATOM 4582 C CD . ARG C 2 14 ? -10.862 -40.860 -43.651 1.000 119.811 0 847 ARG CCC CD 1 ? 5 ATOM 4583 N NE . ARG C 2 14 ? -10.201 -41.942 -42.938 1.000 124.530 0 847 ARG CCC NE 1 ? 5 ATOM 4584 C CZ . ARG C 2 14 ? -9.919 -41.941 -41.638 1.000 129.419 0 847 ARG CCC CZ 1 ? 5 ATOM 4585 N NH1 . ARG C 2 14 ? -10.251 -40.913 -40.874 1.000 130.973 0 847 ARG CCC NH1 1 ? 5 ATOM 4586 N NH2 . ARG C 2 14 ? -9.306 -42.980 -41.096 1.000 137.331 0 847 ARG CCC NH2 1 ? 5 ATOM 4587 N N . GLY C 2 15 ? -9.708 -39.183 -47.337 1.000 86.697 0 848 GLY CCC N 1 ? 5 ATOM 4588 C CA . GLY C 2 15 ? -10.090 -39.991 -48.519 1.000 88.581 0 848 GLY CCC CA 1 ? 5 ATOM 4589 C C . GLY C 2 15 ? -10.528 -39.163 -49.719 1.000 81.467 0 848 GLY CCC C 1 ? 5 ATOM 4590 O O . GLY C 2 15 ? -9.911 -38.109 -49.961 1.000 78.043 0 848 GLY CCC O 1 ? 5 ATOM 4591 N N . THR C 2 16 ? -11.542 -39.641 -50.457 1.000 80.394 0 849 THR CCC N 1 ? 5 ATOM 4592 C CA . THR C 2 16 ? -12.060 -39.049 -51.727 1.000 78.245 0 849 THR CCC CA 1 ? 5 ATOM 4593 C C . THR C 2 16 ? -12.480 -37.601 -51.487 1.000 77.440 0 849 THR CCC C 1 ? 5 ATOM 4594 O O . THR C 2 16 ? -12.054 -36.710 -52.220 1.000 82.087 0 849 THR CCC O 1 ? 5 ATOM 4595 C CB . THR C 2 16 ? -13.221 -39.887 -52.295 1.000 79.134 0 849 THR CCC CB 1 ? 5 ATOM 4596 O OG1 . THR C 2 16 ? -12.664 -40.859 -53.177 1.000 78.037 0 849 THR CCC OG1 1 ? 5 ATOM 4597 C CG2 . THR C 2 16 ? -14.281 -39.095 -53.033 1.000 76.452 0 849 THR CCC CG2 1 ? 5 ATOM 4598 N N . PRO C 2 17 ? -13.337 -37.324 -50.474 1.000 74.296 0 850 PRO CCC N 1 ? 5 ATOM 4599 C CA . PRO C 2 17 ? -13.892 -35.983 -50.282 1.000 69.873 0 850 PRO CCC CA 1 ? 5 ATOM 4600 C C . PRO C 2 17 ? -12.829 -34.876 -50.281 1.000 67.162 0 850 PRO CCC C 1 ? 5 ATOM 4601 O O . PRO C 2 17 ? -13.111 -33.825 -50.813 1.000 68.167 0 850 PRO CCC O 1 ? 5 ATOM 4602 C CB . PRO C 2 17 ? -14.582 -36.082 -48.917 1.000 72.913 0 850 PRO CCC CB 1 ? 5 ATOM 4603 C CG . PRO C 2 17 ? -14.987 -37.535 -48.829 1.000 77.316 0 850 PRO CCC CG 1 ? 5 ATOM 4604 C CD . PRO C 2 17 ? -13.841 -38.283 -49.477 1.000 76.270 0 850 PRO CCC CD 1 ? 5 ATOM 4605 N N . LEU C 2 18 ? -11.643 -35.148 -49.724 1.000 66.717 0 851 LEU CCC N 1 ? 5 ATOM 4606 C CA . LEU C 2 18 ? -10.510 -34.184 -49.652 1.000 62.745 0 851 LEU CCC CA 1 ? 5 ATOM 4607 C C . LEU C 2 18 ? -9.812 -34.069 -51.016 1.000 61.290 0 851 LEU CCC C 1 ? 5 ATOM 4608 O O . LEU C 2 18 ? -9.633 -32.920 -51.478 1.000 58.884 0 851 LEU CCC O 1 ? 5 ATOM 4609 C CB . LEU C 2 18 ? -9.525 -34.634 -48.569 1.000 63.627 0 851 LEU CCC CB 1 ? 5 ATOM 4610 C CG . LEU C 2 18 ? -8.313 -33.723 -48.367 1.000 61.114 0 851 LEU CCC CG 1 ? 5 ATOM 4611 C CD1 . LEU C 2 18 ? -8.734 -32.356 -47.841 1.000 59.702 0 851 LEU CCC CD1 1 ? 5 ATOM 4612 C CD2 . LEU C 2 18 ? -7.299 -34.365 -47.430 1.000 59.704 0 851 LEU CCC CD2 1 ? 5 ATOM 4613 N N . SER C 2 19 ? -9.408 -35.189 -51.633 1.000 62.635 0 852 SER CCC N 1 ? 5 ATOM 4614 C CA . SER C 2 19 ? -8.685 -35.193 -52.940 1.000 62.493 0 852 SER CCC CA 1 ? 5 ATOM 4615 C C . SER C 2 19 ? -9.528 -34.473 -53.997 1.000 58.922 0 852 SER CCC C 1 ? 5 ATOM 4616 O O . SER C 2 19 ? -8.949 -33.672 -54.746 1.000 58.714 0 852 SER CCC O 1 ? 5 ATOM 4617 C CB . SER C 2 19 ? -8.295 -36.577 -53.396 1.000 64.752 0 852 SER CCC CB 1 ? 5 ATOM 4618 O OG . SER C 2 19 ? -9.431 -37.413 -53.487 1.000 71.789 0 852 SER CCC OG 1 ? 5 ATOM 4619 N N . GLN C 2 20 ? -10.841 -34.724 -54.014 1.000 60.190 0 853 GLN CCC N 1 ? 5 ATOM 4620 C CA . GLN C 2 20 ? -11.835 -34.005 -54.859 1.000 63.213 0 853 GLN CCC CA 1 ? 5 ATOM 4621 C C . GLN C 2 20 ? -11.798 -32.494 -54.570 1.000 62.426 0 853 GLN CCC C 1 ? 5 ATOM 4622 O O . GLN C 2 20 ? -11.807 -31.717 -55.554 1.000 61.872 0 853 GLN CCC O 1 ? 5 ATOM 4623 C CB . GLN C 2 20 ? -13.244 -34.570 -54.642 1.000 69.117 0 853 GLN CCC CB 1 ? 5 ATOM 4624 C CG . GLN C 2 20 ? -13.480 -35.908 -55.334 1.000 79.222 0 853 GLN CCC CG 1 ? 5 ATOM 4625 C CD . GLN C 2 20 ? -12.943 -35.926 -56.750 1.000 88.412 0 853 GLN CCC CD 1 ? 5 ATOM 4626 O OE1 . GLN C 2 20 ? -13.393 -35.183 -57.621 1.000 88.509 0 853 GLN CCC OE1 1 ? 5 ATOM 4627 N NE2 . GLN C 2 20 ? -11.947 -36.766 -56.992 1.000 91.268 0 853 GLN CCC NE2 1 ? 5 ATOM 4628 N N . ALA C 2 21 ? -11.773 -32.092 -53.288 1.000 60.013 0 854 ALA CCC N 1 ? 5 ATOM 4629 C CA . ALA C 2 21 ? -11.798 -30.676 -52.831 1.000 53.334 0 854 ALA CCC CA 1 ? 5 ATOM 4630 C C . ALA C 2 21 ? -10.488 -29.973 -53.199 1.000 49.250 0 854 ALA CCC C 1 ? 5 ATOM 4631 O O . ALA C 2 21 ? -10.534 -28.777 -53.565 1.000 45.458 0 854 ALA CCC O 1 ? 5 ATOM 4632 C CB . ALA C 2 21 ? -12.039 -30.599 -51.345 1.000 52.849 0 854 ALA CCC CB 1 ? 5 ATOM 4633 N N . ILE C 2 22 ? -9.363 -30.684 -53.086 1.000 50.371 0 855 ILE CCC N 1 ? 5 ATOM 4634 C CA . ILE C 2 22 ? -8.013 -30.148 -53.424 1.000 55.824 0 855 ILE CCC CA 1 ? 5 ATOM 4635 C C . ILE C 2 22 ? -7.922 -29.952 -54.938 1.000 57.640 0 855 ILE CCC C 1 ? 5 ATOM 4636 O O . ILE C 2 22 ? -7.430 -28.878 -55.366 1.000 58.011 0 855 ILE CCC O 1 ? 5 ATOM 4637 C CB . ILE C 2 22 ? -6.897 -31.075 -52.909 1.000 60.478 0 855 ILE CCC CB 1 ? 5 ATOM 4638 C CG1 . ILE C 2 22 ? -6.809 -31.037 -51.380 1.000 62.884 0 855 ILE CCC CG1 1 ? 5 ATOM 4639 C CG2 . ILE C 2 22 ? -5.565 -30.733 -53.566 1.000 57.419 0 855 ILE CCC CG2 1 ? 5 ATOM 4640 C CD1 . ILE C 2 22 ? -6.074 -32.216 -50.783 1.000 67.537 0 855 ILE CCC CD1 1 ? 5 ATOM 4641 N N . ILE C 2 23 ? -8.341 -30.973 -55.696 1.000 57.809 0 856 ILE CCC N 1 ? 5 ATOM 4642 C CA . ILE C 2 23 ? -8.376 -30.978 -57.189 1.000 54.465 0 856 ILE CCC CA 1 ? 5 ATOM 4643 C C . ILE C 2 23 ? -9.167 -29.754 -57.664 1.000 51.717 0 856 ILE CCC C 1 ? 5 ATOM 4644 O O . ILE C 2 23 ? -8.624 -28.999 -58.495 1.000 51.862 0 856 ILE CCC O 1 ? 5 ATOM 4645 C CB . ILE C 2 23 ? -8.954 -32.304 -57.720 1.000 55.711 0 856 ILE CCC CB 1 ? 5 ATOM 4646 C CG1 . ILE C 2 23 ? -7.908 -33.422 -57.654 1.000 57.772 0 856 ILE CCC CG1 1 ? 5 ATOM 4647 C CG2 . ILE C 2 23 ? -9.514 -32.137 -59.126 1.000 54.681 0 856 ILE CCC CG2 1 ? 5 ATOM 4648 C CD1 . ILE C 2 23 ? -8.492 -34.820 -57.690 1.000 60.946 0 856 ILE CCC CD1 1 ? 5 ATOM 4649 N N . HIS C 2 24 ? -10.382 -29.549 -57.140 1.000 50.483 0 857 HIS CCC N 1 ? 5 ATOM 4650 C CA . HIS C 2 24 ? -11.223 -28.363 -57.458 1.000 50.530 0 857 HIS CCC CA 1 ? 5 ATOM 4651 C C . HIS C 2 24 ? -10.477 -27.077 -57.082 1.000 48.906 0 857 HIS CCC C 1 ? 5 ATOM 4652 O O . HIS C 2 24 ? -10.431 -26.148 -57.910 1.000 51.084 0 857 HIS CCC O 1 ? 5 ATOM 4653 C CB . HIS C 2 24 ? -12.597 -28.417 -56.783 1.000 51.054 0 857 HIS CCC CB 1 ? 5 ATOM 4654 C CG . HIS C 2 24 ? -13.402 -27.195 -57.073 1.000 54.197 0 857 HIS CCC CG 1 ? 5 ATOM 4655 N ND1 . HIS C 2 24 ? -13.312 -26.053 -56.296 1.000 54.894 0 857 HIS CCC ND1 1 ? 5 ATOM 4656 C CD2 . HIS C 2 24 ? -14.259 -26.907 -58.082 1.000 59.216 0 857 HIS CCC CD2 1 ? 5 ATOM 4657 C CE1 . HIS C 2 24 ? -14.108 -25.124 -56.790 1.000 59.705 0 857 HIS CCC CE1 1 ? 5 ATOM 4658 N NE2 . HIS C 2 24 ? -14.696 -25.621 -57.894 1.000 62.690 0 857 HIS CCC NE2 1 ? 5 ATOM 4659 N N . GLN C 2 25 ? -9.898 -27.028 -55.886 1.000 49.615 0 858 GLN CCC N 1 ? 5 ATOM 4660 C CA . GLN C 2 25 ? -9.200 -25.820 -55.372 1.000 50.437 0 858 GLN CCC CA 1 ? 5 ATOM 4661 C C . GLN C 2 25 ? -7.979 -25.485 -56.254 1.000 49.989 0 858 GLN CCC C 1 ? 5 ATOM 4662 O O . GLN C 2 25 ? -7.639 -24.274 -56.389 1.000 47.735 0 858 GLN CCC O 1 ? 5 ATOM 4663 C CB . GLN C 2 25 ? -8.811 -26.042 -53.914 1.000 47.847 0 858 GLN CCC CB 1 ? 5 ATOM 4664 C CG . GLN C 2 25 ? -8.331 -24.773 -53.236 1.000 48.549 0 858 GLN CCC CG 1 ? 5 ATOM 4665 C CD . GLN C 2 25 ? -8.357 -24.907 -51.734 1.000 53.923 0 858 GLN CCC CD 1 ? 5 ATOM 4666 O OE1 . GLN C 2 25 ? -9.383 -25.233 -51.134 1.000 56.481 0 858 GLN CCC OE1 1 ? 5 ATOM 4667 N NE2 . GLN C 2 25 ? -7.221 -24.645 -51.112 1.000 53.778 0 858 GLN CCC NE2 1 ? 5 ATOM 4668 N N . TYR C 2 26 ? -7.333 -26.502 -56.831 1.000 48.822 0 859 TYR CCC N 1 ? 5 ATOM 4669 C CA . TYR C 2 26 ? -6.099 -26.332 -57.634 1.000 52.710 0 859 TYR CCC CA 1 ? 5 ATOM 4670 C C . TYR C 2 26 ? -6.446 -25.751 -59.014 1.000 54.860 0 859 TYR CCC C 1 ? 5 ATOM 4671 O O . TYR C 2 26 ? -5.801 -24.756 -59.415 1.000 53.393 0 859 TYR CCC O 1 ? 5 ATOM 4672 C CB . TYR C 2 26 ? -5.318 -27.642 -57.765 1.000 54.338 0 859 TYR CCC CB 1 ? 5 ATOM 4673 C CG . TYR C 2 26 ? -4.050 -27.482 -58.566 1.000 57.270 0 859 TYR CCC CG 1 ? 5 ATOM 4674 C CD1 . TYR C 2 26 ? -2.878 -27.073 -57.963 1.000 55.430 0 859 TYR CCC CD1 1 ? 5 ATOM 4675 C CD2 . TYR C 2 26 ? -4.035 -27.674 -59.941 1.000 64.770 0 859 TYR CCC CD2 1 ? 5 ATOM 4676 C CE1 . TYR C 2 26 ? -1.712 -26.905 -58.690 1.000 60.787 0 859 TYR CCC CE1 1 ? 5 ATOM 4677 C CE2 . TYR C 2 26 ? -2.880 -27.499 -60.686 1.000 66.314 0 859 TYR CCC CE2 1 ? 5 ATOM 4678 C CZ . TYR C 2 26 ? -1.710 -27.113 -60.056 1.000 67.529 0 859 TYR CCC CZ 1 ? 5 ATOM 4679 O OH . TYR C 2 26 ? -0.556 -26.931 -60.765 1.000 74.646 0 859 TYR CCC OH 1 ? 5 ATOM 4680 N N . TYR C 2 27 ? -7.410 -26.354 -59.719 1.000 55.742 0 860 TYR CCC N 1 ? 5 ATOM 4681 C CA . TYR C 2 27 ? -7.743 -26.037 -61.134 1.000 57.224 0 860 TYR CCC CA 1 ? 5 ATOM 4682 C C . TYR C 2 27 ? -8.751 -24.885 -61.206 1.000 58.466 0 860 TYR CCC C 1 ? 5 ATOM 4683 O O . TYR C 2 27 ? -8.918 -24.333 -62.308 1.000 66.114 0 860 TYR CCC O 1 ? 5 ATOM 4684 C CB . TYR C 2 27 ? -8.286 -27.265 -61.872 1.000 56.708 0 860 TYR CCC CB 1 ? 5 ATOM 4685 C CG . TYR C 2 27 ? -7.289 -28.375 -62.097 1.000 54.725 0 860 TYR CCC CG 1 ? 5 ATOM 4686 C CD1 . TYR C 2 27 ? -6.310 -28.283 -63.070 1.000 54.362 0 860 TYR CCC CD1 1 ? 5 ATOM 4687 C CD2 . TYR C 2 27 ? -7.339 -29.536 -61.346 1.000 54.606 0 860 TYR CCC CD2 1 ? 5 ATOM 4688 C CE1 . TYR C 2 27 ? -5.399 -29.308 -63.278 1.000 56.923 0 860 TYR CCC CE1 1 ? 5 ATOM 4689 C CE2 . TYR C 2 27 ? -6.436 -30.569 -61.537 1.000 55.662 0 860 TYR CCC CE2 1 ? 5 ATOM 4690 C CZ . TYR C 2 27 ? -5.460 -30.458 -62.508 1.000 56.767 0 860 TYR CCC CZ 1 ? 5 ATOM 4691 O OH . TYR C 2 27 ? -4.576 -31.486 -62.689 1.000 56.513 0 860 TYR CCC OH 1 ? 5 ATOM 4692 N N . HIS C 2 28 ? -9.419 -24.549 -60.099 1.000 56.305 0 861 HIS CCC N 1 ? 5 ATOM 4693 C CA . HIS C 2 28 ? -10.453 -23.481 -60.056 1.000 60.750 0 861 HIS CCC CA 1 ? 5 ATOM 4694 C C . HIS C 2 28 ? -10.307 -22.656 -58.785 1.000 60.100 0 861 HIS CCC C 1 ? 5 ATOM 4695 O O . HIS C 2 28 ? -11.257 -22.511 -58.019 1.000 59.130 0 861 HIS CCC O 1 ? 5 ATOM 4696 C CB . HIS C 2 28 ? -11.853 -24.085 -60.179 1.000 64.008 0 861 HIS CCC CB 1 ? 5 ATOM 4697 C CG . HIS C 2 28 ? -12.078 -24.814 -61.459 1.000 64.388 0 861 HIS CCC CG 1 ? 5 ATOM 4698 N ND1 . HIS C 2 28 ? -11.545 -26.065 -61.694 1.000 63.921 0 861 HIS CCC ND1 1 ? 5 ATOM 4699 C CD2 . HIS C 2 28 ? -12.781 -24.483 -62.562 1.000 63.966 0 861 HIS CCC CD2 1 ? 5 ATOM 4700 C CE1 . HIS C 2 28 ? -11.908 -26.474 -62.890 1.000 64.577 0 861 HIS CCC CE1 1 ? 5 ATOM 4701 N NE2 . HIS C 2 28 ? -12.669 -25.524 -63.439 1.000 68.017 0 861 HIS CCC NE2 1 ? 5 ATOM 4702 N N . PRO C 2 29 ? -9.123 -22.050 -58.551 1.000 60.371 0 862 PRO CCC N 1 ? 5 ATOM 4703 C CA . PRO C 2 29 ? -8.859 -21.347 -57.300 1.000 60.514 0 862 PRO CCC CA 1 ? 5 ATOM 4704 C C . PRO C 2 29 ? -9.701 -20.079 -57.226 1.000 61.708 0 862 PRO CCC C 1 ? 5 ATOM 4705 O O . PRO C 2 29 ? -10.163 -19.586 -58.250 1.000 68.015 0 862 PRO CCC O 1 ? 5 ATOM 4706 C CB . PRO C 2 29 ? -7.363 -21.025 -57.408 1.000 60.898 0 862 PRO CCC CB 1 ? 5 ATOM 4707 C CG . PRO C 2 29 ? -7.165 -20.827 -58.892 1.000 59.170 0 862 PRO CCC CG 1 ? 5 ATOM 4708 C CD . PRO C 2 29 ? -8.011 -21.924 -59.506 1.000 60.093 0 862 PRO CCC CD 1 ? 5 ATOM 4709 N N . PRO C 2 30 ? -9.923 -19.509 -56.023 1.000 61.295 0 863 PRO CCC N 1 ? 5 ATOM 4710 C CA . PRO C 2 30 ? -10.707 -18.289 -55.886 1.000 61.634 0 863 PRO CCC CA 1 ? 5 ATOM 4711 C C . PRO C 2 30 ? -9.787 -17.068 -55.959 1.000 61.236 0 863 PRO CCC C 1 ? 5 ATOM 4712 O O . PRO C 2 30 ? -8.586 -17.249 -55.917 1.000 60.965 0 863 PRO CCC O 1 ? 5 ATOM 4713 C CB . PRO C 2 30 ? -11.310 -18.470 -54.491 1.000 62.823 0 863 PRO CCC CB 1 ? 5 ATOM 4714 C CG . PRO C 2 30 ? -10.207 -19.170 -53.712 1.000 63.148 0 863 PRO CCC CG 1 ? 5 ATOM 4715 C CD . PRO C 2 30 ? -9.430 -19.992 -54.725 1.000 61.764 0 863 PRO CCC CD 1 ? 5 ATOM 4716 N N . ASN C 2 31 ? -10.372 -15.876 -56.076 1.000 63.755 0 864 ASN CCC N 1 ? 5 ATOM 4717 C CA . ASN C 2 31 ? -9.659 -14.591 -55.869 1.000 65.785 0 864 ASN CCC CA 1 ? 5 ATOM 4718 C C . ASN C 2 31 ? -9.233 -14.544 -54.393 1.000 66.581 0 864 ASN CCC C 1 ? 5 ATOM 4719 O O . ASN C 2 31 ? -10.128 -14.554 -53.520 1.000 67.095 0 864 ASN CCC O 1 ? 5 ATOM 4720 C CB . ASN C 2 31 ? -10.527 -13.400 -56.282 1.000 67.872 0 864 ASN CCC CB 1 ? 5 ATOM 4721 C CG . ASN C 2 31 ? -9.764 -12.093 -56.348 1.000 70.691 0 864 ASN CCC CG 1 ? 5 ATOM 4722 O OD1 . ASN C 2 31 ? -8.809 -11.875 -55.604 1.000 73.115 0 864 ASN CCC OD1 1 ? 5 ATOM 4723 N ND2 . ASN C 2 31 ? -10.190 -11.204 -57.226 1.000 71.548 0 864 ASN CCC ND2 1 ? 5 ATOM 4724 N N . LEU C 2 32 ? -7.920 -14.536 -54.135 1.000 64.371 0 865 LEU CCC N 1 ? 5 ATOM 4725 C CA . LEU C 2 32 ? -7.318 -14.601 -52.774 1.000 61.384 0 865 LEU CCC CA 1 ? 5 ATOM 4726 C C . LEU C 2 32 ? -7.467 -13.246 -52.068 1.000 65.088 0 865 LEU CCC C 1 ? 5 ATOM 4727 O O . LEU C 2 32 ? -7.760 -13.248 -50.864 1.000 63.762 0 865 LEU CCC O 1 ? 5 ATOM 4728 C CB . LEU C 2 32 ? -5.844 -15.006 -52.892 1.000 57.464 0 865 LEU CCC CB 1 ? 5 ATOM 4729 C CG . LEU C 2 32 ? -5.580 -16.446 -53.333 1.000 53.164 0 865 LEU CCC CG 1 ? 5 ATOM 4730 C CD1 . LEU C 2 32 ? -4.090 -16.712 -53.461 1.000 50.888 0 865 LEU CCC CD1 1 ? 5 ATOM 4731 C CD2 . LEU C 2 32 ? -6.209 -17.434 -52.364 1.000 52.791 0 865 LEU CCC CD2 1 ? 5 ATOM 4732 N N . LEU C 2 33 ? -7.280 -12.140 -52.793 1.000 71.841 0 866 LEU CCC N 1 ? 5 ATOM 4733 C CA . LEU C 2 33 ? -7.375 -10.750 -52.264 1.000 81.567 0 866 LEU CCC CA 1 ? 5 ATOM 4734 C C . LEU C 2 33 ? -8.766 -10.496 -51.668 1.000 83.871 0 866 LEU CCC C 1 ? 5 ATOM 4735 O O . LEU C 2 33 ? -8.843 -9.714 -50.705 1.000 86.390 0 866 LEU CCC O 1 ? 5 ATOM 4736 C CB . LEU C 2 33 ? -7.083 -9.755 -53.394 1.000 89.027 0 866 LEU CCC CB 1 ? 5 ATOM 4737 C CG . LEU C 2 33 ? -7.227 -8.275 -53.034 1.000 92.185 0 866 LEU CCC CG 1 ? 5 ATOM 4738 C CD1 . LEU C 2 33 ? -6.306 -7.901 -51.880 1.000 94.179 0 866 LEU CCC CD1 1 ? 5 ATOM 4739 C CD2 . LEU C 2 33 ? -6.953 -7.394 -54.245 1.000 91.994 0 866 LEU CCC CD2 1 ? 5 ATOM 4740 N N . GLU C 2 34 ? -9.819 -11.094 -52.237 1.000 85.766 0 867 GLU CCC N 1 ? 5 ATOM 4741 C CA . GLU C 2 34 ? -11.227 -10.892 -51.791 1.000 89.406 0 867 GLU CCC CA 1 ? 5 ATOM 4742 C C . GLU C 2 34 ? -11.537 -11.843 -50.631 1.000 84.254 0 867 GLU CCC C 1 ? 5 ATOM 4743 O O . GLU C 2 34 ? -12.346 -11.467 -49.763 1.000 89.912 0 867 GLU CCC O 1 ? 5 ATOM 4744 C CB . GLU C 2 34 ? -12.206 -11.076 -52.956 1.000 100.744 0 867 GLU CCC CB 1 ? 5 ATOM 4745 C CG . GLU C 2 34 ? -12.712 -12.498 -53.151 1.000 107.170 0 867 GLU CCC CG 1 ? 5 ATOM 4746 C CD . GLU C 2 34 ? -13.707 -12.668 -54.290 1.000 118.703 0 867 GLU CCC CD 1 ? 5 ATOM 4747 O OE1 . GLU C 2 34 ? -14.273 -11.649 -54.747 1.000 115.863 0 867 GLU CCC OE1 1 ? 5 ATOM 4748 O OE2 . GLU C 2 34 ? -13.914 -13.822 -54.721 1.000 128.350 0 867 GLU CCC OE2 1 ? 5 ATOM 4749 N N . LEU C 2 35 ? -10.908 -13.020 -50.616 1.000 78.908 0 868 LEU CCC N 1 ? 5 ATOM 4750 C CA . LEU C 2 35 ? -11.150 -14.088 -49.610 1.000 72.412 0 868 LEU CCC CA 1 ? 5 ATOM 4751 C C . LEU C 2 35 ? -10.475 -13.718 -48.277 1.000 68.626 0 868 LEU CCC C 1 ? 5 ATOM 4752 O O . LEU C 2 35 ? -11.136 -13.873 -47.237 1.000 66.510 0 868 LEU CCC O 1 ? 5 ATOM 4753 C CB . LEU C 2 35 ? -10.638 -15.423 -50.171 1.000 67.378 0 868 LEU CCC CB 1 ? 5 ATOM 4754 C CG . LEU C 2 35 ? -11.296 -16.689 -49.619 1.000 62.806 0 868 LEU CCC CG 1 ? 5 ATOM 4755 C CD1 . LEU C 2 35 ? -12.798 -16.677 -49.833 1.000 62.550 0 868 LEU CCC CD1 1 ? 5 ATOM 4756 C CD2 . LEU C 2 35 ? -10.689 -17.929 -50.256 1.000 60.184 0 868 LEU CCC CD2 1 ? 5 ATOM 4757 N N . PHE C 2 36 ? -9.227 -13.233 -48.299 1.000 64.187 0 869 PHE CCC N 1 ? 5 ATOM 4758 C CA . PHE C 2 36 ? -8.387 -13.022 -47.087 1.000 62.633 0 869 PHE CCC CA 1 ? 5 ATOM 4759 C C . PHE C 2 36 ? -8.009 -11.553 -46.874 1.000 63.837 0 869 PHE CCC C 1 ? 5 ATOM 4760 O O . PHE C 2 36 ? -7.363 -11.267 -45.855 1.000 68.043 0 869 PHE CCC O 1 ? 5 ATOM 4761 C CB . PHE C 2 36 ? -7.093 -13.830 -47.174 1.000 59.561 0 869 PHE CCC CB 1 ? 5 ATOM 4762 C CG . PHE C 2 36 ? -7.289 -15.320 -47.210 1.000 58.699 0 869 PHE CCC CG 1 ? 5 ATOM 4763 C CD1 . PHE C 2 36 ? -7.540 -16.026 -46.045 1.000 58.878 0 869 PHE CCC CD1 1 ? 5 ATOM 4764 C CD2 . PHE C 2 36 ? -7.195 -16.017 -48.404 1.000 57.749 0 869 PHE CCC CD2 1 ? 5 ATOM 4765 C CE1 . PHE C 2 36 ? -7.697 -17.402 -46.075 1.000 58.805 0 869 PHE CCC CE1 1 ? 5 ATOM 4766 C CE2 . PHE C 2 36 ? -7.340 -17.395 -48.432 1.000 57.536 0 869 PHE CCC CE2 1 ? 5 ATOM 4767 C CZ . PHE C 2 36 ? -7.598 -18.083 -47.268 1.000 59.333 0 869 PHE CCC CZ 1 ? 5 ATOM 4768 N N . GLY C 2 37 ? -8.363 -10.657 -47.792 1.000 64.461 0 870 GLY CCC N 1 ? 5 ATOM 4769 C CA . GLY C 2 37 ? -8.081 -9.216 -47.649 1.000 67.978 0 870 GLY CCC CA 1 ? 5 ATOM 4770 C C . GLY C 2 37 ? -6.595 -8.911 -47.681 1.000 67.677 0 870 GLY CCC C 1 ? 5 ATOM 4771 O O . GLY C 2 37 ? -5.797 -9.834 -47.903 1.000 63.047 0 870 GLY CCC O 1 ? 5 ATOM 4772 N N . THR C 2 38 ? -6.248 -7.642 -47.470 1.000 75.079 0 871 THR CCC N 1 ? 5 ATOM 4773 C CA . THR C 2 38 ? -4.865 -7.095 -47.532 1.000 80.311 0 871 THR CCC CA 1 ? 5 ATOM 4774 C C . THR C 2 38 ? -4.164 -7.367 -46.195 1.000 77.329 0 871 THR CCC C 1 ? 5 ATOM 4775 O O . THR C 2 38 ? -4.748 -7.047 -45.144 1.000 80.941 0 871 THR CCC O 1 ? 5 ATOM 4776 C CB . THR C 2 38 ? -4.905 -5.613 -47.945 1.000 90.429 0 871 THR CCC CB 1 ? 5 ATOM 4777 O OG1 . THR C 2 38 ? -3.620 -5.226 -48.432 1.000 98.968 0 871 THR CCC OG1 1 ? 5 ATOM 4778 C CG2 . THR C 2 38 ? -5.330 -4.670 -46.837 1.000 94.941 0 871 THR CCC CG2 1 ? 5 ATOM 4779 N N . ILE C 2 39 ? -2.964 -7.951 -46.242 1.000 75.336 0 872 ILE CCC N 1 ? 5 ATOM 4780 C CA . ILE C 2 39 ? -2.137 -8.294 -45.045 1.000 75.790 0 872 ILE CCC CA 1 ? 5 ATOM 4781 C C . ILE C 2 39 ? -1.631 -6.980 -44.434 1.000 78.656 0 872 ILE CCC C 1 ? 5 ATOM 4782 O O . ILE C 2 39 ? -0.770 -6.337 -45.065 1.000 78.974 0 872 ILE CCC O 1 ? 5 ATOM 4783 C CB . ILE C 2 39 ? -0.974 -9.235 -45.432 1.000 77.069 0 872 ILE CCC CB 1 ? 5 ATOM 4784 C CG1 . ILE C 2 39 ? -1.470 -10.526 -46.090 1.000 76.817 0 872 ILE CCC CG1 1 ? 5 ATOM 4785 C CG2 . ILE C 2 39 ? -0.084 -9.528 -44.234 1.000 76.463 0 872 ILE CCC CG2 1 ? 5 ATOM 4786 C CD1 . ILE C 2 39 ? -0.365 -11.424 -46.586 1.000 76.342 0 872 ILE CCC CD1 1 ? 5 ATOM 4787 N N . LEU C 2 40 ? -2.151 -6.590 -43.266 1.000 81.263 0 873 LEU CCC N 1 ? 5 ATOM 4788 C CA . LEU C 2 40 ? -1.822 -5.293 -42.614 1.000 86.149 0 873 LEU CCC CA 1 ? 5 ATOM 4789 C C . LEU C 2 40 ? -0.615 -5.497 -41.706 1.000 82.833 0 873 LEU CCC C 1 ? 5 ATOM 4790 O O . LEU C 2 40 ? -0.444 -6.581 -41.154 1.000 79.906 0 873 LEU CCC O 1 ? 5 ATOM 4791 C CB . LEU C 2 40 ? -3.040 -4.783 -41.839 1.000 95.499 0 873 LEU CCC CB 1 ? 5 ATOM 4792 C CG . LEU C 2 40 ? -3.421 -5.572 -40.584 1.000 103.263 0 873 LEU CCC CG 1 ? 5 ATOM 4793 C CD1 . LEU C 2 40 ? -3.046 -4.803 -39.320 1.000 108.003 0 873 LEU CCC CD1 1 ? 5 ATOM 4794 C CD2 . LEU C 2 40 ? -4.909 -5.888 -40.580 1.000 108.289 0 873 LEU CCC CD2 1 ? 5 ATOM 4795 N N . PRO C 2 41 ? 0.250 -4.471 -41.520 1.000 82.502 0 874 PRO CCC N 1 ? 5 ATOM 4796 C CA . PRO C 2 41 ? 1.491 -4.638 -40.763 1.000 79.231 0 874 PRO CCC CA 1 ? 5 ATOM 4797 C C . PRO C 2 41 ? 1.243 -5.129 -39.329 1.000 75.209 0 874 PRO CCC C 1 ? 5 ATOM 4798 O O . PRO C 2 41 ? 0.293 -4.679 -38.718 1.000 73.339 0 874 PRO CCC O 1 ? 5 ATOM 4799 C CB . PRO C 2 41 ? 2.140 -3.244 -40.764 1.000 84.367 0 874 PRO CCC CB 1 ? 5 ATOM 4800 C CG . PRO C 2 41 ? 1.035 -2.286 -41.176 1.000 87.546 0 874 PRO CCC CG 1 ? 5 ATOM 4801 C CD . PRO C 2 41 ? 0.083 -3.100 -42.026 1.000 85.600 0 874 PRO CCC CD 1 ? 5 ATOM 4802 N N . LEU C 2 42 ? 2.114 -6.022 -38.847 1.000 75.248 0 875 LEU CCC N 1 ? 5 ATOM 4803 C CA . LEU C 2 42 ? 2.059 -6.645 -37.494 1.000 75.392 0 875 LEU CCC CA 1 ? 5 ATOM 4804 C C . LEU C 2 42 ? 2.323 -5.589 -36.413 1.000 79.498 0 875 LEU CCC C 1 ? 5 ATOM 4805 O O . LEU C 2 42 ? 3.466 -5.082 -36.337 1.000 77.778 0 875 LEU CCC O 1 ? 5 ATOM 4806 C CB . LEU C 2 42 ? 3.098 -7.767 -37.413 1.000 73.129 0 875 LEU CCC CB 1 ? 5 ATOM 4807 C CG . LEU C 2 42 ? 2.992 -8.671 -36.186 1.000 71.932 0 875 LEU CCC CG 1 ? 5 ATOM 4808 C CD1 . LEU C 2 42 ? 1.796 -9.594 -36.312 1.000 71.026 0 875 LEU CCC CD1 1 ? 5 ATOM 4809 C CD2 . LEU C 2 42 ? 4.265 -9.479 -35.987 1.000 71.049 0 875 LEU CCC CD2 1 ? 5 ATOM 4810 N N . ASP C 2 43 ? 1.301 -5.297 -35.603 1.000 83.763 0 876 ASP CCC N 1 ? 5 ATOM 4811 C CA . ASP C 2 43 ? 1.335 -4.309 -34.491 1.000 90.801 0 876 ASP CCC CA 1 ? 5 ATOM 4812 C C . ASP C 2 43 ? 1.906 -5.000 -33.242 1.000 90.467 0 876 ASP CCC C 1 ? 5 ATOM 4813 O O . ASP C 2 43 ? 1.139 -5.706 -32.560 1.000 92.639 0 876 ASP CCC O 1 ? 5 ATOM 4814 C CB . ASP C 2 43 ? -0.071 -3.736 -34.281 1.000 95.040 0 876 ASP CCC CB 1 ? 5 ATOM 4815 C CG . ASP C 2 43 ? -0.136 -2.452 -33.472 1.000 98.838 0 876 ASP CCC CG 1 ? 5 ATOM 4816 O OD1 . ASP C 2 43 ? 0.843 -2.143 -32.773 1.000 95.784 0 876 ASP CCC OD1 1 ? 5 ATOM 4817 O OD2 . ASP C 2 43 ? -1.180 -1.775 -33.548 1.000 103.415 0 876 ASP CCC OD2 1 ? 5 ATOM 4818 N N . LEU C 2 44 ? 3.200 -4.805 -32.956 1.000 89.260 0 877 LEU CCC N 1 ? 5 ATOM 4819 C CA . LEU C 2 44 ? 3.955 -5.553 -31.908 1.000 86.448 0 877 LEU CCC CA 1 ? 5 ATOM 4820 C C . LEU C 2 44 ? 3.485 -5.149 -30.505 1.000 86.338 0 877 LEU CCC C 1 ? 5 ATOM 4821 O O . LEU C 2 44 ? 3.389 -6.045 -29.639 1.000 82.133 0 877 LEU CCC O 1 ? 5 ATOM 4822 C CB . LEU C 2 44 ? 5.458 -5.297 -32.067 1.000 88.291 0 877 LEU CCC CB 1 ? 5 ATOM 4823 C CG . LEU C 2 44 ? 6.116 -5.891 -33.311 1.000 88.359 0 877 LEU CCC CG 1 ? 5 ATOM 4824 C CD1 . LEU C 2 44 ? 7.618 -5.647 -33.287 1.000 91.477 0 877 LEU CCC CD1 1 ? 5 ATOM 4825 C CD2 . LEU C 2 44 ? 5.824 -7.381 -33.448 1.000 82.466 0 877 LEU CCC CD2 1 ? 5 ATOM 4826 N N . GLU C 2 45 ? 3.218 -3.858 -30.277 1.000 90.494 0 878 GLU CCC N 1 ? 5 ATOM 4827 C CA . GLU C 2 45 ? 2.712 -3.344 -28.977 1.000 97.480 0 878 GLU CCC CA 1 ? 5 ATOM 4828 C C . GLU C 2 45 ? 1.345 -3.979 -28.688 1.000 99.344 0 878 GLU CCC C 1 ? 5 ATOM 4829 O O . GLU C 2 45 ? 1.093 -4.304 -27.516 1.000 100.132 0 878 GLU CCC O 1 ? 5 ATOM 4830 C CB . GLU C 2 45 ? 2.661 -1.813 -28.967 1.000 104.975 0 878 GLU CCC CB 1 ? 5 ATOM 4831 C CG . GLU C 2 45 ? 1.610 -1.209 -29.888 1.000 109.017 0 878 GLU CCC CG 1 ? 5 ATOM 4832 C CD . GLU C 2 45 ? 1.491 0.305 -29.812 1.000 115.324 0 878 GLU CCC CD 1 ? 5 ATOM 4833 O OE1 . GLU C 2 45 ? 0.431 0.800 -29.365 1.000 115.294 0 878 GLU CCC OE1 1 ? 5 ATOM 4834 O OE2 . GLU C 2 45 ? 2.449 0.985 -30.222 1.000 120.603 0 878 GLU CCC OE2 1 ? 5 ATOM 4835 N N . ASP C 2 46 ? 0.515 -4.169 -29.721 1.000 104.969 0 879 ASP CCC N 1 ? 5 ATOM 4836 C CA . ASP C 2 46 ? -0.872 -4.706 -29.611 1.000 110.107 0 879 ASP CCC CA 1 ? 5 ATOM 4837 C C . ASP C 2 46 ? -0.823 -6.216 -29.330 1.000 100.770 0 879 ASP CCC C 1 ? 5 ATOM 4838 O O . ASP C 2 46 ? -1.718 -6.710 -28.613 1.000 102.726 0 879 ASP CCC O 1 ? 5 ATOM 4839 C CB . ASP C 2 46 ? -1.693 -4.400 -30.873 1.000 116.232 0 879 ASP CCC CB 1 ? 5 ATOM 4840 C CG . ASP C 2 46 ? -3.206 -4.519 -30.703 1.000 121.690 0 879 ASP CCC CG 1 ? 5 ATOM 4841 O OD1 . ASP C 2 46 ? -3.791 -3.688 -29.964 1.000 122.215 0 879 ASP CCC OD1 1 ? 5 ATOM 4842 O OD2 . ASP C 2 46 ? -3.797 -5.433 -31.324 1.000 120.665 0 879 ASP CCC OD2 1 ? 5 ATOM 4843 N N . ILE C 2 47 ? 0.188 -6.915 -29.855 1.000 91.655 0 880 ILE CCC N 1 ? 5 ATOM 4844 C CA . ILE C 2 47 ? 0.239 -8.407 -29.911 1.000 84.662 0 880 ILE CCC CA 1 ? 5 ATOM 4845 C C . ILE C 2 47 ? 1.072 -8.964 -28.747 1.000 81.179 0 880 ILE CCC C 1 ? 5 ATOM 4846 O O . ILE C 2 47 ? 0.634 -9.970 -28.170 1.000 79.079 0 880 ILE CCC O 1 ? 5 ATOM 4847 C CB . ILE C 2 47 ? 0.742 -8.865 -31.296 1.000 82.323 0 880 ILE CCC CB 1 ? 5 ATOM 4848 C CG1 . ILE C 2 47 ? -0.328 -8.594 -32.356 1.000 88.874 0 880 ILE CCC CG1 1 ? 5 ATOM 4849 C CG2 . ILE C 2 47 ? 1.163 -10.326 -31.303 1.000 76.839 0 880 ILE CCC CG2 1 ? 5 ATOM 4850 C CD1 . ILE C 2 47 ? 0.131 -8.817 -33.773 1.000 91.832 0 880 ILE CCC CD1 1 ? 5 ATOM 4851 N N . PHE C 2 48 ? 2.214 -8.359 -28.407 1.000 80.570 0 881 PHE CCC N 1 ? 5 ATOM 4852 C CA . PHE C 2 48 ? 3.184 -8.945 -27.444 1.000 84.586 0 881 PHE CCC CA 1 ? 5 ATOM 4853 C C . PHE C 2 48 ? 3.281 -8.107 -26.163 1.000 92.812 0 881 PHE CCC C 1 ? 5 ATOM 4854 O O . PHE C 2 48 ? 2.814 -6.954 -26.143 1.000 96.903 0 881 PHE CCC O 1 ? 5 ATOM 4855 C CB . PHE C 2 48 ? 4.539 -9.132 -28.122 1.000 86.189 0 881 PHE CCC CB 1 ? 5 ATOM 4856 C CG . PHE C 2 48 ? 4.511 -10.152 -29.230 1.000 85.097 0 881 PHE CCC CG 1 ? 5 ATOM 4857 C CD1 . PHE C 2 48 ? 4.130 -11.460 -28.975 1.000 85.141 0 881 PHE CCC CD1 1 ? 5 ATOM 4858 C CD2 . PHE C 2 48 ? 4.848 -9.804 -30.529 1.000 87.233 0 881 PHE CCC CD2 1 ? 5 ATOM 4859 C CE1 . PHE C 2 48 ? 4.091 -12.398 -29.995 1.000 86.825 0 881 PHE CCC CE1 1 ? 5 ATOM 4860 C CE2 . PHE C 2 48 ? 4.811 -10.744 -31.548 1.000 83.748 0 881 PHE CCC CE2 1 ? 5 ATOM 4861 C CZ . PHE C 2 48 ? 4.426 -12.038 -31.281 1.000 82.556 0 881 PHE CCC CZ 1 ? 5 ATOM 4862 N N . LYS C 2 49 ? 3.861 -8.708 -25.114 1.000 93.953 0 882 LYS CCC N 1 ? 5 ATOM 4863 C CA . LYS C 2 49 ? 4.053 -8.096 -23.768 1.000 99.489 0 882 LYS CCC CA 1 ? 5 ATOM 4864 C C . LYS C 2 49 ? 5.274 -7.166 -23.805 1.000 105.064 0 882 LYS CCC C 1 ? 5 ATOM 4865 O O . LYS C 2 49 ? 5.928 -7.110 -24.861 1.000 114.606 0 882 LYS CCC O 1 ? 5 ATOM 4866 C CB . LYS C 2 49 ? 4.199 -9.192 -22.704 1.000 101.083 0 882 LYS CCC CB 1 ? 5 ATOM 4867 C CG . LYS C 2 49 ? 5.492 -9.997 -22.754 1.000 100.543 0 882 LYS CCC CG 1 ? 5 ATOM 4868 C CD . LYS C 2 49 ? 5.368 -11.406 -22.179 1.000 94.598 0 882 LYS CCC CD 1 ? 5 ATOM 4869 C CE . LYS C 2 49 ? 4.872 -11.426 -20.750 1.000 92.524 0 882 LYS CCC CE 1 ? 5 ATOM 4870 N NZ . LYS C 2 49 ? 5.650 -10.507 -19.887 1.000 92.286 0 882 LYS CCC NZ 1 ? 5 ATOM 4871 N N . LYS C 2 50 ? 5.553 -6.470 -22.694 1.000 104.232 0 883 LYS CCC N 1 ? 5 ATOM 4872 C CA . LYS C 2 50 ? 6.648 -5.469 -22.538 1.000 105.688 0 883 LYS CCC CA 1 ? 5 ATOM 4873 C C . LYS C 2 50 ? 6.376 -4.253 -23.433 1.000 107.895 0 883 LYS CCC C 1 ? 5 ATOM 4874 O O . LYS C 2 50 ? 5.294 -4.058 -23.991 1.000 106.444 0 883 LYS CCC O 1 ? 5 ATOM 4875 C CB . LYS C 2 50 ? 8.015 -6.078 -22.868 1.000 102.873 0 883 LYS CCC CB 1 ? 5 ATOM 4876 C CG . LYS C 2 50 ? 8.379 -7.328 -22.077 1.000 100.177 0 883 LYS CCC CG 1 ? 5 ATOM 4877 C CD . LYS C 2 50 ? 9.826 -7.358 -21.616 1.000 101.313 0 883 LYS CCC CD 1 ? 5 ATOM 4878 C CE . LYS C 2 50 ? 10.126 -6.344 -20.531 1.000 102.924 0 883 LYS CCC CE 1 ? 5 ATOM 4879 N NZ . LYS C 2 50 ? 11.368 -6.680 -19.798 1.000 103.886 0 883 LYS CCC NZ 1 ? 5 ATOM 4880 N N . PRO D 2 8 ? -0.470 11.469 -31.680 1.000 117.767 0 841 PRO DDD N 1 ? 6 ATOM 4881 C CA . PRO D 2 8 ? -0.923 12.768 -31.158 1.000 116.978 0 841 PRO DDD CA 1 ? 6 ATOM 4882 C C . PRO D 2 8 ? -2.072 12.620 -30.144 1.000 112.950 0 841 PRO DDD C 1 ? 6 ATOM 4883 O O . PRO D 2 8 ? -3.142 13.148 -30.385 1.000 116.194 0 841 PRO DDD O 1 ? 6 ATOM 4884 C CB . PRO D 2 8 ? -1.361 13.509 -32.431 1.000 119.075 0 841 PRO DDD CB 1 ? 6 ATOM 4885 C CG . PRO D 2 8 ? -1.939 12.414 -33.288 1.000 116.267 0 841 PRO DDD CG 1 ? 6 ATOM 4886 C CD . PRO D 2 8 ? -1.050 11.219 -33.009 1.000 117.547 0 841 PRO DDD CD 1 ? 6 ATOM 4887 N N . ILE D 2 9 ? -1.820 11.900 -29.045 1.000 109.718 0 842 ILE DDD N 1 ? 6 ATOM 4888 C CA . ILE D 2 9 ? -2.811 11.597 -27.962 1.000 102.201 0 842 ILE DDD CA 1 ? 6 ATOM 4889 C C . ILE D 2 9 ? -3.021 12.862 -27.127 1.000 90.443 0 842 ILE DDD C 1 ? 6 ATOM 4890 O O . ILE D 2 9 ? -2.051 13.503 -26.732 1.000 90.395 0 842 ILE DDD O 1 ? 6 ATOM 4891 C CB . ILE D 2 9 ? -2.345 10.383 -27.120 1.000 105.511 0 842 ILE DDD CB 1 ? 6 ATOM 4892 C CG1 . ILE D 2 9 ? -2.450 9.082 -27.928 1.000 111.396 0 842 ILE DDD CG1 1 ? 6 ATOM 4893 C CG2 . ILE D 2 9 ? -3.108 10.283 -25.806 1.000 98.083 0 842 ILE DDD CG2 1 ? 6 ATOM 4894 C CD1 . ILE D 2 9 ? -1.768 7.885 -27.296 1.000 112.166 0 842 ILE DDD CD1 1 ? 6 ATOM 4895 N N . PRO D 2 10 ? -4.280 13.273 -26.827 1.000 80.471 0 843 PRO DDD N 1 ? 6 ATOM 4896 C CA . PRO D 2 10 ? -4.515 14.489 -26.049 1.000 79.429 0 843 PRO DDD CA 1 ? 6 ATOM 4897 C C . PRO D 2 10 ? -3.966 14.311 -24.622 1.000 80.989 0 843 PRO DDD C 1 ? 6 ATOM 4898 O O . PRO D 2 10 ? -3.926 13.198 -24.152 1.000 80.846 0 843 PRO DDD O 1 ? 6 ATOM 4899 C CB . PRO D 2 10 ? -6.043 14.685 -26.070 1.000 74.401 0 843 PRO DDD CB 1 ? 6 ATOM 4900 C CG . PRO D 2 10 ? -6.567 13.709 -27.108 1.000 73.038 0 843 PRO DDD CG 1 ? 6 ATOM 4901 C CD . PRO D 2 10 ? -5.540 12.598 -27.187 1.000 75.307 0 843 PRO DDD CD 1 ? 6 ATOM 4902 N N . THR D 2 11 ? -3.557 15.402 -23.970 1.000 81.693 0 844 THR DDD N 1 ? 6 ATOM 4903 C CA . THR D 2 11 ? -2.842 15.390 -22.665 1.000 81.390 0 844 THR DDD CA 1 ? 6 ATOM 4904 C C . THR D 2 11 ? -3.679 14.666 -21.599 1.000 84.044 0 844 THR DDD C 1 ? 6 ATOM 4905 O O . THR D 2 11 ? -3.070 13.948 -20.785 1.000 87.862 0 844 THR DDD O 1 ? 6 ATOM 4906 C CB . THR D 2 11 ? -2.475 16.813 -22.235 1.000 81.092 0 844 THR DDD CB 1 ? 6 ATOM 4907 O OG1 . THR D 2 11 ? -3.690 17.559 -22.209 1.000 80.141 0 844 THR DDD OG1 1 ? 6 ATOM 4908 C CG2 . THR D 2 11 ? -1.469 17.463 -23.161 1.000 84.167 0 844 THR DDD CG2 1 ? 6 ATOM 4909 N N . TRP D 2 12 ? -5.009 14.828 -21.610 1.000 82.534 0 845 TRP DDD N 1 ? 6 ATOM 4910 C CA . TRP D 2 12 ? -5.933 14.299 -20.565 1.000 78.520 0 845 TRP DDD CA 1 ? 6 ATOM 4911 C C . TRP D 2 12 ? -5.934 12.763 -20.539 1.000 79.797 0 845 TRP DDD C 1 ? 6 ATOM 4912 O O . TRP D 2 12 ? -6.145 12.196 -19.441 1.000 94.974 0 845 TRP DDD O 1 ? 6 ATOM 4913 C CB . TRP D 2 12 ? -7.355 14.849 -20.746 1.000 76.217 0 845 TRP DDD CB 1 ? 6 ATOM 4914 C CG . TRP D 2 12 ? -8.061 14.358 -21.972 1.000 73.716 0 845 TRP DDD CG 1 ? 6 ATOM 4915 C CD1 . TRP D 2 12 ? -8.133 14.990 -23.178 1.000 75.829 0 845 TRP DDD CD1 1 ? 6 ATOM 4916 C CD2 . TRP D 2 12 ? -8.807 13.135 -22.114 1.000 70.298 0 845 TRP DDD CD2 1 ? 6 ATOM 4917 N NE1 . TRP D 2 12 ? -8.866 14.244 -24.060 1.000 76.201 0 845 TRP DDD NE1 1 ? 6 ATOM 4918 C CE2 . TRP D 2 12 ? -9.283 13.095 -23.443 1.000 71.715 0 845 TRP DDD CE2 1 ? 6 ATOM 4919 C CE3 . TRP D 2 12 ? -9.109 12.067 -21.260 1.000 66.595 0 845 TRP DDD CE3 1 ? 6 ATOM 4920 C CZ2 . TRP D 2 12 ? -10.044 12.033 -23.933 1.000 68.777 0 845 TRP DDD CZ2 1 ? 6 ATOM 4921 C CZ3 . TRP D 2 12 ? -9.864 11.020 -21.744 1.000 65.593 0 845 TRP DDD CZ3 1 ? 6 ATOM 4922 C CH2 . TRP D 2 12 ? -10.324 11.005 -23.062 1.000 66.060 0 845 TRP DDD CH2 1 ? 6 ATOM 4923 N N . ALA D 2 13 ? -5.719 12.115 -21.689 1.000 77.920 0 846 ALA DDD N 1 ? 6 ATOM 4924 C CA . ALA D 2 13 ? -5.843 10.648 -21.881 1.000 74.060 0 846 ALA DDD CA 1 ? 6 ATOM 4925 C C . ALA D 2 13 ? -4.475 9.968 -21.762 1.000 73.777 0 846 ALA DDD C 1 ? 6 ATOM 4926 O O . ALA D 2 13 ? -4.294 8.924 -22.403 1.000 70.805 0 846 ALA DDD O 1 ? 6 ATOM 4927 C CB . ALA D 2 13 ? -6.483 10.363 -23.220 1.000 73.191 0 846 ALA DDD CB 1 ? 6 ATOM 4928 N N . ARG D 2 14 ? -3.573 10.518 -20.940 1.000 80.168 0 847 ARG DDD N 1 ? 6 ATOM 4929 C CA . ARG D 2 14 ? -2.174 10.040 -20.776 1.000 85.340 0 847 ARG DDD CA 1 ? 6 ATOM 4930 C C . ARG D 2 14 ? -1.627 10.514 -19.425 1.000 85.239 0 847 ARG DDD C 1 ? 6 ATOM 4931 O O . ARG D 2 14 ? -2.187 11.489 -18.878 1.000 86.780 0 847 ARG DDD O 1 ? 6 ATOM 4932 C CB . ARG D 2 14 ? -1.304 10.577 -21.915 1.000 92.468 0 847 ARG DDD CB 1 ? 6 ATOM 4933 C CG . ARG D 2 14 ? -0.079 9.721 -22.199 1.000 102.357 0 847 ARG DDD CG 1 ? 6 ATOM 4934 C CD . ARG D 2 14 ? 1.134 10.535 -22.606 1.000 112.941 0 847 ARG DDD CD 1 ? 6 ATOM 4935 N NE . ARG D 2 14 ? 2.086 9.717 -23.344 1.000 117.165 0 847 ARG DDD NE 1 ? 6 ATOM 4936 C CZ . ARG D 2 14 ? 2.042 9.479 -24.654 1.000 118.956 0 847 ARG DDD CZ 1 ? 6 ATOM 4937 N NH1 . ARG D 2 14 ? 1.085 10.001 -25.406 1.000 120.583 0 847 ARG DDD NH1 1 ? 6 ATOM 4938 N NH2 . ARG D 2 14 ? 2.963 8.714 -25.215 1.000 123.765 0 847 ARG DDD NH2 1 ? 6 ATOM 4939 N N . GLY D 2 15 ? -0.597 9.836 -18.902 1.000 86.450 0 848 GLY DDD N 1 ? 6 ATOM 4940 C CA . GLY D 2 15 ? 0.204 10.263 -17.733 1.000 88.219 0 848 GLY DDD CA 1 ? 6 ATOM 4941 C C . GLY D 2 15 ? -0.636 10.667 -16.527 1.000 81.084 0 848 GLY DDD C 1 ? 6 ATOM 4942 O O . GLY D 2 15 ? -1.696 10.030 -16.298 1.000 73.749 0 848 GLY DDD O 1 ? 6 ATOM 4943 N N . THR D 2 16 ? -0.184 11.682 -15.774 1.000 81.588 0 849 THR DDD N 1 ? 6 ATOM 4944 C CA . THR D 2 16 ? -0.811 12.106 -14.486 1.000 77.167 0 849 THR DDD CA 1 ? 6 ATOM 4945 C C . THR D 2 16 ? -2.233 12.586 -14.748 1.000 73.899 0 849 THR DDD C 1 ? 6 ATOM 4946 O O . THR D 2 16 ? -3.136 12.156 -14.038 1.000 75.472 0 849 THR DDD O 1 ? 6 ATOM 4947 C CB . THR D 2 16 ? -0.009 13.126 -13.658 1.000 75.018 0 849 THR DDD CB 1 ? 6 ATOM 4948 O OG1 . THR D 2 16 ? -0.035 14.435 -14.228 1.000 74.876 0 849 THR DDD OG1 1 ? 6 ATOM 4949 C CG2 . THR D 2 16 ? 1.423 12.701 -13.425 1.000 78.095 0 849 THR DDD CG2 1 ? 6 ATOM 4950 N N . PRO D 2 17 ? -2.491 13.450 -15.759 1.000 70.015 0 850 PRO DDD N 1 ? 6 ATOM 4951 C CA . PRO D 2 17 ? -3.831 14.002 -15.970 1.000 67.251 0 850 PRO DDD CA 1 ? 6 ATOM 4952 C C . PRO D 2 17 ? -4.940 12.938 -15.990 1.000 65.559 0 850 PRO DDD C 1 ? 6 ATOM 4953 O O . PRO D 2 17 ? -6.001 13.213 -15.466 1.000 68.037 0 850 PRO DDD O 1 ? 6 ATOM 4954 C CB . PRO D 2 17 ? -3.716 14.695 -17.330 1.000 69.574 0 850 PRO DDD CB 1 ? 6 ATOM 4955 C CG . PRO D 2 17 ? -2.263 15.103 -17.396 1.000 74.169 0 850 PRO DDD CG 1 ? 6 ATOM 4956 C CD . PRO D 2 17 ? -1.523 13.955 -16.745 1.000 72.403 0 850 PRO DDD CD 1 ? 6 ATOM 4957 N N . LEU D 2 18 ? -4.661 11.755 -16.548 1.000 62.907 0 851 LEU DDD N 1 ? 6 ATOM 4958 C CA . LEU D 2 18 ? -5.623 10.623 -16.631 1.000 59.421 0 851 LEU DDD CA 1 ? 6 ATOM 4959 C C . LEU D 2 18 ? -5.745 9.916 -15.271 1.000 61.019 0 851 LEU DDD C 1 ? 6 ATOM 4960 O O . LEU D 2 18 ? -6.893 9.729 -14.811 1.000 62.852 0 851 LEU DDD O 1 ? 6 ATOM 4961 C CB . LEU D 2 18 ? -5.162 9.643 -17.712 1.000 58.690 0 851 LEU DDD CB 1 ? 6 ATOM 4962 C CG . LEU D 2 18 ? -6.067 8.430 -17.917 1.000 56.511 0 851 LEU DDD CG 1 ? 6 ATOM 4963 C CD1 . LEU D 2 18 ? -7.427 8.848 -18.465 1.000 55.471 0 851 LEU DDD CD1 1 ? 6 ATOM 4964 C CD2 . LEU D 2 18 ? -5.401 7.399 -18.817 1.000 55.981 0 851 LEU DDD CD2 1 ? 6 ATOM 4965 N N . SER D 2 19 ? -4.628 9.506 -14.655 1.000 62.760 0 852 SER DDD N 1 ? 6 ATOM 4966 C CA . SER D 2 19 ? -4.628 8.775 -13.355 1.000 63.180 0 852 SER DDD CA 1 ? 6 ATOM 4967 C C . SER D 2 19 ? -5.347 9.614 -12.293 1.000 62.410 0 852 SER DDD C 1 ? 6 ATOM 4968 O O . SER D 2 19 ? -6.140 9.032 -11.543 1.000 63.656 0 852 SER DDD O 1 ? 6 ATOM 4969 C CB . SER D 2 19 ? -3.245 8.378 -12.904 1.000 61.997 0 852 SER DDD CB 1 ? 6 ATOM 4970 O OG . SER D 2 19 ? -2.416 9.513 -12.786 1.000 63.851 0 852 SER DDD OG 1 ? 6 ATOM 4971 N N . GLN D 2 20 ? -5.106 10.929 -12.273 1.000 63.521 0 853 GLN DDD N 1 ? 6 ATOM 4972 C CA . GLN D 2 20 ? -5.826 11.917 -11.421 1.000 65.849 0 853 GLN DDD CA 1 ? 6 ATOM 4973 C C . GLN D 2 20 ? -7.333 11.883 -11.715 1.000 62.745 0 853 GLN DDD C 1 ? 6 ATOM 4974 O O . GLN D 2 20 ? -8.105 11.883 -10.735 1.000 63.227 0 853 GLN DDD O 1 ? 6 ATOM 4975 C CB . GLN D 2 20 ? -5.264 13.329 -11.622 1.000 70.109 0 853 GLN DDD CB 1 ? 6 ATOM 4976 C CG . GLN D 2 20 ? -3.931 13.566 -10.920 1.000 76.140 0 853 GLN DDD CG 1 ? 6 ATOM 4977 C CD . GLN D 2 20 ? -3.903 12.995 -9.519 1.000 79.173 0 853 GLN DDD CD 1 ? 6 ATOM 4978 O OE1 . GLN D 2 20 ? -4.650 13.418 -8.637 1.000 78.120 0 853 GLN DDD OE1 1 ? 6 ATOM 4979 N NE2 . GLN D 2 20 ? -3.050 12.005 -9.303 1.000 80.265 0 853 GLN DDD NE2 1 ? 6 ATOM 4980 N N . ALA D 2 21 ? -7.733 11.860 -12.995 1.000 59.677 0 854 ALA DDD N 1 ? 6 ATOM 4981 C CA . ALA D 2 21 ? -9.149 11.876 -13.449 1.000 55.419 0 854 ALA DDD CA 1 ? 6 ATOM 4982 C C . ALA D 2 21 ? -9.844 10.558 -13.090 1.000 51.008 0 854 ALA DDD C 1 ? 6 ATOM 4983 O O . ALA D 2 21 ? -11.039 10.595 -12.728 1.000 46.896 0 854 ALA DDD O 1 ? 6 ATOM 4984 C CB . ALA D 2 21 ? -9.230 12.124 -14.933 1.000 55.483 0 854 ALA DDD CB 1 ? 6 ATOM 4985 N N . ILE D 2 22 ? -9.130 9.437 -13.207 1.000 52.419 0 855 ILE DDD N 1 ? 6 ATOM 4986 C CA . ILE D 2 22 ? -9.659 8.084 -12.867 1.000 59.398 0 855 ILE DDD CA 1 ? 6 ATOM 4987 C C . ILE D 2 22 ? -9.847 7.986 -11.351 1.000 61.186 0 855 ILE DDD C 1 ? 6 ATOM 4988 O O . ILE D 2 22 ? -10.911 7.484 -10.917 1.000 60.865 0 855 ILE DDD O 1 ? 6 ATOM 4989 C CB . ILE D 2 22 ? -8.728 6.973 -13.387 1.000 65.608 0 855 ILE DDD CB 1 ? 6 ATOM 4990 C CG1 . ILE D 2 22 ? -8.763 6.891 -14.915 1.000 72.275 0 855 ILE DDD CG1 1 ? 6 ATOM 4991 C CG2 . ILE D 2 22 ? -9.072 5.635 -12.742 1.000 62.326 0 855 ILE DDD CG2 1 ? 6 ATOM 4992 C CD1 . ILE D 2 22 ? -7.575 6.168 -15.512 1.000 82.526 0 855 ILE DDD CD1 1 ? 6 ATOM 4993 N N . ILE D 2 23 ? -8.829 8.411 -10.596 1.000 60.125 0 856 ILE DDD N 1 ? 6 ATOM 4994 C CA . ILE D 2 23 ? -8.817 8.438 -9.104 1.000 57.572 0 856 ILE DDD CA 1 ? 6 ATOM 4995 C C . ILE D 2 23 ? -10.037 9.228 -8.623 1.000 55.508 0 856 ILE DDD C 1 ? 6 ATOM 4996 O O . ILE D 2 23 ? -10.785 8.682 -7.783 1.000 53.468 0 856 ILE DDD O 1 ? 6 ATOM 4997 C CB . ILE D 2 23 ? -7.488 9.013 -8.576 1.000 60.296 0 856 ILE DDD CB 1 ? 6 ATOM 4998 C CG1 . ILE D 2 23 ? -6.376 7.963 -8.647 1.000 63.248 0 856 ILE DDD CG1 1 ? 6 ATOM 4999 C CG2 . ILE D 2 23 ? -7.647 9.570 -7.170 1.000 60.864 0 856 ILE DDD CG2 1 ? 6 ATOM 5000 C CD1 . ILE D 2 23 ? -4.977 8.543 -8.619 1.000 69.270 0 856 ILE DDD CD1 1 ? 6 ATOM 5001 N N . HIS D 2 24 ? -10.246 10.441 -9.152 1.000 53.555 0 857 HIS DDD N 1 ? 6 ATOM 5002 C CA . HIS D 2 24 ? -11.436 11.280 -8.842 1.000 53.811 0 857 HIS DDD CA 1 ? 6 ATOM 5003 C C . HIS D 2 24 ? -12.717 10.525 -9.211 1.000 53.554 0 857 HIS DDD C 1 ? 6 ATOM 5004 O O . HIS D 2 24 ? -13.639 10.480 -8.385 1.000 60.116 0 857 HIS DDD O 1 ? 6 ATOM 5005 C CB . HIS D 2 24 ? -11.383 12.649 -9.526 1.000 52.302 0 857 HIS DDD CB 1 ? 6 ATOM 5006 C CG . HIS D 2 24 ? -12.610 13.452 -9.257 1.000 55.145 0 857 HIS DDD CG 1 ? 6 ATOM 5007 N ND1 . HIS D 2 24 ? -13.743 13.349 -10.037 1.000 55.976 0 857 HIS DDD ND1 1 ? 6 ATOM 5008 C CD2 . HIS D 2 24 ? -12.909 14.322 -8.266 1.000 60.756 0 857 HIS DDD CD2 1 ? 6 ATOM 5009 C CE1 . HIS D 2 24 ? -14.676 14.149 -9.567 1.000 60.066 0 857 HIS DDD CE1 1 ? 6 ATOM 5010 N NE2 . HIS D 2 24 ? -14.194 14.751 -8.472 1.000 63.015 0 857 HIS DDD NE2 1 ? 6 ATOM 5011 N N . GLN D 2 25 ? -12.770 9.937 -10.401 1.000 53.895 0 858 GLN DDD N 1 ? 6 ATOM 5012 C CA . GLN D 2 25 ? -13.977 9.235 -10.912 1.000 54.082 0 858 GLN DDD CA 1 ? 6 ATOM 5013 C C . GLN D 2 25 ? -14.307 8.024 -10.018 1.000 51.442 0 858 GLN DDD C 1 ? 6 ATOM 5014 O O . GLN D 2 25 ? -15.516 7.683 -9.882 1.000 47.278 0 858 GLN DDD O 1 ? 6 ATOM 5015 C CB . GLN D 2 25 ? -13.754 8.839 -12.372 1.000 51.941 0 858 GLN DDD CB 1 ? 6 ATOM 5016 C CG . GLN D 2 25 ? -15.007 8.298 -13.040 1.000 52.845 0 858 GLN DDD CG 1 ? 6 ATOM 5017 C CD . GLN D 2 25 ? -14.871 8.283 -14.540 1.000 57.436 0 858 GLN DDD CD 1 ? 6 ATOM 5018 O OE1 . GLN D 2 25 ? -14.571 9.298 -15.166 1.000 62.332 0 858 GLN DDD OE1 1 ? 6 ATOM 5019 N NE2 . GLN D 2 25 ? -15.105 7.125 -15.131 1.000 57.195 0 858 GLN DDD NE2 1 ? 6 ATOM 5020 N N . TYR D 2 26 ? -13.284 7.382 -9.441 1.000 50.991 0 859 TYR DDD N 1 ? 6 ATOM 5021 C CA . TYR D 2 26 ? -13.444 6.145 -8.635 1.000 51.601 0 859 TYR DDD CA 1 ? 6 ATOM 5022 C C . TYR D 2 26 ? -14.026 6.492 -7.257 1.000 52.489 0 859 TYR DDD C 1 ? 6 ATOM 5023 O O . TYR D 2 26 ? -15.018 5.852 -6.860 1.000 50.241 0 859 TYR DDD O 1 ? 6 ATOM 5024 C CB . TYR D 2 26 ? -12.130 5.366 -8.502 1.000 50.685 0 859 TYR DDD CB 1 ? 6 ATOM 5025 C CG . TYR D 2 26 ? -12.302 4.090 -7.717 1.000 51.808 0 859 TYR DDD CG 1 ? 6 ATOM 5026 C CD1 . TYR D 2 26 ? -12.715 2.927 -8.334 1.000 50.062 0 859 TYR DDD CD1 1 ? 6 ATOM 5027 C CD2 . TYR D 2 26 ? -12.129 4.060 -6.342 1.000 58.822 0 859 TYR DDD CD2 1 ? 6 ATOM 5028 C CE1 . TYR D 2 26 ? -12.909 1.757 -7.620 1.000 52.322 0 859 TYR DDD CE1 1 ? 6 ATOM 5029 C CE2 . TYR D 2 26 ? -12.327 2.902 -5.608 1.000 59.973 0 859 TYR DDD CE2 1 ? 6 ATOM 5030 C CZ . TYR D 2 26 ? -12.725 1.743 -6.252 1.000 58.417 0 859 TYR DDD CZ 1 ? 6 ATOM 5031 O OH . TYR D 2 26 ? -12.932 0.586 -5.555 1.000 64.532 0 859 TYR DDD OH 1 ? 6 ATOM 5032 N N . TYR D 2 27 ? -13.423 7.456 -6.552 1.000 55.168 0 860 TYR DDD N 1 ? 6 ATOM 5033 C CA . TYR D 2 27 ? -13.733 7.793 -5.137 1.000 58.934 0 860 TYR DDD CA 1 ? 6 ATOM 5034 C C . TYR D 2 27 ? -14.867 8.822 -5.058 1.000 64.019 0 860 TYR DDD C 1 ? 6 ATOM 5035 O O . TYR D 2 27 ? -15.404 9.018 -3.946 1.000 79.351 0 860 TYR DDD O 1 ? 6 ATOM 5036 C CB . TYR D 2 27 ? -12.495 8.319 -4.400 1.000 59.702 0 860 TYR DDD CB 1 ? 6 ATOM 5037 C CG . TYR D 2 27 ? -11.388 7.314 -4.189 1.000 57.011 0 860 TYR DDD CG 1 ? 6 ATOM 5038 C CD1 . TYR D 2 27 ? -11.481 6.330 -3.221 1.000 55.253 0 860 TYR DDD CD1 1 ? 6 ATOM 5039 C CD2 . TYR D 2 27 ? -10.234 7.355 -4.957 1.000 54.968 0 860 TYR DDD CD2 1 ? 6 ATOM 5040 C CE1 . TYR D 2 27 ? -10.464 5.408 -3.030 1.000 56.396 0 860 TYR DDD CE1 1 ? 6 ATOM 5041 C CE2 . TYR D 2 27 ? -9.208 6.445 -4.778 1.000 54.727 0 860 TYR DDD CE2 1 ? 6 ATOM 5042 C CZ . TYR D 2 27 ? -9.317 5.470 -3.806 1.000 56.800 0 860 TYR DDD CZ 1 ? 6 ATOM 5043 O OH . TYR D 2 27 ? -8.293 4.578 -3.633 1.000 57.583 0 860 TYR DDD OH 1 ? 6 ATOM 5044 N N . HIS D 2 28 ? -15.209 9.486 -6.166 1.000 59.806 0 861 HIS DDD N 1 ? 6 ATOM 5045 C CA . HIS D 2 28 ? -16.269 10.530 -6.204 1.000 62.023 0 861 HIS DDD CA 1 ? 6 ATOM 5046 C C . HIS D 2 28 ? -17.106 10.381 -7.468 1.000 63.958 0 861 HIS DDD C 1 ? 6 ATOM 5047 O O . HIS D 2 28 ? -17.264 11.337 -8.228 1.000 63.078 0 861 HIS DDD O 1 ? 6 ATOM 5048 C CB . HIS D 2 28 ? -15.652 11.928 -6.102 1.000 63.696 0 861 HIS DDD CB 1 ? 6 ATOM 5049 C CG . HIS D 2 28 ? -14.895 12.160 -4.840 1.000 64.491 0 861 HIS DDD CG 1 ? 6 ATOM 5050 N ND1 . HIS D 2 28 ? -13.651 11.603 -4.608 1.000 64.694 0 861 HIS DDD ND1 1 ? 6 ATOM 5051 C CD2 . HIS D 2 28 ? -15.186 12.901 -3.756 1.000 64.266 0 861 HIS DDD CD2 1 ? 6 ATOM 5052 C CE1 . HIS D 2 28 ? -13.217 11.982 -3.428 1.000 63.542 0 861 HIS DDD CE1 1 ? 6 ATOM 5053 N NE2 . HIS D 2 28 ? -14.135 12.779 -2.891 1.000 66.808 0 861 HIS DDD NE2 1 ? 6 ATOM 5054 N N . PRO D 2 29 ? -17.709 9.194 -7.699 1.000 63.748 0 862 PRO DDD N 1 ? 6 ATOM 5055 C CA . PRO D 2 29 ? -18.416 8.924 -8.946 1.000 64.150 0 862 PRO DDD CA 1 ? 6 ATOM 5056 C C . PRO D 2 29 ? -19.683 9.768 -9.020 1.000 65.554 0 862 PRO DDD C 1 ? 6 ATOM 5057 O O . PRO D 2 29 ? -20.180 10.231 -7.994 1.000 73.407 0 862 PRO DDD O 1 ? 6 ATOM 5058 C CB . PRO D 2 29 ? -18.746 7.431 -8.835 1.000 64.963 0 862 PRO DDD CB 1 ? 6 ATOM 5059 C CG . PRO D 2 29 ? -18.928 7.235 -7.349 1.000 63.400 0 862 PRO DDD CG 1 ? 6 ATOM 5060 C CD . PRO D 2 29 ? -17.832 8.086 -6.741 1.000 63.701 0 862 PRO DDD CD 1 ? 6 ATOM 5061 N N . PRO D 2 30 ? -20.245 9.991 -10.227 1.000 59.730 0 863 PRO DDD N 1 ? 6 ATOM 5062 C CA . PRO D 2 30 ? -21.459 10.783 -10.372 1.000 59.741 0 863 PRO DDD CA 1 ? 6 ATOM 5063 C C . PRO D 2 30 ? -22.686 9.871 -10.301 1.000 59.797 0 863 PRO DDD C 1 ? 6 ATOM 5064 O O . PRO D 2 30 ? -22.506 8.662 -10.324 1.000 55.891 0 863 PRO DDD O 1 ? 6 ATOM 5065 C CB . PRO D 2 30 ? -21.260 11.377 -11.767 1.000 61.263 0 863 PRO DDD CB 1 ? 6 ATOM 5066 C CG . PRO D 2 30 ? -20.572 10.259 -12.539 1.000 60.193 0 863 PRO DDD CG 1 ? 6 ATOM 5067 C CD . PRO D 2 30 ? -19.757 9.489 -11.519 1.000 58.918 0 863 PRO DDD CD 1 ? 6 ATOM 5068 N N . ASN D 2 31 ? -23.878 10.464 -10.214 1.000 65.567 0 864 ASN DDD N 1 ? 6 ATOM 5069 C CA . ASN D 2 31 ? -25.159 9.737 -10.403 1.000 69.482 0 864 ASN DDD CA 1 ? 6 ATOM 5070 C C . ASN D 2 31 ? -25.206 9.282 -11.867 1.000 69.479 0 864 ASN DDD C 1 ? 6 ATOM 5071 O O . ASN D 2 31 ? -25.199 10.159 -12.749 1.000 71.889 0 864 ASN DDD O 1 ? 6 ATOM 5072 C CB . ASN D 2 31 ? -26.363 10.594 -10.001 1.000 74.243 0 864 ASN DDD CB 1 ? 6 ATOM 5073 C CG . ASN D 2 31 ? -27.648 9.798 -9.891 1.000 78.551 0 864 ASN DDD CG 1 ? 6 ATOM 5074 O OD1 . ASN D 2 31 ? -27.894 8.882 -10.677 1.000 79.644 0 864 ASN DDD OD1 1 ? 6 ATOM 5075 N ND2 . ASN D 2 31 ? -28.485 10.143 -8.924 1.000 80.873 0 864 ASN DDD ND2 1 ? 6 ATOM 5076 N N . LEU D 2 32 ? -25.203 7.965 -12.101 1.000 67.232 0 865 LEU DDD N 1 ? 6 ATOM 5077 C CA . LEU D 2 32 ? -25.127 7.337 -13.449 1.000 64.233 0 865 LEU DDD CA 1 ? 6 ATOM 5078 C C . LEU D 2 32 ? -26.476 7.464 -14.170 1.000 67.134 0 865 LEU DDD C 1 ? 6 ATOM 5079 O O . LEU D 2 32 ? -26.465 7.727 -15.385 1.000 66.144 0 865 LEU DDD O 1 ? 6 ATOM 5080 C CB . LEU D 2 32 ? -24.719 5.867 -13.290 1.000 59.956 0 865 LEU DDD CB 1 ? 6 ATOM 5081 C CG . LEU D 2 32 ? -23.267 5.620 -12.881 1.000 54.432 0 865 LEU DDD CG 1 ? 6 ATOM 5082 C CD1 . LEU D 2 32 ? -22.985 4.132 -12.749 1.000 51.373 0 865 LEU DDD CD1 1 ? 6 ATOM 5083 C CD2 . LEU D 2 32 ? -22.309 6.245 -13.882 1.000 55.235 0 865 LEU DDD CD2 1 ? 6 ATOM 5084 N N . LEU D 2 33 ? -27.587 7.283 -13.450 1.000 71.493 0 866 LEU DDD N 1 ? 6 ATOM 5085 C CA . LEU D 2 33 ? -28.969 7.348 -13.998 1.000 77.791 0 866 LEU DDD CA 1 ? 6 ATOM 5086 C C . LEU D 2 33 ? -29.235 8.727 -14.615 1.000 78.812 0 866 LEU DDD C 1 ? 6 ATOM 5087 O O . LEU D 2 33 ? -30.015 8.788 -15.580 1.000 79.398 0 866 LEU DDD O 1 ? 6 ATOM 5088 C CB . LEU D 2 33 ? -29.973 7.060 -12.877 1.000 86.973 0 866 LEU DDD CB 1 ? 6 ATOM 5089 C CG . LEU D 2 33 ? -31.448 7.166 -13.270 1.000 90.236 0 866 LEU DDD CG 1 ? 6 ATOM 5090 C CD1 . LEU D 2 33 ? -31.776 6.207 -14.408 1.000 90.276 0 866 LEU DDD CD1 1 ? 6 ATOM 5091 C CD2 . LEU D 2 33 ? -32.350 6.913 -12.069 1.000 90.982 0 866 LEU DDD CD2 1 ? 6 ATOM 5092 N N . GLU D 2 34 ? -28.649 9.792 -14.058 1.000 80.233 0 867 GLU DDD N 1 ? 6 ATOM 5093 C CA . GLU D 2 34 ? -28.859 11.191 -14.524 1.000 86.289 0 867 GLU DDD CA 1 ? 6 ATOM 5094 C C . GLU D 2 34 ? -27.898 11.491 -15.678 1.000 79.820 0 867 GLU DDD C 1 ? 6 ATOM 5095 O O . GLU D 2 34 ? -28.274 12.286 -16.563 1.000 83.185 0 867 GLU DDD O 1 ? 6 ATOM 5096 C CB . GLU D 2 34 ? -28.697 12.187 -13.371 1.000 97.454 0 867 GLU DDD CB 1 ? 6 ATOM 5097 C CG . GLU D 2 34 ? -27.283 12.711 -13.170 1.000 101.078 0 867 GLU DDD CG 1 ? 6 ATOM 5098 C CD . GLU D 2 34 ? -27.139 13.730 -12.048 1.000 112.410 0 867 GLU DDD CD 1 ? 6 ATOM 5099 O OE1 . GLU D 2 34 ? -26.021 13.840 -11.492 1.000 123.425 0 867 GLU DDD OE1 1 ? 6 ATOM 5100 O OE2 . GLU D 2 34 ? -28.142 14.419 -11.735 1.000 104.054 0 867 GLU DDD OE2 1 ? 6 ATOM 5101 N N . LEU D 2 35 ? -26.716 10.870 -15.668 1.000 72.501 0 868 LEU DDD N 1 ? 6 ATOM 5102 C CA . LEU D 2 35 ? -25.635 11.109 -16.662 1.000 71.012 0 868 LEU DDD CA 1 ? 6 ATOM 5103 C C . LEU D 2 35 ? -25.982 10.422 -17.993 1.000 66.111 0 868 LEU DDD C 1 ? 6 ATOM 5104 O O . LEU D 2 35 ? -25.813 11.078 -19.034 1.000 69.445 0 868 LEU DDD O 1 ? 6 ATOM 5105 C CB . LEU D 2 35 ? -24.301 10.609 -16.087 1.000 69.162 0 868 LEU DDD CB 1 ? 6 ATOM 5106 C CG . LEU D 2 35 ? -23.038 11.287 -16.621 1.000 66.036 0 868 LEU DDD CG 1 ? 6 ATOM 5107 C CD1 . LEU D 2 35 ? -23.066 12.784 -16.374 1.000 66.950 0 868 LEU DDD CD1 1 ? 6 ATOM 5108 C CD2 . LEU D 2 35 ? -21.795 10.684 -15.988 1.000 65.317 0 868 LEU DDD CD2 1 ? 6 ATOM 5109 N N . PHE D 2 36 ? -26.464 9.173 -17.966 1.000 59.633 0 869 PHE DDD N 1 ? 6 ATOM 5110 C CA . PHE D 2 36 ? -26.671 8.325 -19.171 1.000 57.922 0 869 PHE DDD CA 1 ? 6 ATOM 5111 C C . PHE D 2 36 ? -28.142 7.952 -19.394 1.000 57.956 0 869 PHE DDD C 1 ? 6 ATOM 5112 O O . PHE D 2 36 ? -28.422 7.299 -20.416 1.000 58.646 0 869 PHE DDD O 1 ? 6 ATOM 5113 C CB . PHE D 2 36 ? -25.859 7.034 -19.070 1.000 56.149 0 869 PHE DDD CB 1 ? 6 ATOM 5114 C CG . PHE D 2 36 ? -24.369 7.240 -19.039 1.000 57.237 0 869 PHE DDD CG 1 ? 6 ATOM 5115 C CD1 . PHE D 2 36 ? -23.669 7.481 -20.211 1.000 56.682 0 869 PHE DDD CD1 1 ? 6 ATOM 5116 C CD2 . PHE D 2 36 ? -23.667 7.178 -17.844 1.000 57.694 0 869 PHE DDD CD2 1 ? 6 ATOM 5117 C CE1 . PHE D 2 36 ? -22.295 7.657 -20.186 1.000 56.583 0 869 PHE DDD CE1 1 ? 6 ATOM 5118 C CE2 . PHE D 2 36 ? -22.292 7.350 -17.823 1.000 56.427 0 869 PHE DDD CE2 1 ? 6 ATOM 5119 C CZ . PHE D 2 36 ? -21.611 7.594 -18.993 1.000 57.059 0 869 PHE DDD CZ 1 ? 6 ATOM 5120 N N . GLY D 2 37 ? -29.049 8.303 -18.484 1.000 58.846 0 870 GLY DDD N 1 ? 6 ATOM 5121 C CA . GLY D 2 37 ? -30.486 7.996 -18.628 1.000 62.456 0 870 GLY DDD CA 1 ? 6 ATOM 5122 C C . GLY D 2 37 ? -30.762 6.503 -18.583 1.000 62.876 0 870 GLY DDD C 1 ? 6 ATOM 5123 O O . GLY D 2 37 ? -29.822 5.731 -18.339 1.000 61.294 0 870 GLY DDD O 1 ? 6 ATOM 5124 N N . THR D 2 38 ? -32.016 6.108 -18.808 1.000 69.261 0 871 THR DDD N 1 ? 6 ATOM 5125 C CA . THR D 2 38 ? -32.472 4.691 -18.811 1.000 72.693 0 871 THR DDD CA 1 ? 6 ATOM 5126 C C . THR D 2 38 ? -32.162 4.059 -20.175 1.000 71.049 0 871 THR DDD C 1 ? 6 ATOM 5127 O O . THR D 2 38 ? -32.483 4.665 -21.213 1.000 74.728 0 871 THR DDD O 1 ? 6 ATOM 5128 C CB . THR D 2 38 ? -33.952 4.582 -18.418 1.000 75.470 0 871 THR DDD CB 1 ? 6 ATOM 5129 O OG1 . THR D 2 38 ? -34.650 5.669 -19.021 1.000 77.272 0 871 THR DDD OG1 1 ? 6 ATOM 5130 C CG2 . THR D 2 38 ? -34.164 4.617 -16.921 1.000 77.195 0 871 THR DDD CG2 1 ? 6 ATOM 5131 N N . ILE D 2 39 ? -31.548 2.876 -20.150 1.000 68.971 0 872 ILE DDD N 1 ? 6 ATOM 5132 C CA . ILE D 2 39 ? -31.247 2.027 -21.340 1.000 70.848 0 872 ILE DDD CA 1 ? 6 ATOM 5133 C C . ILE D 2 39 ? -32.580 1.546 -21.930 1.000 74.611 0 872 ILE DDD C 1 ? 6 ATOM 5134 O O . ILE D 2 39 ? -33.256 0.719 -21.271 1.000 75.358 0 872 ILE DDD O 1 ? 6 ATOM 5135 C CB . ILE D 2 39 ? -30.335 0.846 -20.933 1.000 70.194 0 872 ILE DDD CB 1 ? 6 ATOM 5136 C CG1 . ILE D 2 39 ? -29.025 1.319 -20.298 1.000 67.168 0 872 ILE DDD CG1 1 ? 6 ATOM 5137 C CG2 . ILE D 2 39 ? -30.077 -0.084 -22.109 1.000 69.793 0 872 ILE DDD CG2 1 ? 6 ATOM 5138 C CD1 . ILE D 2 39 ? -28.172 0.200 -19.763 1.000 67.590 0 872 ILE DDD CD1 1 ? 6 ATOM 5139 N N . LEU D 2 40 ? -32.935 2.032 -23.125 1.000 74.869 0 873 LEU DDD N 1 ? 6 ATOM 5140 C CA . LEU D 2 40 ? -34.220 1.718 -23.807 1.000 78.286 0 873 LEU DDD CA 1 ? 6 ATOM 5141 C C . LEU D 2 40 ? -34.053 0.435 -24.617 1.000 79.573 0 873 LEU DDD C 1 ? 6 ATOM 5142 O O . LEU D 2 40 ? -32.963 0.165 -25.121 1.000 76.846 0 873 LEU DDD O 1 ? 6 ATOM 5143 C CB . LEU D 2 40 ? -34.614 2.877 -24.728 1.000 81.375 0 873 LEU DDD CB 1 ? 6 ATOM 5144 C CG . LEU D 2 40 ? -34.588 4.278 -24.120 1.000 85.494 0 873 LEU DDD CG 1 ? 6 ATOM 5145 C CD1 . LEU D 2 40 ? -34.341 5.318 -25.201 1.000 86.594 0 873 LEU DDD CD1 1 ? 6 ATOM 5146 C CD2 . LEU D 2 40 ? -35.873 4.582 -23.363 1.000 90.525 0 873 LEU DDD CD2 1 ? 6 ATOM 5147 N N . PRO D 2 41 ? -35.124 -0.374 -24.810 1.000 83.987 0 874 PRO DDD N 1 ? 6 ATOM 5148 C CA . PRO D 2 41 ? -35.020 -1.625 -25.566 1.000 81.566 0 874 PRO DDD CA 1 ? 6 ATOM 5149 C C . PRO D 2 41 ? -34.492 -1.398 -26.991 1.000 78.232 0 874 PRO DDD C 1 ? 6 ATOM 5150 O O . PRO D 2 41 ? -34.883 -0.417 -27.606 1.000 77.475 0 874 PRO DDD O 1 ? 6 ATOM 5151 C CB . PRO D 2 41 ? -36.457 -2.173 -25.619 1.000 84.356 0 874 PRO DDD CB 1 ? 6 ATOM 5152 C CG . PRO D 2 41 ? -37.181 -1.461 -24.496 1.000 87.203 0 874 PRO DDD CG 1 ? 6 ATOM 5153 C CD . PRO D 2 41 ? -36.495 -0.119 -24.340 1.000 87.622 0 874 PRO DDD CD 1 ? 6 ATOM 5154 N N . LEU D 2 42 ? -33.630 -2.302 -27.469 1.000 75.906 0 875 LEU DDD N 1 ? 6 ATOM 5155 C CA . LEU D 2 42 ? -32.987 -2.228 -28.811 1.000 75.249 0 875 LEU DDD CA 1 ? 6 ATOM 5156 C C . LEU D 2 42 ? -34.032 -2.472 -29.905 1.000 77.664 0 875 LEU DDD C 1 ? 6 ATOM 5157 O O . LEU D 2 42 ? -34.544 -3.606 -29.995 1.000 74.602 0 875 LEU DDD O 1 ? 6 ATOM 5158 C CB . LEU D 2 42 ? -31.868 -3.267 -28.888 1.000 76.601 0 875 LEU DDD CB 1 ? 6 ATOM 5159 C CG . LEU D 2 42 ? -30.939 -3.142 -30.093 1.000 78.605 0 875 LEU DDD CG 1 ? 6 ATOM 5160 C CD1 . LEU D 2 42 ? -30.034 -1.931 -29.946 1.000 80.460 0 875 LEU DDD CD1 1 ? 6 ATOM 5161 C CD2 . LEU D 2 42 ? -30.103 -4.403 -30.261 1.000 78.483 0 875 LEU DDD CD2 1 ? 6 ATOM 5162 N N . ASP D 2 43 ? -34.311 -1.441 -30.709 1.000 82.671 0 876 ASP DDD N 1 ? 6 ATOM 5163 C CA . ASP D 2 43 ? -35.303 -1.446 -31.821 1.000 88.242 0 876 ASP DDD CA 1 ? 6 ATOM 5164 C C . ASP D 2 43 ? -34.625 -2.021 -33.074 1.000 89.336 0 876 ASP DDD C 1 ? 6 ATOM 5165 O O . ASP D 2 43 ? -33.893 -1.265 -33.748 1.000 93.117 0 876 ASP DDD O 1 ? 6 ATOM 5166 C CB . ASP D 2 43 ? -35.846 -0.027 -32.025 1.000 90.565 0 876 ASP DDD CB 1 ? 6 ATOM 5167 C CG . ASP D 2 43 ? -37.125 0.076 -32.836 1.000 92.620 0 876 ASP DDD CG 1 ? 6 ATOM 5168 O OD1 . ASP D 2 43 ? -37.459 -0.892 -33.548 1.000 94.001 0 876 ASP DDD OD1 1 ? 6 ATOM 5169 O OD2 . ASP D 2 43 ? -37.774 1.136 -32.752 1.000 92.605 0 876 ASP DDD OD2 1 ? 6 ATOM 5170 N N . LEU D 2 44 ? -34.851 -3.308 -33.369 1.000 88.630 0 877 LEU DDD N 1 ? 6 ATOM 5171 C CA . LEU D 2 44 ? -34.113 -4.077 -34.413 1.000 86.920 0 877 LEU DDD CA 1 ? 6 ATOM 5172 C C . LEU D 2 44 ? -34.494 -3.588 -35.818 1.000 87.350 0 877 LEU DDD C 1 ? 6 ATOM 5173 O O . LEU D 2 44 ? -33.582 -3.508 -36.673 1.000 84.187 0 877 LEU DDD O 1 ? 6 ATOM 5174 C CB . LEU D 2 44 ? -34.394 -5.576 -34.249 1.000 87.284 0 877 LEU DDD CB 1 ? 6 ATOM 5175 C CG . LEU D 2 44 ? -33.293 -6.393 -33.565 1.000 84.529 0 877 LEU DDD CG 1 ? 6 ATOM 5176 C CD1 . LEU D 2 44 ? -32.859 -5.760 -32.250 1.000 82.559 0 877 LEU DDD CD1 1 ? 6 ATOM 5177 C CD2 . LEU D 2 44 ? -33.745 -7.830 -33.344 1.000 85.671 0 877 LEU DDD CD2 1 ? 6 ATOM 5178 N N . GLU D 2 45 ? -35.777 -3.293 -36.052 1.000 89.321 0 878 GLU DDD N 1 ? 6 ATOM 5179 C CA . GLU D 2 45 ? -36.270 -2.772 -37.356 1.000 97.160 0 878 GLU DDD CA 1 ? 6 ATOM 5180 C C . GLU D 2 45 ? -35.597 -1.421 -37.633 1.000 97.804 0 878 GLU DDD C 1 ? 6 ATOM 5181 O O . GLU D 2 45 ? -35.255 -1.170 -38.801 1.000 102.492 0 878 GLU DDD O 1 ? 6 ATOM 5182 C CB . GLU D 2 45 ? -37.801 -2.670 -37.384 1.000 104.556 0 878 GLU DDD CB 1 ? 6 ATOM 5183 C CG . GLU D 2 45 ? -38.378 -1.638 -36.427 1.000 108.210 0 878 GLU DDD CG 1 ? 6 ATOM 5184 C CD . GLU D 2 45 ? -39.822 -1.233 -36.674 1.000 112.734 0 878 GLU DDD CD 1 ? 6 ATOM 5185 O OE1 . GLU D 2 45 ? -40.653 -1.455 -35.778 1.000 113.975 0 878 GLU DDD OE1 1 ? 6 ATOM 5186 O OE2 . GLU D 2 45 ? -40.110 -0.678 -37.754 1.000 113.962 0 878 GLU DDD OE2 1 ? 6 ATOM 5187 N N . ASP D 2 46 ? -35.400 -0.599 -36.594 1.000 100.368 0 879 ASP DDD N 1 ? 6 ATOM 5188 C CA . ASP D 2 46 ? -34.843 0.780 -36.693 1.000 107.417 0 879 ASP DDD CA 1 ? 6 ATOM 5189 C C . ASP D 2 46 ? -33.332 0.710 -36.960 1.000 103.120 0 879 ASP DDD C 1 ? 6 ATOM 5190 O O . ASP D 2 46 ? -32.818 1.604 -37.665 1.000 108.660 0 879 ASP DDD O 1 ? 6 ATOM 5191 C CB . ASP D 2 46 ? -35.145 1.595 -35.427 1.000 114.160 0 879 ASP DDD CB 1 ? 6 ATOM 5192 C CG . ASP D 2 46 ? -35.002 3.106 -35.576 1.000 119.245 0 879 ASP DDD CG 1 ? 6 ATOM 5193 O OD1 . ASP D 2 46 ? -35.824 3.708 -36.306 1.000 118.164 0 879 ASP DDD OD1 1 ? 6 ATOM 5194 O OD2 . ASP D 2 46 ? -34.079 3.676 -34.947 1.000 118.732 0 879 ASP DDD OD2 1 ? 6 ATOM 5195 N N . ILE D 2 47 ? -32.651 -0.314 -36.433 1.000 93.792 0 880 ILE DDD N 1 ? 6 ATOM 5196 C CA . ILE D 2 47 ? -31.161 -0.384 -36.370 1.000 86.384 0 880 ILE DDD CA 1 ? 6 ATOM 5197 C C . ILE D 2 47 ? -30.612 -1.228 -37.530 1.000 86.915 0 880 ILE DDD C 1 ? 6 ATOM 5198 O O . ILE D 2 47 ? -29.600 -0.805 -38.110 1.000 90.310 0 880 ILE DDD O 1 ? 6 ATOM 5199 C CB . ILE D 2 47 ? -30.710 -0.888 -34.983 1.000 81.610 0 880 ILE DDD CB 1 ? 6 ATOM 5200 C CG1 . ILE D 2 47 ? -30.980 0.180 -33.922 1.000 83.701 0 880 ILE DDD CG1 1 ? 6 ATOM 5201 C CG2 . ILE D 2 47 ? -29.248 -1.314 -34.974 1.000 75.360 0 880 ILE DDD CG2 1 ? 6 ATOM 5202 C CD1 . ILE D 2 47 ? -30.770 -0.288 -32.509 1.000 81.979 0 880 ILE DDD CD1 1 ? 6 ATOM 5203 N N . PHE D 2 48 ? -31.231 -2.363 -37.867 1.000 84.101 0 881 PHE DDD N 1 ? 6 ATOM 5204 C CA . PHE D 2 48 ? -30.651 -3.348 -38.817 1.000 88.340 0 881 PHE DDD CA 1 ? 6 ATOM 5205 C C . PHE D 2 48 ? -31.479 -3.447 -40.105 1.000 98.313 0 881 PHE DDD C 1 ? 6 ATOM 5206 O O . PHE D 2 48 ? -32.597 -2.903 -40.164 1.000 102.453 0 881 PHE DDD O 1 ? 6 ATOM 5207 C CB . PHE D 2 48 ? -30.492 -4.698 -38.119 1.000 88.148 0 881 PHE DDD CB 1 ? 6 ATOM 5208 C CG . PHE D 2 48 ? -29.475 -4.679 -37.010 1.000 85.216 0 881 PHE DDD CG 1 ? 6 ATOM 5209 C CD1 . PHE D 2 48 ? -28.160 -4.323 -37.265 1.000 83.802 0 881 PHE DDD CD1 1 ? 6 ATOM 5210 C CD2 . PHE D 2 48 ? -29.835 -4.997 -35.709 1.000 84.342 0 881 PHE DDD CD2 1 ? 6 ATOM 5211 C CE1 . PHE D 2 48 ? -27.225 -4.296 -36.243 1.000 83.257 0 881 PHE DDD CE1 1 ? 6 ATOM 5212 C CE2 . PHE D 2 48 ? -28.899 -4.968 -34.689 1.000 78.561 0 881 PHE DDD CE2 1 ? 6 ATOM 5213 C CZ . PHE D 2 48 ? -27.598 -4.614 -34.956 1.000 79.781 0 881 PHE DDD CZ 1 ? 6 ATOM 5214 N N . LYS D 2 49 ? -30.911 -4.133 -41.105 1.000 103.611 0 882 LYS DDD N 1 ? 6 ATOM 5215 C CA . LYS D 2 49 ? -31.498 -4.379 -42.449 1.000 111.823 0 882 LYS DDD CA 1 ? 6 ATOM 5216 C C . LYS D 2 49 ? -32.546 -5.496 -42.353 1.000 115.849 0 882 LYS DDD C 1 ? 6 ATOM 5217 O O . LYS D 2 49 ? -32.703 -6.068 -41.254 1.000 121.504 0 882 LYS DDD O 1 ? 6 ATOM 5218 C CB . LYS D 2 49 ? -30.407 -4.771 -43.451 1.000 116.343 0 882 LYS DDD CB 1 ? 6 ATOM 5219 C CG . LYS D 2 49 ? -29.358 -3.704 -43.738 1.000 117.871 0 882 LYS DDD CG 1 ? 6 ATOM 5220 C CD . LYS D 2 49 ? -28.437 -4.028 -44.899 1.000 121.056 0 882 LYS DDD CD 1 ? 6 ATOM 5221 C CE . LYS D 2 49 ? -27.788 -5.396 -44.836 1.000 118.037 0 882 LYS DDD CE 1 ? 6 ATOM 5222 N NZ . LYS D 2 49 ? -28.457 -6.352 -45.750 1.000 121.233 0 882 LYS DDD NZ 1 ? 6 ATOM 5223 N N . LYS D 2 50 ? -33.217 -5.790 -43.473 1.000 113.461 0 883 LYS DDD N 1 ? 6 ATOM 5224 C CA . LYS D 2 50 ? -34.365 -6.733 -43.584 1.000 118.687 0 883 LYS DDD CA 1 ? 6 ATOM 5225 C C . LYS D 2 50 ? -35.621 -6.093 -42.969 1.000 130.250 0 883 LYS DDD C 1 ? 6 ATOM 5226 O O . LYS D 2 50 ? -36.640 -6.809 -42.857 1.000 138.805 0 883 LYS DDD O 1 ? 6 ATOM 5227 C CB . LYS D 2 50 ? -34.048 -8.087 -42.937 1.000 111.220 0 883 LYS DDD CB 1 ? 6 ATOM 5228 C CG . LYS D 2 50 ? -32.733 -8.732 -43.362 1.000 107.088 0 883 LYS DDD CG 1 ? 6 ATOM 5229 C CD . LYS D 2 50 ? -32.561 -8.889 -44.860 1.000 111.121 0 883 LYS DDD CD 1 ? 6 ATOM 5230 C CE . LYS D 2 50 ? -33.552 -9.841 -45.500 1.000 113.281 0 883 LYS DDD CE 1 ? 6 ATOM 5231 N NZ . LYS D 2 50 ? -33.280 -11.245 -45.115 1.000 112.037 0 883 LYS DDD NZ 1 ? 6 ATOM 5232 N N . SER D 2 51 ? -35.565 -4.798 -42.622 1.000 131.006 0 884 SER DDD N 1 ? 6 ATOM 5233 C CA . SER D 2 51 ? -36.710 -3.993 -42.114 1.000 129.574 0 884 SER DDD CA 1 ? 6 ATOM 5234 C C . SER D 2 51 ? -37.808 -3.937 -43.186 1.000 126.848 0 884 SER DDD C 1 ? 6 ATOM 5235 O O . SER D 2 51 ? -38.658 -3.052 -43.201 1.000 121.982 0 884 SER DDD O 1 ? 6 ATOM 5236 C CB . SER D 2 51 ? -36.267 -2.606 -41.695 1.000 125.810 0 884 SER DDD CB 1 ? 6 ATOM 5237 O OG . SER D 2 51 ? -35.963 -1.795 -42.823 1.000 124.427 0 884 SER DDD OG 1 ? 6 HETATM 5238 C C1 . EDO E 3 . ? -9.506 -26.329 3.718 1.000 90.972 0 400 EDO BBB C1 1 ? ? HETATM 5239 O O1 . EDO E 3 . ? -8.643 -25.340 4.250 1.000 77.586 0 400 EDO BBB O1 1 ? ? HETATM 5240 C C2 . EDO E 3 . ? -10.174 -27.149 4.762 1.000 89.794 0 400 EDO BBB C2 1 ? ? HETATM 5241 O O2 . EDO E 3 . ? -11.583 -27.196 4.630 1.000 84.828 0 400 EDO BBB O2 1 ? ? HETATM 5242 O O . HOH F 4 . ? 8.829 -0.962 -44.327 1.000 57.619 0 401 HOH AAA O 1 ? ? HETATM 5243 O O . HOH F 4 . ? 0.539 -19.422 -60.619 1.000 47.101 0 402 HOH AAA O 1 ? ? HETATM 5244 O O . HOH F 4 . ? 18.469 -13.200 -49.462 1.000 48.678 0 403 HOH AAA O 1 ? ? HETATM 5245 O O . HOH F 4 . ? 23.275 -23.436 -46.200 1.000 55.138 0 404 HOH AAA O 1 ? ? HETATM 5246 O O . HOH F 4 . ? 18.834 -18.321 -46.807 1.000 55.115 0 405 HOH AAA O 1 ? ? HETATM 5247 O O . HOH F 4 . ? 11.305 -32.283 -70.327 1.000 32.796 0 406 HOH AAA O 1 ? ? HETATM 5248 O O . HOH F 4 . ? 12.281 -14.535 -61.450 1.000 59.662 0 407 HOH AAA O 1 ? ? HETATM 5249 O O . HOH F 4 . ? 18.323 -15.892 -62.677 1.000 51.082 0 408 HOH AAA O 1 ? ? HETATM 5250 O O . HOH F 4 . ? -4.175 -8.587 -41.910 1.000 56.981 0 409 HOH AAA O 1 ? ? HETATM 5251 O O . HOH F 4 . ? 4.680 -6.450 -40.698 1.000 56.906 0 410 HOH AAA O 1 ? ? HETATM 5252 O O . HOH F 4 . ? 27.244 -46.146 -66.557 1.000 48.447 0 411 HOH AAA O 1 ? ? HETATM 5253 O O . HOH F 4 . ? 8.520 -37.519 -72.728 1.000 62.534 0 412 HOH AAA O 1 ? ? HETATM 5254 O O . HOH F 4 . ? 18.198 -17.073 -67.633 1.000 64.429 0 413 HOH AAA O 1 ? ? HETATM 5255 O O . HOH F 4 . ? 22.414 -25.730 -43.798 1.000 62.901 0 414 HOH AAA O 1 ? ? HETATM 5256 O O . HOH F 4 . ? -0.564 -34.913 -29.830 1.000 48.913 0 415 HOH AAA O 1 ? ? HETATM 5257 O O . HOH F 4 . ? 29.335 -20.243 -40.665 1.000 59.472 0 416 HOH AAA O 1 ? ? HETATM 5258 O O . HOH F 4 . ? 34.613 -38.886 -36.669 1.000 43.379 0 417 HOH AAA O 1 ? ? HETATM 5259 O O . HOH F 4 . ? 32.833 -30.414 -58.274 1.000 61.287 0 418 HOH AAA O 1 ? ? HETATM 5260 O O . HOH F 4 . ? 26.276 -19.405 -36.154 1.000 60.626 0 419 HOH AAA O 1 ? ? HETATM 5261 O O . HOH F 4 . ? 29.795 -24.068 -34.267 1.000 48.934 0 420 HOH AAA O 1 ? ? HETATM 5262 O O . HOH F 4 . ? -8.870 -19.882 -62.955 1.000 52.573 0 421 HOH AAA O 1 ? ? HETATM 5263 O O . HOH F 4 . ? -2.084 -11.472 -49.602 1.000 54.327 0 422 HOH AAA O 1 ? ? HETATM 5264 O O . HOH F 4 . ? -1.626 -20.197 -64.551 1.000 56.956 0 423 HOH AAA O 1 ? ? HETATM 5265 O O . HOH F 4 . ? 16.654 -18.172 -26.860 1.000 53.442 0 424 HOH AAA O 1 ? ? HETATM 5266 O O . HOH F 4 . ? 20.007 -37.251 -70.108 1.000 43.716 0 425 HOH AAA O 1 ? ? HETATM 5267 O O . HOH F 4 . ? -13.656 -26.373 -35.864 1.000 36.060 0 426 HOH AAA O 1 ? ? HETATM 5268 O O . HOH F 4 . ? 10.665 -5.437 -49.099 1.000 60.557 0 427 HOH AAA O 1 ? ? HETATM 5269 O O . HOH F 4 . ? 18.952 -10.126 -49.286 1.000 61.318 0 428 HOH AAA O 1 ? ? HETATM 5270 O O . HOH G 4 . ? -26.383 -11.063 -23.057 1.000 55.655 0 501 HOH BBB O 1 ? ? HETATM 5271 O O . HOH G 4 . ? -26.289 -4.828 -7.921 1.000 47.616 0 502 HOH BBB O 1 ? ? HETATM 5272 O O . HOH G 4 . ? -33.578 -11.076 -28.000 1.000 50.781 0 503 HOH BBB O 1 ? ? HETATM 5273 O O . HOH G 4 . ? -20.338 -0.794 -5.724 1.000 41.800 0 504 HOH BBB O 1 ? ? HETATM 5274 O O . HOH G 4 . ? -23.931 -18.321 -3.510 1.000 52.047 0 505 HOH BBB O 1 ? ? HETATM 5275 O O . HOH G 4 . ? -22.165 10.313 -36.604 1.000 43.642 0 506 HOH BBB O 1 ? ? HETATM 5276 O O . HOH G 4 . ? -13.626 1.118 -35.030 1.000 61.423 0 507 HOH BBB O 1 ? ? HETATM 5277 O O . HOH G 4 . ? -1.071 -18.171 3.598 1.000 58.903 0 508 HOH BBB O 1 ? ? HETATM 5278 O O . HOH G 4 . ? -30.215 7.196 -8.793 1.000 52.776 0 509 HOH BBB O 1 ? ? HETATM 5279 O O . HOH G 4 . ? -9.247 -32.710 -8.094 1.000 57.803 0 510 HOH BBB O 1 ? ? HETATM 5280 O O . HOH G 4 . ? -14.790 -0.794 -9.479 1.000 51.675 0 511 HOH BBB O 1 ? ? HETATM 5281 O O . HOH G 4 . ? -25.467 -12.283 -5.365 1.000 56.858 0 512 HOH BBB O 1 ? ? HETATM 5282 O O . HOH G 4 . ? -19.236 2.639 -13.026 1.000 50.612 0 513 HOH BBB O 1 ? ? HETATM 5283 O O . HOH G 4 . ? -31.272 4.956 -24.433 1.000 53.935 0 514 HOH BBB O 1 ? ? HETATM 5284 O O . HOH G 4 . ? -19.571 1.836 -1.894 1.000 52.419 0 515 HOH BBB O 1 ? ? HETATM 5285 O O . HOH G 4 . ? -15.237 -30.047 -32.199 1.000 55.139 0 516 HOH BBB O 1 ? ? HETATM 5286 O O . HOH G 4 . ? -4.300 -5.965 -10.598 1.000 55.403 0 517 HOH BBB O 1 ? ? HETATM 5287 O O . HOH G 4 . ? -19.402 8.742 -3.378 1.000 45.138 0 518 HOH BBB O 1 ? ? HETATM 5288 O O . HOH G 4 . ? -2.604 -20.275 3.715 1.000 38.812 0 519 HOH BBB O 1 ? ? HETATM 5289 O O . HOH G 4 . ? -13.294 13.557 -30.511 1.000 39.561 0 520 HOH BBB O 1 ? ? HETATM 5290 O O . HOH G 4 . ? -20.009 -29.177 -25.644 1.000 59.080 0 521 HOH BBB O 1 ? ? HETATM 5291 O O . HOH G 4 . ? -28.167 3.551 -12.112 1.000 48.635 0 522 HOH BBB O 1 ? ? HETATM 5292 O O . HOH G 4 . ? -28.228 2.188 -16.917 1.000 55.141 0 523 HOH BBB O 1 ? ? HETATM 5293 O O . HOH G 4 . ? -30.255 -18.860 -16.615 1.000 62.033 0 524 HOH BBB O 1 ? ? HETATM 5294 O O . HOH G 4 . ? -15.754 -9.099 -29.069 1.000 46.547 0 525 HOH BBB O 1 ? ? HETATM 5295 O O . HOH H 4 . ? -5.806 -18.023 -57.466 1.000 59.468 0 901 HOH CCC O 1 ? ? HETATM 5296 O O . HOH I 4 . ? -1.979 9.099 -9.684 1.000 55.815 0 901 HOH DDD O 1 ? ? HETATM 5297 O O . HOH I 4 . ? 2.413 13.419 -16.627 1.000 52.712 0 902 HOH DDD O 1 ? ? # loop_ _atom_site_anisotrop.id _atom_site_anisotrop.type_symbol _atom_site_anisotrop.pdbx_label_atom_id _atom_site_anisotrop.pdbx_label_alt_id _atom_site_anisotrop.pdbx_label_comp_id _atom_site_anisotrop.pdbx_label_asym_id _atom_site_anisotrop.pdbx_label_seq_id _atom_site_anisotrop.pdbx_PDB_ins_code _atom_site_anisotrop.U[1][1] _atom_site_anisotrop.U[2][2] _atom_site_anisotrop.U[3][3] _atom_site_anisotrop.U[1][2] _atom_site_anisotrop.U[1][3] _atom_site_anisotrop.U[2][3] _atom_site_anisotrop.pdbx_auth_seq_id _atom_site_anisotrop.pdbx_auth_comp_id _atom_site_anisotrop.pdbx_auth_asym_id _atom_site_anisotrop.pdbx_auth_atom_id 1 N N . SER A 26 ? 1.358 2.032 1.634 0.486 -0.128 0.094 32 SER AAA N 2 C CA . SER A 26 ? 1.373 1.924 1.598 0.471 -0.112 0.088 32 SER AAA CA 3 C C . SER A 26 ? 1.490 1.944 1.694 0.506 -0.131 0.114 32 SER AAA C 4 O O . SER A 26 ? 1.525 1.941 1.692 0.488 -0.150 0.146 32 SER AAA O 5 C CB . SER A 26 ? 1.352 1.882 1.531 0.408 -0.106 0.089 32 SER AAA CB 6 O OG . SER A 26 ? 1.360 1.926 1.543 0.379 -0.080 0.059 32 SER AAA OG 7 N N . PRO A 27 ? 1.645 2.053 1.866 0.557 -0.125 0.102 33 PRO AAA N 8 C CA . PRO A 27 ? 1.761 2.062 1.957 0.592 -0.142 0.128 33 PRO AAA CA 9 C C . PRO A 27 ? 1.767 1.949 1.900 0.551 -0.134 0.132 33 PRO AAA C 10 O O . PRO A 27 ? 1.835 1.996 1.932 0.517 -0.148 0.161 33 PRO AAA O 11 C CB . PRO A 27 ? 1.828 2.120 2.066 0.657 -0.132 0.104 33 PRO AAA CB 12 C CG . PRO A 27 ? 1.744 2.167 2.038 0.657 -0.113 0.070 33 PRO AAA CG 13 C CD . PRO A 27 ? 1.684 2.140 1.950 0.585 -0.101 0.063 33 PRO AAA CD 14 N N . ALA A 28 ? 1.702 1.813 1.821 0.552 -0.112 0.102 34 ALA AAA N 15 C CA . ALA A 28 ? 1.640 1.651 1.706 0.509 -0.102 0.098 34 ALA AAA CA 16 C C . ALA A 28 ? 1.595 1.596 1.661 0.499 -0.074 0.052 34 ALA AAA C 17 O O . ALA A 28 ? 1.625 1.529 1.661 0.496 -0.066 0.039 34 ALA AAA O 18 C CB . ALA A 28 ? 1.721 1.613 1.754 0.529 -0.116 0.124 34 ALA AAA CB 19 N N . MET A 29 ? 1.516 1.614 1.609 0.489 -0.060 0.030 35 MET AAA N 20 C CA . MET A 29 ? 1.504 1.610 1.595 0.478 -0.034 -0.013 35 MET AAA CA 21 C C . MET A 29 ? 1.471 1.614 1.540 0.421 -0.027 -0.016 35 MET AAA C 22 O O . MET A 29 ? 1.608 1.690 1.639 0.390 -0.022 -0.026 35 MET AAA O 23 C CB . MET A 29 ? 1.492 1.680 1.632 0.517 -0.019 -0.038 35 MET AAA CB 24 C CG . MET A 29 ? 1.491 1.772 1.680 0.545 -0.035 -0.016 35 MET AAA CG 25 S SD . MET A 29 ? 1.513 1.893 1.772 0.601 -0.019 -0.046 35 MET AAA SD 26 C CE . MET A 29 ? 1.582 1.848 1.826 0.646 -0.004 -0.074 35 MET AAA CE 27 N N . ARG A 30 ? 1.352 1.589 1.443 0.407 -0.028 -0.009 36 ARG AAA N 28 C CA . ARG A 30 ? 1.227 1.495 1.297 0.356 -0.026 -0.006 36 ARG AAA CA 29 C C . ARG A 30 ? 1.212 1.439 1.248 0.328 -0.011 -0.030 36 ARG AAA C 30 O O . ARG A 30 ? 1.232 1.439 1.240 0.292 -0.015 -0.022 36 ARG AAA O 31 C CB . ARG A 30 ? 1.170 1.412 1.220 0.335 -0.046 0.026 36 ARG AAA CB 32 C CG . ARG A 30 ? 1.218 1.503 1.293 0.357 -0.066 0.054 36 ARG AAA CG 33 C CD . ARG A 30 ? 1.335 1.548 1.386 0.364 -0.084 0.084 36 ARG AAA CD 34 N NE . ARG A 30 ? 1.403 1.660 1.463 0.372 -0.107 0.115 36 ARG AAA NE 35 C CZ . ARG A 30 ? 1.472 1.680 1.514 0.387 -0.126 0.147 36 ARG AAA CZ 36 N NH1 . ARG A 30 ? 1.456 1.716 1.503 0.392 -0.148 0.175 36 ARG AAA NH1 37 N NH2 . ARG A 30 ? 1.570 1.675 1.583 0.393 -0.125 0.153 36 ARG AAA NH2 38 N N . ARG A 31 ? 1.139 1.357 1.176 0.345 0.007 -0.060 37 ARG AAA N 39 C CA . ARG A 31 ? 1.083 1.272 1.084 0.319 0.021 -0.084 37 ARG AAA CA 40 C C . ARG A 31 ? 0.954 1.217 0.956 0.295 0.032 -0.090 37 ARG AAA C 41 O O . ARG A 31 ? 0.991 1.317 1.022 0.312 0.045 -0.100 37 ARG AAA O 42 C CB . ARG A 31 ? 1.256 1.407 1.251 0.345 0.036 -0.116 37 ARG AAA CB 43 C CG . ARG A 31 ? 1.521 1.612 1.529 0.384 0.029 -0.114 37 ARG AAA CG 44 C CD . ARG A 31 ? 1.632 1.757 1.676 0.432 0.044 -0.134 37 ARG AAA CD 45 N NE . ARG A 31 ? 1.650 1.787 1.681 0.431 0.070 -0.174 37 ARG AAA NE 46 C CZ . ARG A 31 ? 1.753 1.820 1.760 0.445 0.081 -0.204 37 ARG AAA CZ 47 N NH1 . ARG A 31 ? 1.780 1.869 1.770 0.440 0.106 -0.240 37 ARG AAA NH1 48 N NH2 . ARG A 31 ? 1.799 1.773 1.795 0.461 0.069 -0.199 37 ARG AAA NH2 49 N N . LEU A 32 ? 0.857 1.111 0.829 0.258 0.028 -0.083 38 LEU AAA N 50 C CA . LEU A 32 ? 0.799 1.109 0.765 0.231 0.037 -0.082 38 LEU AAA CA 51 C C . LEU A 32 ? 0.821 1.117 0.751 0.217 0.052 -0.104 38 LEU AAA C 52 O O . LEU A 32 ? 0.903 1.144 0.808 0.219 0.049 -0.116 38 LEU AAA O 53 C CB . LEU A 32 ? 0.821 1.126 0.775 0.204 0.022 -0.060 38 LEU AAA CB 54 C CG . LEU A 32 ? 0.833 1.172 0.817 0.208 0.010 -0.038 38 LEU AAA CG 55 C CD1 . LEU A 32 ? 0.763 1.094 0.728 0.178 -0.001 -0.023 38 LEU AAA CD1 56 C CD2 . LEU A 32 ? 0.855 1.272 0.871 0.215 0.018 -0.041 38 LEU AAA CD2 57 N N . THR A 33 ? 0.781 1.126 0.706 0.202 0.067 -0.109 39 THR AAA N 58 C CA . THR A 33 ? 0.742 1.080 0.623 0.181 0.081 -0.123 39 THR AAA CA 59 C C . THR A 33 ? 0.734 1.095 0.598 0.148 0.082 -0.107 39 THR AAA C 60 O O . THR A 33 ? 0.708 1.096 0.599 0.143 0.074 -0.091 39 THR AAA O 61 C CB . THR A 33 ? 0.720 1.092 0.606 0.196 0.107 -0.149 39 THR AAA CB 62 O OG1 . THR A 33 ? 0.707 1.150 0.610 0.182 0.122 -0.147 39 THR AAA OG1 63 C CG2 . THR A 33 ? 0.707 1.075 0.631 0.237 0.108 -0.163 39 THR AAA CG2 64 N N . VAL A 34 ? 0.750 1.095 0.566 0.126 0.090 -0.111 40 VAL AAA N 65 C CA . VAL A 34 ? 0.723 1.073 0.512 0.094 0.093 -0.096 40 VAL AAA CA 66 C C . VAL A 34 ? 0.706 1.125 0.523 0.083 0.112 -0.098 40 VAL AAA C 67 O O . VAL A 34 ? 0.698 1.126 0.509 0.056 0.111 -0.084 40 VAL AAA O 68 C CB . VAL A 34 ? 0.763 1.075 0.488 0.076 0.096 -0.098 40 VAL AAA CB 69 C CG1 . VAL A 34 ? 0.846 1.186 0.553 0.074 0.122 -0.118 40 VAL AAA CG1 70 C CG2 . VAL A 34 ? 0.756 1.048 0.448 0.047 0.092 -0.077 40 VAL AAA CG2 71 N N . ASP A 35 ? 0.730 1.199 0.579 0.102 0.129 -0.116 41 ASP AAA N 72 C CA . ASP A 35 ? 0.791 1.343 0.677 0.094 0.148 -0.122 41 ASP AAA CA 73 C C . ASP A 35 ? 0.794 1.383 0.731 0.099 0.131 -0.107 41 ASP AAA C 74 O O . ASP A 35 ? 0.774 1.434 0.739 0.083 0.142 -0.108 41 ASP AAA O 75 C CB . ASP A 35 ? 0.822 1.421 0.735 0.120 0.170 -0.148 41 ASP AAA CB 76 C CG . ASP A 35 ? 0.923 1.503 0.781 0.106 0.193 -0.165 41 ASP AAA CG 77 O OD1 . ASP A 35 ? 0.864 1.385 0.662 0.081 0.185 -0.154 41 ASP AAA OD1 78 O OD2 . ASP A 35 ? 1.067 1.694 0.943 0.122 0.217 -0.191 41 ASP AAA OD2 79 N N . ASP A 36 ? 0.752 1.296 0.696 0.118 0.106 -0.095 42 ASP AAA N 80 C CA . ASP A 36 ? 0.659 1.229 0.641 0.124 0.087 -0.079 42 ASP AAA CA 81 C C . ASP A 36 ? 0.639 1.186 0.594 0.088 0.078 -0.063 42 ASP AAA C 82 O O . ASP A 36 ? 0.615 1.189 0.594 0.085 0.064 -0.052 42 ASP AAA O 83 C CB . ASP A 36 ? 0.655 1.184 0.652 0.159 0.068 -0.073 42 ASP AAA CB 84 C CG . ASP A 36 ? 0.695 1.246 0.728 0.201 0.075 -0.088 42 ASP AAA CG 85 O OD1 . ASP A 36 ? 0.726 1.354 0.804 0.213 0.080 -0.092 42 ASP AAA OD1 86 O OD2 . ASP A 36 ? 0.732 1.225 0.748 0.220 0.074 -0.097 42 ASP AAA OD2 87 N N . PHE A 37 ? 0.654 1.152 0.558 0.063 0.084 -0.062 43 PHE AAA N 88 C CA . PHE A 37 ? 0.658 1.120 0.530 0.034 0.076 -0.049 43 PHE AAA CA 89 C C . PHE A 37 ? 0.692 1.167 0.536 -0.005 0.095 -0.051 43 PHE AAA C 90 O O . PHE A 37 ? 0.727 1.213 0.554 -0.009 0.114 -0.060 43 PHE AAA O 91 C CB . PHE A 37 ? 0.650 1.035 0.485 0.041 0.064 -0.044 43 PHE AAA CB 92 C CG . PHE A 37 ? 0.612 0.980 0.471 0.068 0.046 -0.041 43 PHE AAA CG 93 C CD1 . PHE A 37 ? 0.637 0.999 0.507 0.094 0.046 -0.050 43 PHE AAA CD1 94 C CD2 . PHE A 37 ? 0.612 0.970 0.479 0.064 0.032 -0.030 43 PHE AAA CD2 95 C CE1 . PHE A 37 ? 0.627 0.966 0.515 0.114 0.031 -0.046 43 PHE AAA CE1 96 C CE2 . PHE A 37 ? 0.598 0.941 0.482 0.084 0.018 -0.025 43 PHE AAA CE2 97 C CZ . PHE A 37 ? 0.605 0.936 0.499 0.107 0.017 -0.032 43 PHE AAA CZ 98 N N . GLU A 38 ? 0.694 1.168 0.531 -0.034 0.092 -0.043 44 GLU AAA N 99 C CA . GLU A 38 ? 0.776 1.226 0.569 -0.076 0.107 -0.040 44 GLU AAA CA 100 C C . GLU A 38 ? 0.801 1.160 0.545 -0.077 0.094 -0.029 44 GLU AAA C 101 O O . GLU A 38 ? 0.751 1.095 0.510 -0.066 0.077 -0.025 44 GLU AAA O 102 C CB . GLU A 38 ? 0.801 1.303 0.613 -0.110 0.112 -0.042 44 GLU AAA CB 103 C CG . GLU A 38 ? 0.849 1.455 0.717 -0.108 0.122 -0.054 44 GLU AAA CG 104 C CD . GLU A 38 ? 0.957 1.627 0.853 -0.140 0.121 -0.057 44 GLU AAA CD 105 O OE1 . GLU A 38 ? 1.080 1.752 0.950 -0.187 0.138 -0.059 44 GLU AAA OE1 106 O OE2 . GLU A 38 ? 0.995 1.712 0.935 -0.120 0.103 -0.056 44 GLU AAA OE2 107 N N . ILE A 39 ? 0.855 1.159 0.545 -0.089 0.101 -0.023 45 ILE AAA N 108 C CA . ILE A 39 ? 0.875 1.094 0.521 -0.082 0.086 -0.012 45 ILE AAA CA 109 C C . ILE A 39 ? 0.900 1.076 0.511 -0.118 0.092 -0.005 45 ILE AAA C 110 O O . ILE A 39 ? 0.911 1.102 0.504 -0.154 0.112 -0.005 45 ILE AAA O 111 C CB . ILE A 39 ? 0.911 1.092 0.516 -0.070 0.085 -0.008 45 ILE AAA CB 112 C CG1 . ILE A 39 ? 0.964 1.184 0.604 -0.039 0.081 -0.020 45 ILE AAA CG1 113 C CG2 . ILE A 39 ? 0.907 1.010 0.472 -0.058 0.067 0.005 45 ILE AAA CG2 114 C CD1 . ILE A 39 ? 1.217 1.432 0.821 -0.038 0.092 -0.024 45 ILE AAA CD1 115 N N . GLY A 40 ? 0.887 1.011 0.489 -0.108 0.077 -0.001 46 GLY AAA N 116 C CA . GLY A 40 ? 0.957 1.036 0.533 -0.136 0.081 0.001 46 GLY AAA CA 117 C C . GLY A 40 ? 1.025 1.006 0.539 -0.134 0.076 0.014 46 GLY AAA C 118 O O . GLY A 40 ? 1.102 1.042 0.568 -0.168 0.090 0.022 46 GLY AAA O 119 N N . ARG A 41 ? 1.043 0.990 0.558 -0.096 0.057 0.018 47 ARG AAA N 120 C CA . ARG A 41 ? 1.167 1.022 0.632 -0.083 0.047 0.030 47 ARG AAA CA 121 C C . ARG A 41 ? 1.141 0.996 0.625 -0.038 0.024 0.032 47 ARG AAA C 122 O O . ARG A 41 ? 1.076 0.984 0.612 -0.019 0.018 0.020 47 ARG AAA O 123 C CB . ARG A 41 ? 1.280 1.088 0.735 -0.097 0.050 0.024 47 ARG AAA CB 124 C CG . ARG A 41 ? 1.386 1.125 0.827 -0.063 0.034 0.027 47 ARG AAA CG 125 C CD . ARG A 41 ? 1.468 1.144 0.885 -0.080 0.041 0.020 47 ARG AAA CD 126 N NE . ARG A 41 ? 1.374 1.103 0.831 -0.097 0.050 -0.001 47 ARG AAA NE 127 C CZ . ARG A 41 ? 1.478 1.166 0.917 -0.120 0.059 -0.014 47 ARG AAA CZ 128 N NH1 . ARG A 41 ? 1.523 1.108 0.906 -0.127 0.062 -0.008 47 ARG AAA NH1 129 N NH2 . ARG A 41 ? 1.561 1.308 1.034 -0.137 0.064 -0.033 47 ARG AAA NH2 130 N N . PRO A 42 ? 1.213 1.011 0.653 -0.020 0.012 0.047 48 PRO AAA N 131 C CA . PRO A 42 ? 1.201 1.000 0.659 0.022 -0.012 0.047 48 PRO AAA CA 132 C C . PRO A 42 ? 1.179 0.969 0.670 0.044 -0.021 0.037 48 PRO AAA C 133 O O . PRO A 42 ? 1.266 0.993 0.729 0.043 -0.019 0.040 48 PRO AAA O 134 C CB . PRO A 42 ? 1.243 0.973 0.637 0.031 -0.025 0.068 48 PRO AAA CB 135 C CG . PRO A 42 ? 1.316 1.025 0.658 -0.010 -0.004 0.079 48 PRO AAA CG 136 C CD . PRO A 42 ? 1.291 1.023 0.660 -0.042 0.018 0.065 48 PRO AAA CD 137 N N . LEU A 43 ? 1.083 0.933 0.631 0.063 -0.028 0.024 49 LEU AAA N 138 C CA . LEU A 43 ? 1.103 0.958 0.686 0.083 -0.033 0.011 49 LEU AAA CA 139 C C . LEU A 43 ? 1.164 1.003 0.751 0.122 -0.055 0.015 49 LEU AAA C 140 O O . LEU A 43 ? 1.379 1.210 0.987 0.142 -0.058 0.005 49 LEU AAA O 141 C CB . LEU A 43 ? 0.982 0.910 0.620 0.079 -0.028 -0.003 49 LEU AAA CB 142 C CG . LEU A 43 ? 0.882 0.832 0.528 0.048 -0.010 -0.010 49 LEU AAA CG 143 C CD1 . LEU A 43 ? 0.828 0.846 0.520 0.048 -0.010 -0.016 49 LEU AAA CD1 144 C CD2 . LEU A 43 ? 0.882 0.795 0.518 0.043 -0.003 -0.019 49 LEU AAA CD2 145 N N . GLY A 44 ? 1.149 0.991 0.719 0.133 -0.070 0.026 50 GLY AAA N 146 C CA . GLY A 44 ? 1.189 1.025 0.763 0.170 -0.096 0.030 50 GLY AAA CA 147 C C . GLY A 44 ? 1.184 1.059 0.759 0.174 -0.112 0.034 50 GLY AAA C 148 O O . GLY A 44 ? 1.038 0.944 0.615 0.151 -0.100 0.029 50 GLY AAA O 149 N N . LYS A 45 ? 1.332 1.208 0.906 0.205 -0.138 0.039 51 LYS AAA N 150 C CA . LYS A 45 ? 1.472 1.380 1.039 0.210 -0.159 0.042 51 LYS AAA CA 151 C C . LYS A 45 ? 1.448 1.425 1.080 0.229 -0.174 0.024 51 LYS AAA C 152 O O . LYS A 45 ? 1.476 1.456 1.134 0.259 -0.187 0.022 51 LYS AAA O 153 C CB . LYS A 45 ? 1.581 1.435 1.084 0.227 -0.181 0.065 51 LYS AAA CB 154 C CG . LYS A 45 ? 1.726 1.498 1.163 0.210 -0.165 0.085 51 LYS AAA CG 155 C CD . LYS A 45 ? 1.836 1.574 1.197 0.194 -0.170 0.105 51 LYS AAA CD 156 C CE . LYS A 45 ? 1.885 1.546 1.183 0.168 -0.148 0.124 51 LYS AAA CE 157 N NZ . LYS A 45 ? 1.898 1.536 1.122 0.144 -0.146 0.141 51 LYS AAA NZ 158 N N . GLY A 46 ? 1.406 1.436 1.066 0.211 -0.170 0.010 52 GLY AAA N 159 C CA . GLY A 46 ? 1.354 1.450 1.068 0.219 -0.185 -0.006 52 GLY AAA CA 160 C C . GLY A 46 ? 1.354 1.465 1.047 0.229 -0.215 -0.003 52 GLY AAA C 161 O O . GLY A 46 ? 1.278 1.344 0.907 0.230 -0.223 0.014 52 GLY AAA O 162 N N . LYS A 47 ? 1.353 1.527 1.092 0.233 -0.232 -0.018 53 LYS AAA N 163 C CA . LYS A 47 ? 1.531 1.735 1.256 0.238 -0.263 -0.020 53 LYS AAA CA 164 C C . LYS A 47 ? 1.593 1.774 1.266 0.210 -0.255 -0.022 53 LYS AAA C 165 O O . LYS A 47 ? 1.575 1.736 1.192 0.214 -0.274 -0.010 53 LYS AAA O 166 C CB . LYS A 47 ? 1.580 1.864 1.373 0.238 -0.276 -0.041 53 LYS AAA CB 167 C CG . LYS A 47 ? 1.571 1.890 1.418 0.270 -0.286 -0.043 53 LYS AAA CG 168 C CD . LYS A 47 ? 1.547 1.959 1.461 0.270 -0.304 -0.063 53 LYS AAA CD 169 C CE . LYS A 47 ? 1.566 2.018 1.521 0.315 -0.325 -0.062 53 LYS AAA CE 170 N NZ . LYS A 47 ? 1.512 2.062 1.550 0.309 -0.327 -0.086 53 LYS AAA NZ 171 N N . PHE A 48 ? 1.585 1.769 1.275 0.184 -0.229 -0.035 54 PHE AAA N 172 C CA . PHE A 48 ? 1.668 1.843 1.326 0.159 -0.219 -0.046 54 PHE AAA CA 173 C C . PHE A 48 ? 1.629 1.752 1.236 0.151 -0.195 -0.033 54 PHE AAA C 174 O O . PHE A 48 ? 1.475 1.583 1.032 0.140 -0.193 -0.035 54 PHE AAA O 175 C CB . PHE A 48 ? 1.551 1.755 1.257 0.139 -0.206 -0.067 54 PHE AAA CB 176 C CG . PHE A 48 ? 1.439 1.697 1.188 0.138 -0.228 -0.082 54 PHE AAA CG 177 C CD1 . PHE A 48 ? 1.232 1.527 1.037 0.150 -0.231 -0.082 54 PHE AAA CD1 178 C CD2 . PHE A 48 ? 1.450 1.728 1.184 0.124 -0.246 -0.098 54 PHE AAA CD2 179 C CE1 . PHE A 48 ? 1.215 1.571 1.065 0.146 -0.250 -0.097 54 PHE AAA CE1 180 C CE2 . PHE A 48 ? 1.361 1.697 1.138 0.118 -0.267 -0.113 54 PHE AAA CE2 181 C CZ . PHE A 48 ? 1.260 1.638 1.098 0.129 -0.269 -0.112 54 PHE AAA CZ 182 N N . GLY A 49 ? 1.561 1.662 1.180 0.155 -0.177 -0.022 55 GLY AAA N 183 C CA . GLY A 49 ? 1.418 1.477 0.994 0.144 -0.155 -0.010 55 GLY AAA CA 184 C C . GLY A 49 ? 1.259 1.300 0.856 0.146 -0.139 -0.001 55 GLY AAA C 185 O O . GLY A 49 ? 1.109 1.173 0.756 0.156 -0.142 -0.007 55 GLY AAA O 186 N N . ASN A 50 ? 1.181 1.186 0.738 0.133 -0.120 0.010 56 ASN AAA N 187 C CA . ASN A 50 ? 1.145 1.122 0.704 0.128 -0.105 0.019 56 ASN AAA CA 188 C C . ASN A 50 ? 0.969 0.979 0.577 0.116 -0.085 0.006 56 ASN AAA C 189 O O . ASN A 50 ? 0.873 0.915 0.499 0.108 -0.078 -0.005 56 ASN AAA O 190 C CB . ASN A 50 ? 1.217 1.148 0.714 0.111 -0.092 0.035 56 ASN AAA CB 191 C CG . ASN A 50 ? 1.364 1.251 0.802 0.123 -0.113 0.053 56 ASN AAA CG 192 O OD1 . ASN A 50 ? 1.428 1.267 0.807 0.108 -0.104 0.070 56 ASN AAA OD1 193 N ND2 . ASN A 50 ? 1.391 1.295 0.841 0.148 -0.141 0.052 56 ASN AAA ND2 194 N N . VAL A 51 ? 0.953 0.951 0.576 0.114 -0.076 0.008 57 VAL AAA N 195 C CA . VAL A 51 ? 0.915 0.941 0.575 0.100 -0.058 -0.000 57 VAL AAA CA 196 C C . VAL A 51 ? 0.894 0.894 0.526 0.079 -0.040 0.006 57 VAL AAA C 197 O O . VAL A 51 ? 0.898 0.851 0.502 0.081 -0.042 0.014 57 VAL AAA O 198 C CB . VAL A 51 ? 0.892 0.939 0.596 0.112 -0.062 -0.009 57 VAL AAA CB 199 C CG1 . VAL A 51 ? 0.891 0.980 0.633 0.118 -0.071 -0.018 57 VAL AAA CG1 200 C CG2 . VAL A 51 ? 0.999 1.015 0.695 0.131 -0.073 -0.006 57 VAL AAA CG2 201 N N . TYR A 52 ? 0.857 0.885 0.497 0.060 -0.024 0.003 58 TYR AAA N 202 C CA . TYR A 52 ? 0.925 0.945 0.545 0.034 -0.006 0.007 58 TYR AAA CA 203 C C . TYR A 52 ? 0.913 0.973 0.574 0.024 0.002 -0.001 58 TYR AAA C 204 O O . TYR A 52 ? 0.911 1.015 0.610 0.032 0.001 -0.007 58 TYR AAA O 205 C CB . TYR A 52 ? 1.000 1.035 0.598 0.020 0.006 0.008 58 TYR AAA CB 206 C CG . TYR A 52 ? 1.105 1.103 0.652 0.024 -0.000 0.017 58 TYR AAA CG 207 C CD1 . TYR A 52 ? 1.083 1.088 0.632 0.045 -0.016 0.013 58 TYR AAA CD1 208 C CD2 . TYR A 52 ? 1.163 1.116 0.654 0.003 0.008 0.030 58 TYR AAA CD2 209 C CE1 . TYR A 52 ? 1.204 1.180 0.702 0.048 -0.025 0.021 58 TYR AAA CE1 210 C CE2 . TYR A 52 ? 1.246 1.163 0.682 0.006 0.001 0.042 58 TYR AAA CE2 211 C CZ . TYR A 52 ? 1.284 1.214 0.723 0.029 -0.017 0.038 58 TYR AAA CZ 212 O OH . TYR A 52 ? 1.368 1.267 0.748 0.032 -0.027 0.049 58 TYR AAA OH 213 N N . LEU A 53 ? 0.823 0.862 0.472 0.007 0.010 -0.001 59 LEU AAA N 214 C CA . LEU A 53 ? 0.749 0.830 0.425 -0.012 0.019 -0.008 59 LEU AAA CA 215 C C . LEU A 53 ? 0.756 0.883 0.440 -0.027 0.030 -0.008 59 LEU AAA C 216 O O . LEU A 53 ? 0.795 0.903 0.445 -0.043 0.040 -0.004 59 LEU AAA O 217 C CB . LEU A 53 ? 0.786 0.827 0.435 -0.034 0.026 -0.010 59 LEU AAA CB 218 C CG . LEU A 53 ? 0.780 0.866 0.452 -0.058 0.033 -0.019 59 LEU AAA CG 219 C CD1 . LEU A 53 ? 0.755 0.868 0.459 -0.040 0.024 -0.025 59 LEU AAA CD1 220 C CD2 . LEU A 53 ? 0.840 0.884 0.477 -0.089 0.043 -0.024 59 LEU AAA CD2 221 N N . ALA A 54 ? 0.734 0.919 0.461 -0.020 0.029 -0.013 60 ALA AAA N 222 C CA . ALA A 54 ? 0.745 0.986 0.493 -0.025 0.039 -0.015 60 ALA AAA CA 223 C C . ALA A 54 ? 0.716 1.013 0.506 -0.026 0.035 -0.017 60 ALA AAA C 224 O O . ALA A 54 ? 0.769 1.056 0.566 -0.020 0.024 -0.016 60 ALA AAA O 225 C CB . ALA A 54 ? 0.738 0.982 0.492 -0.001 0.037 -0.017 60 ALA AAA CB 226 N N . ARG A 55 ? 0.657 1.014 0.472 -0.032 0.042 -0.021 61 ARG AAA N 227 C CA . ARG A 55 ? 0.630 1.048 0.486 -0.027 0.035 -0.020 61 ARG AAA CA 228 C C . ARG A 55 ? 0.607 1.081 0.499 -0.006 0.039 -0.023 61 ARG AAA C 229 O O . ARG A 55 ? 0.682 1.166 0.566 -0.014 0.055 -0.030 61 ARG AAA O 230 C CB . ARG A 55 ? 0.682 1.129 0.535 -0.062 0.038 -0.023 61 ARG AAA CB 231 C CG . ARG A 55 ? 0.691 1.174 0.542 -0.091 0.056 -0.030 61 ARG AAA CG 232 C CD . ARG A 55 ? 0.701 1.218 0.553 -0.130 0.057 -0.035 61 ARG AAA CD 233 N NE . ARG A 55 ? 0.737 1.304 0.595 -0.162 0.074 -0.043 61 ARG AAA NE 234 C CZ . ARG A 55 ? 0.743 1.366 0.614 -0.199 0.076 -0.050 61 ARG AAA CZ 235 N NH1 . ARG A 55 ? 0.731 1.362 0.604 -0.208 0.061 -0.052 61 ARG AAA NH1 236 N NH2 . ARG A 55 ? 0.774 1.448 0.654 -0.230 0.094 -0.058 61 ARG AAA NH2 237 N N . LEU A 56 ? 0.547 1.050 0.474 0.019 0.026 -0.018 62 LEU AAA N 238 C CA . LEU A 56 ? 0.536 1.092 0.503 0.046 0.028 -0.021 62 LEU AAA CA 239 C C . LEU A 56 ? 0.559 1.196 0.551 0.026 0.038 -0.029 62 LEU AAA C 240 O O . LEU A 56 ? 0.563 1.226 0.555 -0.000 0.032 -0.026 62 LEU AAA O 241 C CB . LEU A 56 ? 0.486 1.047 0.477 0.074 0.008 -0.010 62 LEU AAA CB 242 C CG . LEU A 56 ? 0.476 0.968 0.451 0.095 0.002 -0.005 62 LEU AAA CG 243 C CD1 . LEU A 56 ? 0.496 0.976 0.475 0.102 -0.016 0.011 62 LEU AAA CD1 244 C CD2 . LEU A 56 ? 0.491 0.976 0.480 0.125 0.008 -0.014 62 LEU AAA CD2 245 N N . LYS A 57 ? 0.590 1.266 0.601 0.034 0.054 -0.040 63 LYS AAA N 246 C CA . LYS A 57 ? 0.648 1.412 0.687 0.012 0.068 -0.050 63 LYS AAA CA 247 C C . LYS A 57 ? 0.610 1.452 0.700 0.025 0.050 -0.045 63 LYS AAA C 248 O O . LYS A 57 ? 0.574 1.470 0.673 -0.010 0.049 -0.047 63 LYS AAA O 249 C CB . LYS A 57 ? 0.707 1.506 0.765 0.029 0.090 -0.066 63 LYS AAA CB 250 C CG . LYS A 57 ? 0.815 1.562 0.819 0.005 0.112 -0.072 63 LYS AAA CG 251 C CD . LYS A 57 ? 0.909 1.699 0.928 0.018 0.137 -0.090 63 LYS AAA CD 252 C CE . LYS A 57 ? 0.965 1.702 0.922 -0.009 0.157 -0.094 63 LYS AAA CE 253 N NZ . LYS A 57 ? 1.024 1.801 0.992 0.008 0.182 -0.115 63 LYS AAA NZ 254 N N . GLU A 58 ? 0.606 1.448 0.724 0.072 0.034 -0.037 64 GLU AAA N 255 C CA . GLU A 58 ? 0.630 1.547 0.799 0.097 0.013 -0.029 64 GLU AAA CA 256 C C . GLU A 58 ? 0.590 1.501 0.741 0.075 -0.009 -0.014 64 GLU AAA C 257 O O . GLU A 58 ? 0.545 1.538 0.721 0.055 -0.017 -0.015 64 GLU AAA O 258 C CB . GLU A 58 ? 0.707 1.597 0.896 0.154 0.004 -0.023 64 GLU AAA CB 259 C CG . GLU A 58 ? 0.777 1.746 1.023 0.192 -0.016 -0.015 64 GLU AAA CG 260 C CD . GLU A 58 ? 0.853 1.802 1.126 0.251 -0.017 -0.017 64 GLU AAA CD 261 O OE1 . GLU A 58 ? 0.824 1.682 1.063 0.261 -0.007 -0.021 64 GLU AAA OE1 262 O OE2 . GLU A 58 ? 0.881 1.905 1.208 0.289 -0.027 -0.015 64 GLU AAA OE2 263 N N . SER A 59 ? 0.578 1.401 0.687 0.076 -0.018 -0.002 65 SER AAA N 264 C CA . SER A 59 ? 0.534 1.345 0.623 0.061 -0.038 0.013 65 SER AAA CA 265 C C . SER A 59 ? 0.510 1.295 0.559 0.011 -0.028 0.003 65 SER AAA C 266 O O . SER A 59 ? 0.541 1.340 0.577 -0.009 -0.041 0.008 65 SER AAA O 267 C CB . SER A 59 ? 0.556 1.292 0.624 0.087 -0.049 0.028 65 SER AAA CB 268 O OG . SER A 59 ? 0.562 1.221 0.587 0.068 -0.038 0.023 65 SER AAA OG 269 N N . HIS A 60 ? 0.494 1.237 0.519 -0.007 -0.006 -0.009 66 HIS AAA N 270 C CA . HIS A 60 ? 0.498 1.193 0.478 -0.049 0.004 -0.016 66 HIS AAA CA 271 C C . HIS A 60 ? 0.510 1.131 0.455 -0.045 -0.004 -0.010 66 HIS AAA C 272 O O . HIS A 60 ? 0.524 1.115 0.437 -0.076 -0.001 -0.016 66 HIS AAA O 273 C CB . HIS A 60 ? 0.479 1.235 0.463 -0.091 0.004 -0.025 66 HIS AAA CB 274 C CG . HIS A 60 ? 0.463 1.275 0.467 -0.114 0.022 -0.037 66 HIS AAA CG 275 N ND1 . HIS A 60 ? 0.460 1.356 0.486 -0.148 0.020 -0.045 66 HIS AAA ND1 276 C CD2 . HIS A 60 ? 0.475 1.278 0.477 -0.112 0.043 -0.043 66 HIS AAA CD2 277 C CE1 . HIS A 60 ? 0.479 1.416 0.520 -0.167 0.041 -0.056 66 HIS AAA CE1 278 N NE2 . HIS A 60 ? 0.497 1.376 0.521 -0.145 0.056 -0.054 66 HIS AAA NE2 279 N N . PHE A 61 ? 0.498 1.087 0.449 -0.011 -0.012 0.001 67 PHE AAA N 280 C CA . PHE A 61 ? 0.553 1.082 0.477 -0.006 -0.018 0.006 67 PHE AAA CA 281 C C . PHE A 61 ? 0.576 1.038 0.471 -0.010 -0.006 -0.002 67 PHE AAA C 282 O O . PHE A 61 ? 0.699 1.140 0.598 0.010 -0.002 -0.002 67 PHE AAA O 283 C CB . PHE A 61 ? 0.605 1.127 0.545 0.027 -0.031 0.021 67 PHE AAA CB 284 C CG . PHE A 61 ? 0.642 1.115 0.559 0.027 -0.036 0.027 67 PHE AAA CG 285 C CD1 . PHE A 61 ? 0.622 1.108 0.526 0.012 -0.044 0.033 67 PHE AAA CD1 286 C CD2 . PHE A 61 ? 0.681 1.100 0.589 0.039 -0.031 0.024 67 PHE AAA CD2 287 C CE1 . PHE A 61 ? 0.630 1.078 0.514 0.010 -0.044 0.036 67 PHE AAA CE1 288 C CE2 . PHE A 61 ? 0.667 1.053 0.561 0.037 -0.033 0.028 67 PHE AAA CE2 289 C CZ . PHE A 61 ? 0.643 1.043 0.525 0.022 -0.038 0.034 67 PHE AAA CZ 290 N N . ILE A 62 ? 0.575 1.001 0.440 -0.033 -0.001 -0.008 68 ILE AAA N 291 C CA . ILE A 62 ? 0.557 0.918 0.393 -0.033 0.007 -0.014 68 ILE AAA CA 292 C C . ILE A 62 ? 0.553 0.882 0.393 -0.007 -0.000 -0.009 68 ILE AAA C 293 O O . ILE A 62 ? 0.598 0.933 0.444 -0.003 -0.007 -0.005 68 ILE AAA O 294 C CB . ILE A 62 ? 0.600 0.929 0.405 -0.059 0.012 -0.023 68 ILE AAA CB 295 C CG1 . ILE A 62 ? 0.655 0.996 0.447 -0.092 0.022 -0.030 68 ILE AAA CG1 296 C CG2 . ILE A 62 ? 0.585 0.848 0.368 -0.047 0.014 -0.026 68 ILE AAA CG2 297 C CD1 . ILE A 62 ? 0.650 1.046 0.452 -0.118 0.019 -0.035 68 ILE AAA CD1 298 N N . VAL A 63 ? 0.556 0.855 0.390 0.007 0.002 -0.010 69 VAL AAA N 299 C CA . VAL A 63 ? 0.504 0.772 0.339 0.027 -0.004 -0.009 69 VAL AAA CA 300 C C . VAL A 63 ? 0.511 0.734 0.319 0.028 -0.002 -0.014 69 VAL AAA C 301 O O . VAL A 63 ? 0.506 0.714 0.290 0.014 0.006 -0.015 69 VAL AAA O 302 C CB . VAL A 63 ? 0.478 0.758 0.332 0.046 -0.007 -0.006 69 VAL AAA CB 303 C CG1 . VAL A 63 ? 0.429 0.746 0.307 0.051 -0.013 0.002 69 VAL AAA CG1 304 C CG2 . VAL A 63 ? 0.546 0.827 0.391 0.047 0.001 -0.011 69 VAL AAA CG2 305 N N . ALA A 64 ? 0.573 0.775 0.383 0.043 -0.010 -0.015 70 ALA AAA N 306 C CA . ALA A 64 ? 0.639 0.804 0.428 0.052 -0.014 -0.017 70 ALA AAA CA 307 C C . ALA A 64 ? 0.608 0.776 0.400 0.064 -0.019 -0.017 70 ALA AAA C 308 O O . ALA A 64 ? 0.595 0.774 0.409 0.073 -0.026 -0.020 70 ALA AAA O 309 C CB . ALA A 64 ? 0.646 0.798 0.440 0.062 -0.020 -0.021 70 ALA AAA CB 310 N N . LEU A 65 ? 0.638 0.795 0.405 0.061 -0.014 -0.016 71 LEU AAA N 311 C CA . LEU A 65 ? 0.668 0.828 0.431 0.070 -0.016 -0.021 71 LEU AAA CA 312 C C . LEU A 65 ? 0.668 0.798 0.407 0.079 -0.029 -0.021 71 LEU AAA C 313 O O . LEU A 65 ? 0.684 0.787 0.389 0.075 -0.029 -0.015 71 LEU AAA O 314 C CB . LEU A 65 ? 0.709 0.880 0.456 0.059 -0.001 -0.022 71 LEU AAA CB 315 C CG . LEU A 65 ? 0.777 0.963 0.529 0.069 0.004 -0.031 71 LEU AAA CG 316 C CD1 . LEU A 65 ? 0.793 0.992 0.582 0.083 -0.003 -0.035 71 LEU AAA CD1 317 C CD2 . LEU A 65 ? 0.852 1.069 0.603 0.059 0.023 -0.034 71 LEU AAA CD2 318 N N . LYS A 66 ? 0.655 0.791 0.410 0.089 -0.040 -0.028 72 LYS AAA N 319 C CA . LYS A 66 ? 0.712 0.834 0.450 0.098 -0.056 -0.030 72 LYS AAA CA 320 C C . LYS A 66 ? 0.736 0.856 0.453 0.097 -0.057 -0.039 72 LYS AAA C 321 O O . LYS A 66 ? 0.711 0.842 0.449 0.097 -0.054 -0.049 72 LYS AAA O 322 C CB . LYS A 66 ? 0.715 0.853 0.487 0.104 -0.069 -0.035 72 LYS AAA CB 323 C CG . LYS A 66 ? 0.773 0.907 0.533 0.116 -0.089 -0.037 72 LYS AAA CG 324 C CD . LYS A 66 ? 0.835 0.996 0.635 0.122 -0.099 -0.042 72 LYS AAA CD 325 C CE . LYS A 66 ? 0.932 1.105 0.731 0.134 -0.122 -0.046 72 LYS AAA CE 326 N NZ . LYS A 66 ? 0.932 1.141 0.775 0.142 -0.130 -0.053 72 LYS AAA NZ 327 N N . VAL A 67 ? 0.762 0.862 0.434 0.096 -0.060 -0.034 73 VAL AAA N 328 C CA . VAL A 67 ? 0.807 0.903 0.444 0.093 -0.059 -0.043 73 VAL AAA CA 329 C C . VAL A 67 ? 0.802 0.895 0.427 0.101 -0.084 -0.047 73 VAL AAA C 330 O O . VAL A 67 ? 0.819 0.896 0.417 0.107 -0.099 -0.035 73 VAL AAA O 331 C CB . VAL A 67 ? 0.879 0.956 0.466 0.083 -0.047 -0.032 73 VAL AAA CB 332 C CG1 . VAL A 67 ? 0.952 1.029 0.498 0.078 -0.041 -0.043 73 VAL AAA CG1 333 C CG2 . VAL A 67 ? 0.884 0.973 0.487 0.072 -0.024 -0.028 73 VAL AAA CG2 334 N N . LEU A 68 ? 0.797 0.903 0.441 0.100 -0.089 -0.065 74 LEU AAA N 335 C CA . LEU A 68 ? 0.850 0.964 0.483 0.101 -0.113 -0.074 74 LEU AAA CA 336 C C . LEU A 68 ? 0.894 0.996 0.473 0.095 -0.112 -0.084 74 LEU AAA C 337 O O . LEU A 68 ? 0.929 1.026 0.502 0.089 -0.090 -0.096 74 LEU AAA O 338 C CB . LEU A 68 ? 0.813 0.942 0.490 0.096 -0.115 -0.091 74 LEU AAA CB 339 C CG . LEU A 68 ? 0.730 0.875 0.459 0.098 -0.114 -0.083 74 LEU AAA CG 340 C CD1 . LEU A 68 ? 0.737 0.887 0.498 0.087 -0.111 -0.097 74 LEU AAA CD1 341 C CD2 . LEU A 68 ? 0.720 0.884 0.461 0.107 -0.134 -0.076 74 LEU AAA CD2 342 N N . PHE A 69 ? 0.929 1.030 0.470 0.097 -0.135 -0.081 75 PHE AAA N 343 C CA . PHE A 69 ? 0.991 1.087 0.476 0.087 -0.139 -0.094 75 PHE AAA CA 344 C C . PHE A 69 ? 0.971 1.082 0.478 0.079 -0.149 -0.122 75 PHE AAA C 345 O O . PHE A 69 ? 0.916 1.050 0.454 0.081 -0.173 -0.123 75 PHE AAA O 346 C CB . PHE A 69 ? 1.077 1.166 0.509 0.093 -0.165 -0.077 75 PHE AAA CB 347 C CG . PHE A 69 ? 1.151 1.212 0.555 0.100 -0.160 -0.047 75 PHE AAA CG 348 C CD1 . PHE A 69 ? 1.175 1.218 0.565 0.089 -0.128 -0.041 75 PHE AAA CD1 349 C CD2 . PHE A 69 ? 1.237 1.289 0.627 0.116 -0.188 -0.025 75 PHE AAA CD2 350 C CE1 . PHE A 69 ? 1.217 1.229 0.578 0.089 -0.123 -0.015 75 PHE AAA CE1 351 C CE2 . PHE A 69 ? 1.266 1.278 0.625 0.122 -0.183 0.003 75 PHE AAA CE2 352 C CZ . PHE A 69 ? 1.243 1.232 0.585 0.105 -0.150 0.008 75 PHE AAA CZ 353 N N . LYS A 70 ? 1.012 1.111 0.505 0.070 -0.129 -0.146 76 LYS AAA N 354 C CA . LYS A 70 ? 1.053 1.153 0.561 0.058 -0.134 -0.176 76 LYS AAA CA 355 C C . LYS A 70 ? 1.167 1.286 0.649 0.049 -0.168 -0.183 76 LYS AAA C 356 O O . LYS A 70 ? 1.235 1.372 0.755 0.040 -0.184 -0.195 76 LYS AAA O 357 C CB . LYS A 70 ? 1.094 1.171 0.575 0.054 -0.108 -0.202 76 LYS AAA CB 358 C CG . LYS A 70 ? 1.093 1.156 0.616 0.064 -0.080 -0.202 76 LYS AAA CG 359 C CD . LYS A 70 ? 1.154 1.195 0.659 0.066 -0.055 -0.232 76 LYS AAA CD 360 C CE . LYS A 70 ? 1.114 1.139 0.671 0.079 -0.038 -0.235 76 LYS AAA CE 361 N NZ . LYS A 70 ? 1.149 1.153 0.692 0.089 -0.012 -0.263 76 LYS AAA NZ 362 N N . SER A 71 ? 1.203 1.323 0.624 0.050 -0.179 -0.175 77 SER AAA N 363 C CA . SER A 71 ? 1.233 1.375 0.616 0.044 -0.215 -0.179 77 SER AAA CA 364 C C . SER A 71 ? 1.177 1.357 0.609 0.054 -0.247 -0.164 77 SER AAA C 365 O O . SER A 71 ? 1.137 1.350 0.569 0.045 -0.277 -0.177 77 SER AAA O 366 C CB . SER A 71 ? 1.319 1.447 0.623 0.046 -0.219 -0.163 77 SER AAA CB 367 O OG . SER A 71 ? 1.279 1.400 0.585 0.065 -0.223 -0.125 77 SER AAA OG 368 N N . GLN A 72 ? 1.197 1.375 0.670 0.072 -0.240 -0.139 78 GLN AAA N 369 C CA . GLN A 72 ? 1.176 1.392 0.700 0.088 -0.266 -0.125 78 GLN AAA CA 370 C C . GLN A 72 ? 1.075 1.322 0.667 0.074 -0.264 -0.145 78 GLN AAA C 371 O O . GLN A 72 ? 1.050 1.346 0.675 0.075 -0.292 -0.150 78 GLN AAA O 372 C CB . GLN A 72 ? 1.200 1.395 0.735 0.110 -0.255 -0.095 78 GLN AAA CB 373 C CG . GLN A 72 ? 1.356 1.526 0.827 0.125 -0.269 -0.069 78 GLN AAA CG 374 C CD . GLN A 72 ? 1.540 1.743 0.997 0.138 -0.313 -0.064 78 GLN AAA CD 375 O OE1 . GLN A 72 ? 1.715 1.903 1.103 0.139 -0.330 -0.053 78 GLN AAA OE1 376 N NE2 . GLN A 72 ? 1.621 1.874 1.145 0.148 -0.332 -0.071 78 GLN AAA NE2 377 N N . ILE A 73 ? 1.052 1.273 0.665 0.062 -0.234 -0.157 79 ILE AAA N 378 C CA . ILE A 73 ? 1.081 1.321 0.754 0.045 -0.230 -0.172 79 ILE AAA CA 379 C C . ILE A 73 ? 1.109 1.358 0.767 0.018 -0.243 -0.203 79 ILE AAA C 380 O O . ILE A 73 ? 1.100 1.386 0.802 0.001 -0.256 -0.215 79 ILE AAA O 381 C CB . ILE A 73 ? 1.057 1.263 0.756 0.045 -0.196 -0.167 79 ILE AAA CB 382 C CG1 . ILE A 73 ? 1.089 1.255 0.772 0.029 -0.177 -0.188 79 ILE AAA CG1 383 C CG2 . ILE A 73 ? 1.041 1.229 0.729 0.067 -0.182 -0.141 79 ILE AAA CG2 384 C CD1 . ILE A 73 ? 1.077 1.242 0.797 0.006 -0.176 -0.204 79 ILE AAA CD1 385 N N . GLU A 74 ? 1.131 1.350 0.728 0.012 -0.241 -0.217 80 GLU AAA N 386 C CA . GLU A 74 ? 1.186 1.410 0.753 -0.015 -0.255 -0.249 80 GLU AAA CA 387 C C . GLU A 74 ? 1.115 1.402 0.685 -0.017 -0.297 -0.249 80 GLU AAA C 388 O O . GLU A 74 ? 1.063 1.384 0.660 -0.043 -0.313 -0.271 80 GLU AAA O 389 C CB . GLU A 74 ? 1.284 1.466 0.779 -0.016 -0.241 -0.263 80 GLU AAA CB 390 C CG . GLU A 74 ? 1.334 1.461 0.832 -0.019 -0.204 -0.279 80 GLU AAA CG 391 C CD . GLU A 74 ? 1.349 1.442 0.784 -0.013 -0.182 -0.291 80 GLU AAA CD 392 O OE1 . GLU A 74 ? 1.365 1.468 0.761 -0.001 -0.184 -0.272 80 GLU AAA OE1 393 O OE2 . GLU A 74 ? 1.333 1.386 0.759 -0.021 -0.161 -0.320 80 GLU AAA OE2 394 N N . LYS A 75 ? 1.109 1.410 0.651 0.009 -0.315 -0.223 81 LYS AAA N 395 C CA . LYS A 75 ? 1.144 1.506 0.685 0.017 -0.359 -0.215 81 LYS AAA CA 396 C C . LYS A 75 ? 1.067 1.491 0.692 0.014 -0.373 -0.220 81 LYS AAA C 397 O O . LYS A 75 ? 1.057 1.539 0.697 -0.004 -0.403 -0.238 81 LYS AAA O 398 C CB . LYS A 75 ? 1.218 1.568 0.725 0.052 -0.368 -0.178 81 LYS AAA CB 399 C CG . LYS A 75 ? 1.352 1.750 0.836 0.067 -0.416 -0.167 81 LYS AAA CG 400 C CD . LYS A 75 ? 1.474 1.836 0.896 0.095 -0.424 -0.131 81 LYS AAA CD 401 C CE . LYS A 75 ? 1.594 2.001 0.997 0.117 -0.476 -0.115 81 LYS AAA CE 402 N NZ . LYS A 75 ? 1.683 2.050 1.047 0.153 -0.484 -0.072 81 LYS AAA NZ 403 N N . GLU A 76 ? 1.051 1.469 0.730 0.027 -0.350 -0.205 82 GLU AAA N 404 C CA . GLU A 76 ? 1.017 1.497 0.776 0.029 -0.358 -0.204 82 GLU AAA CA 405 C C . GLU A 76 ? 0.990 1.479 0.787 -0.012 -0.344 -0.232 82 GLU AAA C 406 O O . GLU A 76 ? 0.944 1.494 0.808 -0.020 -0.350 -0.237 82 GLU AAA O 407 C CB . GLU A 76 ? 1.007 1.470 0.795 0.059 -0.338 -0.177 82 GLU AAA CB 408 C CG . GLU A 76 ? 1.056 1.504 0.809 0.099 -0.353 -0.149 82 GLU AAA CG 409 C CD . GLU A 76 ? 1.206 1.714 0.962 0.119 -0.398 -0.144 82 GLU AAA CD 410 O OE1 . GLU A 76 ? 1.362 1.851 1.051 0.125 -0.418 -0.136 82 GLU AAA OE1 411 O OE2 . GLU A 76 ? 1.235 1.812 1.058 0.128 -0.413 -0.149 82 GLU AAA OE2 412 N N . GLY A 77 ? 1.022 1.450 0.779 -0.037 -0.324 -0.250 83 GLY AAA N 413 C CA . GLY A 77 ? 1.042 1.457 0.821 -0.079 -0.310 -0.276 83 GLY AAA CA 414 C C . GLY A 77 ? 1.013 1.413 0.842 -0.080 -0.282 -0.263 83 GLY AAA C 415 O O . GLY A 77 ? 0.995 1.422 0.867 -0.112 -0.280 -0.277 83 GLY AAA O 416 N N . LEU A 78 ? 0.971 1.331 0.793 -0.050 -0.260 -0.239 84 LEU AAA N 417 C CA . LEU A 78 ? 0.893 1.240 0.756 -0.048 -0.234 -0.223 84 LEU AAA CA 418 C C . LEU A 78 ? 0.897 1.163 0.731 -0.053 -0.205 -0.223 84 LEU AAA C 419 O O . LEU A 78 ? 0.870 1.115 0.716 -0.037 -0.185 -0.203 84 LEU AAA O 420 C CB . LEU A 78 ? 0.850 1.216 0.725 -0.010 -0.234 -0.195 84 LEU AAA CB 421 C CG . LEU A 78 ? 0.860 1.300 0.765 0.007 -0.262 -0.192 84 LEU AAA CG 422 C CD1 . LEU A 78 ? 0.781 1.223 0.699 0.044 -0.256 -0.167 84 LEU AAA CD1 423 C CD2 . LEU A 78 ? 0.893 1.402 0.857 -0.020 -0.270 -0.209 84 LEU AAA CD2 424 N N . GLU A 79 ? 0.971 1.195 0.771 -0.074 -0.204 -0.247 85 GLU AAA N 425 C CA . GLU A 79 ? 1.030 1.175 0.805 -0.074 -0.177 -0.250 85 GLU AAA CA 426 C C . GLU A 79 ? 1.002 1.128 0.815 -0.092 -0.161 -0.242 85 GLU AAA C 427 O O . GLU A 79 ? 1.004 1.094 0.819 -0.073 -0.141 -0.223 85 GLU AAA O 428 C CB . GLU A 79 ? 1.171 1.275 0.901 -0.091 -0.179 -0.283 85 GLU AAA CB 429 C CG . GLU A 79 ? 1.242 1.353 0.923 -0.073 -0.188 -0.289 85 GLU AAA CG 430 C CD . GLU A 79 ? 1.327 1.501 1.000 -0.085 -0.222 -0.298 85 GLU AAA CD 431 O OE1 . GLU A 79 ? 1.351 1.516 0.977 -0.098 -0.232 -0.324 85 GLU AAA OE1 432 O OE2 . GLU A 79 ? 1.331 1.565 1.044 -0.079 -0.238 -0.281 85 GLU AAA OE2 433 N N . HIS A 80 ? 1.001 1.153 0.839 -0.128 -0.170 -0.256 86 HIS AAA N 434 C CA . HIS A 80 ? 0.978 1.113 0.845 -0.156 -0.156 -0.249 86 HIS AAA CA 435 C C . HIS A 80 ? 0.901 1.077 0.805 -0.136 -0.148 -0.219 86 HIS AAA C 436 O O . HIS A 80 ? 0.906 1.038 0.810 -0.132 -0.128 -0.200 86 HIS AAA O 437 C CB . HIS A 80 ? 1.018 1.192 0.906 -0.204 -0.169 -0.272 86 HIS AAA CB 438 C CG . HIS A 80 ? 1.078 1.192 0.928 -0.235 -0.171 -0.303 86 HIS AAA CG 439 N ND1 . HIS A 80 ? 1.127 1.245 0.989 -0.289 -0.174 -0.323 86 HIS AAA ND1 440 C CD2 . HIS A 80 ? 1.097 1.145 0.897 -0.222 -0.167 -0.319 86 HIS AAA CD2 441 C CE1 . HIS A 80 ? 1.205 1.255 1.023 -0.308 -0.174 -0.351 86 HIS AAA CE1 442 N NE2 . HIS A 80 ? 1.198 1.205 0.978 -0.265 -0.169 -0.350 86 HIS AAA NE2 443 N N . GLN A 81 ? 0.843 1.097 0.774 -0.123 -0.163 -0.215 87 GLN AAA N 444 C CA . GLN A 81 ? 0.793 1.091 0.759 -0.103 -0.156 -0.193 87 GLN AAA CA 445 C C . GLN A 81 ? 0.758 1.003 0.702 -0.074 -0.138 -0.171 87 GLN AAA C 446 O O . GLN A 81 ? 0.709 0.948 0.669 -0.077 -0.122 -0.154 87 GLN AAA O 447 C CB . GLN A 81 ? 0.771 1.142 0.757 -0.080 -0.178 -0.194 87 GLN AAA CB 448 C CG . GLN A 81 ? 0.810 1.262 0.840 -0.105 -0.196 -0.212 87 GLN AAA CG 449 C CD . GLN A 81 ? 0.886 1.345 0.895 -0.126 -0.218 -0.237 87 GLN AAA CD 450 O OE1 . GLN A 81 ? 1.008 1.402 0.966 -0.125 -0.218 -0.244 87 GLN AAA OE1 451 N NE2 . GLN A 81 ? 0.814 1.356 0.862 -0.145 -0.239 -0.254 87 GLN AAA NE2 452 N N . LEU A 82 ? 0.793 1.006 0.700 -0.050 -0.141 -0.171 88 LEU AAA N 453 C CA . LEU A 82 ? 0.833 1.005 0.720 -0.023 -0.125 -0.153 88 LEU AAA CA 454 C C . LEU A 82 ? 0.885 0.999 0.766 -0.033 -0.107 -0.148 88 LEU AAA C 455 O O . LEU A 82 ? 0.876 0.982 0.765 -0.022 -0.095 -0.128 88 LEU AAA O 456 C CB . LEU A 82 ? 0.866 1.021 0.714 -0.002 -0.130 -0.159 88 LEU AAA CB 457 C CG . LEU A 82 ? 0.857 0.985 0.689 0.023 -0.114 -0.143 88 LEU AAA CG 458 C CD1 . LEU A 82 ? 0.821 0.977 0.676 0.035 -0.109 -0.121 88 LEU AAA CD1 459 C CD2 . LEU A 82 ? 0.844 0.965 0.635 0.037 -0.117 -0.150 88 LEU AAA CD2 460 N N . ARG A 83 ? 0.952 1.024 0.817 -0.054 -0.108 -0.167 89 ARG AAA N 461 C CA . ARG A 83 ? 1.067 1.070 0.922 -0.064 -0.093 -0.163 89 ARG AAA CA 462 C C . ARG A 83 ? 1.023 1.041 0.906 -0.081 -0.086 -0.141 89 ARG AAA C 463 O O . ARG A 83 ? 0.981 0.963 0.859 -0.069 -0.074 -0.120 89 ARG AAA O 464 C CB . ARG A 83 ? 1.235 1.193 1.070 -0.092 -0.097 -0.190 89 ARG AAA CB 465 C CG . ARG A 83 ? 1.383 1.253 1.201 -0.098 -0.083 -0.186 89 ARG AAA CG 466 C CD . ARG A 83 ? 1.565 1.391 1.371 -0.142 -0.085 -0.209 89 ARG AAA CD 467 N NE . ARG A 83 ? 1.699 1.594 1.529 -0.180 -0.098 -0.221 89 ARG AAA NE 468 C CZ . ARG A 83 ? 1.702 1.625 1.560 -0.213 -0.095 -0.209 89 ARG AAA CZ 469 N NH1 . ARG A 83 ? 1.733 1.615 1.590 -0.215 -0.080 -0.182 89 ARG AAA NH1 470 N NH2 . ARG A 83 ? 1.587 1.585 1.472 -0.244 -0.107 -0.225 89 ARG AAA NH2 471 N N . ARG A 84 ? 0.971 1.045 0.881 -0.108 -0.093 -0.147 90 ARG AAA N 472 C CA . ARG A 84 ? 0.941 1.039 0.876 -0.132 -0.083 -0.132 90 ARG AAA CA 473 C C . ARG A 84 ? 0.850 0.974 0.795 -0.103 -0.076 -0.108 90 ARG AAA C 474 O O . ARG A 84 ? 0.810 0.913 0.752 -0.111 -0.063 -0.088 90 ARG AAA O 475 C CB . ARG A 84 ? 0.924 1.095 0.893 -0.162 -0.093 -0.150 90 ARG AAA CB 476 C CG . ARG A 84 ? 0.911 1.117 0.908 -0.193 -0.080 -0.139 90 ARG AAA CG 477 C CD . ARG A 84 ? 0.995 1.125 0.966 -0.219 -0.063 -0.122 90 ARG AAA CD 478 N NE . ARG A 84 ? 1.041 1.209 1.033 -0.253 -0.049 -0.112 90 ARG AAA NE 479 C CZ . ARG A 84 ? 1.074 1.188 1.042 -0.274 -0.033 -0.088 90 ARG AAA CZ 480 N NH1 . ARG A 84 ? 1.129 1.148 1.056 -0.259 -0.031 -0.072 90 ARG AAA NH1 481 N NH2 . ARG A 84 ? 1.071 1.230 1.057 -0.308 -0.018 -0.081 90 ARG AAA NH2 482 N N . GLU A 85 ? 0.804 0.969 0.755 -0.074 -0.084 -0.110 91 GLU AAA N 483 C CA . GLU A 85 ? 0.789 0.973 0.744 -0.047 -0.077 -0.092 91 GLU AAA CA 484 C C . GLU A 85 ? 0.864 0.993 0.796 -0.035 -0.066 -0.074 91 GLU AAA C 485 O O . GLU A 85 ? 0.964 1.099 0.899 -0.036 -0.057 -0.055 91 GLU AAA O 486 C CB . GLU A 85 ? 0.768 0.977 0.719 -0.019 -0.088 -0.098 91 GLU AAA CB 487 C CG . GLU A 85 ? 0.713 0.937 0.665 0.004 -0.081 -0.082 91 GLU AAA CG 488 C CD . GLU A 85 ? 0.660 0.935 0.642 -0.001 -0.078 -0.081 91 GLU AAA CD 489 O OE1 . GLU A 85 ? 0.657 0.972 0.665 -0.016 -0.084 -0.094 91 GLU AAA OE1 490 O OE2 . GLU A 85 ? 0.616 0.896 0.598 0.010 -0.068 -0.070 91 GLU AAA OE2 491 N N . ILE A 86 ? 0.856 0.936 0.765 -0.024 -0.068 -0.080 92 ILE AAA N 492 C CA . ILE A 86 ? 0.866 0.898 0.758 -0.005 -0.060 -0.065 92 ILE AAA CA 493 C C . ILE A 86 ? 0.852 0.844 0.740 -0.025 -0.054 -0.049 92 ILE AAA C 494 O O . ILE A 86 ? 0.832 0.818 0.717 -0.015 -0.049 -0.026 92 ILE AAA O 495 C CB . ILE A 86 ? 0.935 0.929 0.807 0.013 -0.061 -0.081 92 ILE AAA CB 496 C CG1 . ILE A 86 ? 0.900 0.930 0.766 0.028 -0.066 -0.094 92 ILE AAA CG1 497 C CG2 . ILE A 86 ? 0.957 0.912 0.820 0.037 -0.053 -0.068 92 ILE AAA CG2 498 C CD1 . ILE A 86 ? 0.880 0.943 0.751 0.048 -0.063 -0.078 92 ILE AAA CD1 499 N N . GLU A 87 ? 0.908 0.873 0.793 -0.055 -0.055 -0.061 93 GLU AAA N 500 C CA . GLU A 87 ? 0.988 0.901 0.861 -0.081 -0.048 -0.046 93 GLU AAA CA 501 C C . GLU A 87 ? 0.948 0.904 0.833 -0.098 -0.041 -0.024 93 GLU AAA C 502 O O . GLU A 87 ? 0.977 0.895 0.844 -0.098 -0.036 0.002 93 GLU AAA O 503 C CB . GLU A 87 ? 1.058 0.945 0.926 -0.119 -0.050 -0.067 93 GLU AAA CB 504 C CG . GLU A 87 ? 1.155 0.971 1.003 -0.150 -0.042 -0.051 93 GLU AAA CG 505 C CD . GLU A 87 ? 1.262 1.037 1.100 -0.191 -0.042 -0.075 93 GLU AAA CD 506 O OE1 . GLU A 87 ? 1.292 1.124 1.149 -0.208 -0.050 -0.102 93 GLU AAA OE1 507 O OE2 . GLU A 87 ? 1.325 1.008 1.132 -0.206 -0.037 -0.066 93 GLU AAA OE2 508 N N . ILE A 88 ? 0.862 0.894 0.774 -0.108 -0.041 -0.035 94 ILE AAA N 509 C CA . ILE A 88 ? 0.841 0.923 0.766 -0.121 -0.032 -0.021 94 ILE AAA CA 510 C C . ILE A 88 ? 0.848 0.929 0.761 -0.091 -0.030 -0.000 94 ILE AAA C 511 O O . ILE A 88 ? 0.850 0.922 0.749 -0.103 -0.022 0.022 94 ILE AAA O 512 C CB . ILE A 88 ? 0.789 0.955 0.751 -0.127 -0.034 -0.042 94 ILE AAA CB 513 C CG1 . ILE A 88 ? 0.768 0.953 0.747 -0.167 -0.034 -0.060 94 ILE AAA CG1 514 C CG2 . ILE A 88 ? 0.789 1.006 0.762 -0.125 -0.023 -0.032 94 ILE AAA CG2 515 C CD1 . ILE A 88 ? 0.717 0.992 0.739 -0.167 -0.040 -0.081 94 ILE AAA CD1 516 N N . GLN A 89 ? 0.835 0.927 0.751 -0.057 -0.037 -0.007 95 GLN AAA N 517 C CA . GLN A 89 ? 0.834 0.942 0.745 -0.033 -0.036 0.007 95 GLN AAA CA 518 C C . GLN A 89 ? 0.871 0.928 0.759 -0.019 -0.037 0.029 95 GLN AAA C 519 O O . GLN A 89 ? 0.894 0.967 0.777 -0.006 -0.037 0.044 95 GLN AAA O 520 C CB . GLN A 89 ? 0.845 0.978 0.763 -0.006 -0.041 -0.007 95 GLN AAA CB 521 C CG . GLN A 89 ? 0.840 1.013 0.762 0.003 -0.037 -0.002 95 GLN AAA CG 522 C CD . GLN A 89 ? 0.861 1.077 0.801 0.001 -0.038 -0.018 95 GLN AAA CD 523 O OE1 . GLN A 89 ? 0.928 1.150 0.877 0.003 -0.045 -0.033 95 GLN AAA OE1 524 N NE2 . GLN A 89 ? 0.849 1.096 0.793 -0.000 -0.030 -0.016 95 GLN AAA NE2 525 N N . ALA A 90 ? 0.886 0.884 0.763 -0.021 -0.040 0.028 96 ALA AAA N 526 C CA . ALA A 90 ? 0.977 0.917 0.835 -0.004 -0.043 0.049 96 ALA AAA CA 527 C C . ALA A 90 ? 1.010 0.918 0.846 -0.029 -0.040 0.076 96 ALA AAA C 528 O O . ALA A 90 ? 0.990 0.859 0.808 -0.011 -0.045 0.100 96 ALA AAA O 529 C CB . ALA A 90 ? 1.014 0.896 0.865 0.007 -0.045 0.032 96 ALA AAA CB 530 N N . HIS A 91 ? 1.090 1.017 0.929 -0.068 -0.032 0.071 97 HIS AAA N 531 C CA . HIS A 91 ? 1.159 1.057 0.973 -0.103 -0.025 0.095 97 HIS AAA CA 532 C C . HIS A 91 ? 1.052 1.020 0.870 -0.119 -0.016 0.103 97 HIS AAA C 533 O O . HIS A 91 ? 1.058 1.007 0.847 -0.134 -0.013 0.131 97 HIS AAA O 534 C CB . HIS A 91 ? 1.256 1.121 1.069 -0.142 -0.019 0.081 97 HIS AAA CB 535 C CG . HIS A 91 ? 1.406 1.175 1.197 -0.135 -0.024 0.082 97 HIS AAA CG 536 N ND1 . HIS A 91 ? 1.443 1.181 1.233 -0.089 -0.034 0.078 97 HIS AAA ND1 537 C CD2 . HIS A 91 ? 1.502 1.198 1.269 -0.169 -0.020 0.085 97 HIS AAA CD2 538 C CE1 . HIS A 91 ? 1.531 1.180 1.300 -0.090 -0.035 0.077 97 HIS AAA CE1 539 N NE2 . HIS A 91 ? 1.567 1.183 1.319 -0.140 -0.027 0.081 97 HIS AAA NE2 540 N N . LEU A 92 ? 0.943 0.984 0.793 -0.115 -0.013 0.079 98 LEU AAA N 541 C CA . LEU A 92 ? 0.900 1.008 0.758 -0.131 -0.001 0.077 98 LEU AAA CA 542 C C . LEU A 92 ? 0.861 1.008 0.725 -0.099 -0.005 0.073 98 LEU AAA C 543 O O . LEU A 92 ? 0.835 0.980 0.713 -0.070 -0.015 0.060 98 LEU AAA O 544 C CB . LEU A 92 ? 0.888 1.048 0.780 -0.152 0.007 0.048 98 LEU AAA CB 545 C CG . LEU A 92 ? 0.966 1.121 0.854 -0.200 0.020 0.052 98 LEU AAA CG 546 C CD1 . LEU A 92 ? 1.050 1.115 0.907 -0.213 0.014 0.069 98 LEU AAA CD1 547 C CD2 . LEU A 92 ? 0.965 1.181 0.897 -0.216 0.023 0.020 98 LEU AAA CD2 548 N N . GLN A 93 ? 0.825 1.004 0.675 -0.109 0.003 0.083 99 GLN AAA N 549 C CA . GLN A 93 ? 0.792 1.009 0.643 -0.088 0.001 0.078 99 GLN AAA CA 550 C C . GLN A 93 ? 0.749 1.018 0.600 -0.109 0.018 0.068 99 GLN AAA C 551 O O . GLN A 93 ? 0.808 1.078 0.643 -0.140 0.030 0.079 99 GLN AAA O 552 C CB . GLN A 93 ? 0.902 1.094 0.725 -0.073 -0.010 0.104 99 GLN AAA CB 553 C CG . GLN A 93 ? 0.984 1.143 0.817 -0.041 -0.025 0.106 99 GLN AAA CG 554 C CD . GLN A 93 ? 1.033 1.130 0.858 -0.044 -0.029 0.117 99 GLN AAA CD 555 O OE1 . GLN A 93 ? 1.112 1.174 0.910 -0.060 -0.030 0.141 99 GLN AAA OE1 556 N NE2 . GLN A 93 ? 0.995 1.074 0.839 -0.029 -0.033 0.098 99 GLN AAA NE2 557 N N . HIS A 94 ? 0.654 0.961 0.520 -0.094 0.022 0.047 100 HIS AAA N 558 C CA . HIS A 94 ? 0.645 1.000 0.511 -0.108 0.040 0.032 100 HIS AAA CA 559 C C . HIS A 94 ? 0.610 0.981 0.478 -0.085 0.038 0.016 100 HIS AAA C 560 O O . HIS A 94 ? 0.681 1.041 0.568 -0.061 0.028 0.005 100 HIS AAA O 561 C CB . HIS A 94 ? 0.635 1.028 0.535 -0.121 0.053 0.010 100 HIS AAA CB 562 C CG . HIS A 94 ? 0.644 1.088 0.544 -0.137 0.075 -0.005 100 HIS AAA CG 563 N ND1 . HIS A 94 ? 0.678 1.134 0.552 -0.172 0.091 0.008 100 HIS AAA ND1 564 C CD2 . HIS A 94 ? 0.627 1.111 0.547 -0.122 0.086 -0.033 100 HIS AAA CD2 565 C CE1 . HIS A 94 ? 0.693 1.200 0.572 -0.180 0.112 -0.013 100 HIS AAA CE1 566 N NE2 . HIS A 94 ? 0.645 1.168 0.552 -0.147 0.109 -0.039 100 HIS AAA NE2 567 N N . PRO A 95 ? 0.602 0.994 0.446 -0.095 0.048 0.013 101 PRO AAA N 568 C CA . PRO A 95 ? 0.571 0.969 0.411 -0.079 0.047 -0.003 101 PRO AAA CA 569 C C . PRO A 95 ? 0.527 0.939 0.398 -0.061 0.055 -0.034 101 PRO AAA C 570 O O . PRO A 95 ? 0.515 0.913 0.382 -0.045 0.051 -0.045 101 PRO AAA O 571 C CB . PRO A 95 ? 0.620 1.038 0.422 -0.100 0.058 -0.002 101 PRO AAA CB 572 C CG . PRO A 95 ? 0.665 1.098 0.457 -0.128 0.071 0.009 101 PRO AAA CG 573 C CD . PRO A 95 ? 0.649 1.056 0.461 -0.125 0.060 0.026 101 PRO AAA CD 574 N N . ASN A 96 ? 0.541 0.978 0.442 -0.063 0.064 -0.047 102 ASN AAA N 575 C CA . ASN A 96 ? 0.556 1.014 0.492 -0.041 0.069 -0.075 102 ASN AAA CA 576 C C . ASN A 96 ? 0.557 1.010 0.526 -0.027 0.054 -0.074 102 ASN AAA C 577 O O . ASN A 96 ? 0.611 1.092 0.614 -0.010 0.056 -0.094 102 ASN AAA O 578 C CB . ASN A 96 ? 0.562 1.072 0.515 -0.052 0.093 -0.097 102 ASN AAA CB 579 C CG . ASN A 96 ? 0.592 1.108 0.507 -0.068 0.109 -0.102 102 ASN AAA CG 580 O OD1 . ASN A 96 ? 0.631 1.175 0.530 -0.097 0.125 -0.097 102 ASN AAA OD1 581 N ND2 . ASN A 96 ? 0.603 1.091 0.496 -0.053 0.106 -0.110 102 ASN AAA ND2 582 N N . ILE A 97 ? 0.534 0.954 0.492 -0.032 0.040 -0.053 103 ILE AAA N 583 C CA . ILE A 97 ? 0.522 0.926 0.499 -0.018 0.023 -0.052 103 ILE AAA CA 584 C C . ILE A 97 ? 0.543 0.903 0.496 -0.003 0.010 -0.040 103 ILE AAA C 585 O O . ILE A 97 ? 0.566 0.906 0.496 -0.014 0.008 -0.021 103 ILE AAA O 586 C CB . ILE A 97 ? 0.525 0.930 0.511 -0.041 0.021 -0.043 103 ILE AAA CB 587 C CG1 . ILE A 97 ? 0.553 1.012 0.568 -0.061 0.036 -0.057 103 ILE AAA CG1 588 C CG2 . ILE A 97 ? 0.528 0.910 0.524 -0.028 0.003 -0.045 103 ILE AAA CG2 589 C CD1 . ILE A 97 ? 0.574 1.028 0.589 -0.094 0.038 -0.047 103 ILE AAA CD1 590 N N . LEU A 98 ? 0.502 0.848 0.459 0.020 0.000 -0.048 104 LEU AAA N 591 C CA . LEU A 98 ? 0.468 0.779 0.404 0.032 -0.009 -0.039 104 LEU AAA CA 592 C C . LEU A 98 ? 0.448 0.739 0.379 0.026 -0.017 -0.025 104 LEU AAA C 593 O O . LEU A 98 ? 0.469 0.762 0.414 0.021 -0.021 -0.028 104 LEU AAA O 594 C CB . LEU A 98 ? 0.490 0.788 0.428 0.054 -0.017 -0.049 104 LEU AAA CB 595 C CG . LEU A 98 ? 0.529 0.795 0.440 0.061 -0.020 -0.043 104 LEU AAA CG 596 C CD1 . LEU A 98 ? 0.532 0.795 0.428 0.056 -0.009 -0.048 104 LEU AAA CD1 597 C CD2 . LEU A 98 ? 0.534 0.779 0.440 0.080 -0.031 -0.047 104 LEU AAA CD2 598 N N . ARG A 99 ? 0.456 0.731 0.368 0.026 -0.018 -0.012 105 ARG AAA N 599 C CA . ARG A 99 ? 0.506 0.760 0.414 0.025 -0.024 0.003 105 ARG AAA CA 600 C C . ARG A 99 ? 0.525 0.758 0.432 0.042 -0.031 -0.002 105 ARG AAA C 601 O O . ARG A 99 ? 0.516 0.751 0.416 0.051 -0.031 -0.007 105 ARG AAA O 602 C CB . ARG A 99 ? 0.552 0.808 0.445 0.023 -0.024 0.019 105 ARG AAA CB 603 C CG . ARG A 99 ? 0.632 0.865 0.522 0.026 -0.030 0.036 105 ARG AAA CG 604 C CD . ARG A 99 ? 0.722 0.958 0.598 0.011 -0.029 0.055 105 ARG AAA CD 605 N NE . ARG A 99 ? 0.764 0.964 0.634 0.018 -0.037 0.073 105 ARG AAA NE 606 C CZ . ARG A 99 ? 0.774 0.969 0.630 0.023 -0.045 0.096 105 ARG AAA CZ 607 N NH1 . ARG A 99 ? 0.822 1.051 0.667 0.018 -0.046 0.103 105 ARG AAA NH1 608 N NH2 . ARG A 99 ? 0.817 0.969 0.668 0.035 -0.052 0.111 105 ARG AAA NH2 609 N N . LEU A 100 ? 0.544 0.756 0.454 0.042 -0.036 -0.001 106 LEU AAA N 610 C CA . LEU A 100 ? 0.596 0.786 0.500 0.057 -0.040 -0.004 106 LEU AAA CA 611 C C . LEU A 100 ? 0.567 0.745 0.468 0.064 -0.040 0.011 106 LEU AAA C 612 O O . LEU A 100 ? 0.631 0.788 0.531 0.057 -0.041 0.021 106 LEU AAA O 613 C CB . LEU A 100 ? 0.683 0.852 0.590 0.053 -0.045 -0.015 106 LEU AAA CB 614 C CG . LEU A 100 ? 0.729 0.879 0.626 0.067 -0.048 -0.026 106 LEU AAA CG 615 C CD1 . LEU A 100 ? 0.773 0.925 0.667 0.062 -0.055 -0.042 106 LEU AAA CD1 616 C CD2 . LEU A 100 ? 0.815 0.929 0.708 0.072 -0.046 -0.022 106 LEU AAA CD2 617 N N . TYR A 101 ? 0.567 0.760 0.466 0.075 -0.038 0.014 107 TYR AAA N 618 C CA . TYR A 101 ? 0.619 0.815 0.522 0.088 -0.041 0.028 107 TYR AAA CA 619 C C . TYR A 101 ? 0.647 0.810 0.553 0.105 -0.042 0.023 107 TYR AAA C 620 O O . TYR A 101 ? 0.610 0.748 0.516 0.113 -0.046 0.036 107 TYR AAA O 621 C CB . TYR A 101 ? 0.582 0.815 0.488 0.093 -0.038 0.028 107 TYR AAA CB 622 C CG . TYR A 101 ? 0.559 0.818 0.458 0.075 -0.036 0.029 107 TYR AAA CG 623 C CD1 . TYR A 101 ? 0.550 0.817 0.444 0.064 -0.039 0.041 107 TYR AAA CD1 624 C CD2 . TYR A 101 ? 0.586 0.855 0.478 0.069 -0.030 0.017 107 TYR AAA CD2 625 C CE1 . TYR A 101 ? 0.549 0.838 0.433 0.047 -0.035 0.038 107 TYR AAA CE1 626 C CE2 . TYR A 101 ? 0.588 0.871 0.471 0.053 -0.027 0.015 107 TYR AAA CE2 627 C CZ . TYR A 101 ? 0.559 0.854 0.438 0.043 -0.029 0.024 107 TYR AAA CZ 628 O OH . TYR A 101 ? 0.535 0.842 0.402 0.027 -0.024 0.017 107 TYR AAA OH 629 N N . ASN A 102 ? 0.700 0.859 0.603 0.110 -0.038 0.004 108 ASN AAA N 630 C CA . ASN A 102 ? 0.731 0.856 0.630 0.124 -0.036 -0.009 108 ASN AAA CA 631 C C . ASN A 102 ? 0.767 0.897 0.654 0.121 -0.032 -0.028 108 ASN AAA C 632 O O . ASN A 102 ? 0.813 0.967 0.694 0.111 -0.032 -0.028 108 ASN AAA O 633 C CB . ASN A 102 ? 0.704 0.832 0.615 0.149 -0.034 -0.004 108 ASN AAA CB 634 C CG . ASN A 102 ? 0.786 0.861 0.695 0.163 -0.034 -0.010 108 ASN AAA CG 635 O OD1 . ASN A 102 ? 0.867 0.908 0.762 0.154 -0.033 -0.026 108 ASN AAA OD1 636 N ND2 . ASN A 102 ? 0.846 0.909 0.766 0.186 -0.038 0.003 108 ASN AAA ND2 637 N N . TYR A 103 ? 0.753 0.857 0.631 0.130 -0.029 -0.045 109 TYR AAA N 638 C CA . TYR A 103 ? 0.736 0.840 0.593 0.127 -0.027 -0.064 109 TYR AAA CA 639 C C . TYR A 103 ? 0.760 0.856 0.612 0.146 -0.015 -0.080 109 TYR AAA C 640 O O . TYR A 103 ? 0.867 0.939 0.731 0.162 -0.013 -0.080 109 TYR AAA O 641 C CB . TYR A 103 ? 0.706 0.786 0.552 0.112 -0.037 -0.075 109 TYR AAA CB 642 C CG . TYR A 103 ? 0.713 0.748 0.557 0.113 -0.037 -0.086 109 TYR AAA CG 643 C CD1 . TYR A 103 ? 0.746 0.757 0.603 0.108 -0.039 -0.073 109 TYR AAA CD1 644 C CD2 . TYR A 103 ? 0.746 0.757 0.569 0.117 -0.033 -0.110 109 TYR AAA CD2 645 C CE1 . TYR A 103 ? 0.780 0.737 0.630 0.106 -0.039 -0.082 109 TYR AAA CE1 646 C CE2 . TYR A 103 ? 0.795 0.755 0.613 0.117 -0.032 -0.123 109 TYR AAA CE2 647 C CZ . TYR A 103 ? 0.816 0.745 0.647 0.111 -0.035 -0.108 109 TYR AAA CZ 648 O OH . TYR A 103 ? 0.910 0.776 0.732 0.109 -0.034 -0.119 109 TYR AAA OH 649 N N . PHE A 104 ? 0.726 0.836 0.557 0.145 -0.008 -0.093 110 PHE AAA N 650 C CA . PHE A 104 ? 0.751 0.854 0.569 0.158 0.005 -0.115 110 PHE AAA CA 651 C C . PHE A 104 ? 0.733 0.827 0.511 0.143 0.003 -0.130 110 PHE AAA C 652 O O . PHE A 104 ? 0.674 0.769 0.441 0.127 -0.012 -0.121 110 PHE AAA O 653 C CB . PHE A 104 ? 0.742 0.889 0.576 0.171 0.021 -0.113 110 PHE AAA CB 654 C CG . PHE A 104 ? 0.692 0.877 0.518 0.155 0.023 -0.100 110 PHE AAA CG 655 C CD1 . PHE A 104 ? 0.700 0.898 0.543 0.146 0.014 -0.078 110 PHE AAA CD1 656 C CD2 . PHE A 104 ? 0.690 0.893 0.489 0.145 0.037 -0.109 110 PHE AAA CD2 657 C CE1 . PHE A 104 ? 0.692 0.915 0.525 0.129 0.017 -0.068 110 PHE AAA CE1 658 C CE2 . PHE A 104 ? 0.701 0.927 0.488 0.127 0.039 -0.095 110 PHE AAA CE2 659 C CZ . PHE A 104 ? 0.714 0.947 0.519 0.120 0.029 -0.076 110 PHE AAA CZ 660 N N . HIS A 105 ? 0.782 0.869 0.537 0.149 0.015 -0.154 111 HIS AAA N 661 C CA . HIS A 105 ? 0.815 0.893 0.523 0.135 0.011 -0.169 111 HIS AAA CA 662 C C . HIS A 105 ? 0.885 0.976 0.566 0.141 0.034 -0.189 111 HIS AAA C 663 O O . HIS A 105 ? 0.868 0.964 0.572 0.161 0.051 -0.202 111 HIS AAA O 664 C CB . HIS A 105 ? 0.835 0.874 0.533 0.126 -0.003 -0.185 111 HIS AAA CB 665 C CG . HIS A 105 ? 0.887 0.890 0.587 0.139 0.008 -0.210 111 HIS AAA CG 666 N ND1 . HIS A 105 ? 0.960 0.949 0.624 0.140 0.019 -0.241 111 HIS AAA ND1 667 C CD2 . HIS A 105 ? 0.939 0.909 0.668 0.151 0.009 -0.209 111 HIS AAA CD2 668 C CE1 . HIS A 105 ? 1.031 0.979 0.704 0.155 0.029 -0.261 111 HIS AAA CE1 669 N NE2 . HIS A 105 ? 1.044 0.977 0.757 0.163 0.022 -0.240 111 HIS AAA NE2 670 N N . ASP A 106 ? 0.951 1.050 0.585 0.125 0.032 -0.191 112 ASP AAA N 671 C CA . ASP A 106 ? 0.920 1.033 0.512 0.121 0.053 -0.209 112 ASP AAA CA 672 C C . ASP A 106 ? 0.984 1.069 0.529 0.112 0.045 -0.234 112 ASP AAA C 673 O O . ASP A 106 ? 0.941 0.999 0.493 0.108 0.023 -0.237 112 ASP AAA O 674 C CB . ASP A 106 ? 0.920 1.056 0.482 0.104 0.055 -0.186 112 ASP AAA CB 675 C CG . ASP A 106 ? 0.962 1.140 0.545 0.106 0.081 -0.180 112 ASP AAA CG 676 O OD1 . ASP A 106 ? 1.013 1.213 0.612 0.120 0.105 -0.203 112 ASP AAA OD1 677 O OD2 . ASP A 106 ? 0.984 1.173 0.567 0.093 0.078 -0.154 112 ASP AAA OD2 678 N N . ALA A 107 ? 1.066 1.159 0.561 0.105 0.062 -0.252 113 ALA AAA N 679 C CA . ALA A 107 ? 1.101 1.174 0.534 0.091 0.054 -0.275 113 ALA AAA CA 680 C C . ALA A 107 ? 1.086 1.153 0.492 0.074 0.020 -0.251 113 ALA AAA C 681 O O . ALA A 107 ? 1.117 1.166 0.504 0.065 -0.002 -0.266 113 ALA AAA O 682 C CB . ALA A 107 ? 1.178 1.272 0.561 0.084 0.082 -0.291 113 ALA AAA CB 683 N N . ARG A 108 ? 1.024 1.107 0.430 0.070 0.015 -0.217 114 ARG AAA N 684 C CA . ARG A 108 ? 1.013 1.091 0.390 0.060 -0.016 -0.191 114 ARG AAA CA 685 C C . ARG A 108 ? 0.964 1.043 0.400 0.069 -0.035 -0.169 114 ARG AAA C 686 O O . ARG A 108 ? 0.954 1.031 0.386 0.066 -0.065 -0.159 114 ARG AAA O 687 C CB . ARG A 108 ? 1.019 1.102 0.344 0.049 -0.006 -0.170 114 ARG AAA CB 688 C CG . ARG A 108 ? 1.103 1.189 0.361 0.037 0.014 -0.192 114 ARG AAA CG 689 C CD . ARG A 108 ? 1.130 1.232 0.358 0.025 0.048 -0.185 114 ARG AAA CD 690 N NE . ARG A 108 ? 1.219 1.308 0.361 0.005 0.044 -0.166 114 ARG AAA NE 691 C CZ . ARG A 108 ? 1.288 1.379 0.357 -0.010 0.057 -0.184 114 ARG AAA CZ 692 N NH1 . ARG A 108 ? 1.322 1.427 0.395 -0.006 0.077 -0.227 114 ARG AAA NH1 693 N NH2 . ARG A 108 ? 1.343 1.417 0.331 -0.030 0.049 -0.160 114 ARG AAA NH2 694 N N . ARG A 109 ? 0.934 1.021 0.423 0.078 -0.019 -0.163 115 ARG AAA N 695 C CA . ARG A 109 ? 0.860 0.953 0.396 0.083 -0.031 -0.138 115 ARG AAA CA 696 C C . ARG A 109 ? 0.834 0.924 0.426 0.092 -0.032 -0.146 115 ARG AAA C 697 O O . ARG A 109 ? 0.860 0.943 0.463 0.098 -0.017 -0.166 115 ARG AAA O 698 C CB . ARG A 109 ? 0.832 0.938 0.373 0.082 -0.012 -0.119 115 ARG AAA CB 699 C CG . ARG A 109 ? 0.849 0.945 0.360 0.075 -0.023 -0.093 115 ARG AAA CG 700 C CD . ARG A 109 ? 0.919 0.997 0.367 0.069 -0.040 -0.089 115 ARG AAA CD 701 N NE . ARG A 109 ? 0.940 0.999 0.348 0.061 -0.041 -0.063 115 ARG AAA NE 702 C CZ . ARG A 109 ? 1.003 1.043 0.340 0.052 -0.046 -0.053 115 ARG AAA CZ 703 N NH1 . ARG A 109 ? 1.062 1.074 0.362 0.045 -0.046 -0.026 115 ARG AAA NH1 704 N NH2 . ARG A 109 ? 1.026 1.069 0.323 0.048 -0.050 -0.071 115 ARG AAA NH2 705 N N . VAL A 110 ? 0.803 0.897 0.428 0.092 -0.049 -0.131 116 VAL AAA N 706 C CA . VAL A 110 ? 0.781 0.875 0.459 0.096 -0.048 -0.127 116 VAL AAA CA 707 C C . VAL A 110 ? 0.752 0.862 0.452 0.099 -0.045 -0.103 116 VAL AAA C 708 O O . VAL A 110 ? 0.823 0.936 0.510 0.096 -0.058 -0.091 116 VAL AAA O 709 C CB . VAL A 110 ? 0.749 0.837 0.443 0.088 -0.067 -0.135 116 VAL AAA CB 710 C CG1 . VAL A 110 ? 0.662 0.749 0.403 0.089 -0.065 -0.125 116 VAL AAA CG1 711 C CG2 . VAL A 110 ? 0.782 0.850 0.454 0.081 -0.069 -0.162 116 VAL AAA CG2 712 N N . TYR A 111 ? 0.716 0.834 0.446 0.105 -0.031 -0.098 117 TYR AAA N 713 C CA . TYR A 111 ? 0.687 0.822 0.436 0.104 -0.027 -0.078 117 TYR AAA CA 714 C C . TYR A 111 ? 0.631 0.767 0.417 0.105 -0.034 -0.071 117 TYR AAA C 715 O O . TYR A 111 ? 0.622 0.750 0.426 0.111 -0.030 -0.076 117 TYR AAA O 716 C CB . TYR A 111 ? 0.734 0.888 0.485 0.107 -0.008 -0.077 117 TYR AAA CB 717 C CG . TYR A 111 ? 0.804 0.959 0.514 0.102 0.003 -0.085 117 TYR AAA CG 718 C CD1 . TYR A 111 ? 0.827 0.979 0.524 0.108 0.013 -0.106 117 TYR AAA CD1 719 C CD2 . TYR A 111 ? 0.838 0.992 0.518 0.089 0.005 -0.072 117 TYR AAA CD2 720 C CE1 . TYR A 111 ? 0.864 1.020 0.519 0.100 0.026 -0.114 117 TYR AAA CE1 721 C CE2 . TYR A 111 ? 0.876 1.027 0.510 0.080 0.016 -0.077 117 TYR AAA CE2 722 C CZ . TYR A 111 ? 0.889 1.046 0.511 0.085 0.027 -0.098 117 TYR AAA CZ 723 O OH . TYR A 111 ? 0.935 1.093 0.508 0.073 0.041 -0.103 117 TYR AAA OH 724 N N . LEU A 112 ? 0.625 0.769 0.420 0.100 -0.042 -0.060 118 LEU AAA N 725 C CA . LEU A 112 ? 0.600 0.752 0.426 0.097 -0.044 -0.051 118 LEU AAA CA 726 C C . LEU A 112 ? 0.568 0.737 0.399 0.095 -0.036 -0.039 118 LEU AAA C 727 O O . LEU A 112 ? 0.571 0.739 0.385 0.092 -0.035 -0.035 118 LEU AAA O 728 C CB . LEU A 112 ? 0.560 0.717 0.394 0.091 -0.057 -0.053 118 LEU AAA CB 729 C CG . LEU A 112 ? 0.566 0.715 0.395 0.088 -0.068 -0.067 118 LEU AAA CG 730 C CD1 . LEU A 112 ? 0.572 0.740 0.422 0.081 -0.081 -0.069 118 LEU AAA CD1 731 C CD2 . LEU A 112 ? 0.562 0.690 0.397 0.085 -0.063 -0.074 118 LEU AAA CD2 732 N N . ILE A 113 ? 0.560 0.740 0.410 0.098 -0.030 -0.033 119 ILE AAA N 733 C CA . ILE A 113 ? 0.539 0.743 0.399 0.093 -0.025 -0.022 119 ILE AAA CA 734 C C . ILE A 113 ? 0.507 0.712 0.376 0.085 -0.030 -0.016 119 ILE AAA C 735 O O . ILE A 113 ? 0.526 0.729 0.409 0.085 -0.033 -0.010 119 ILE AAA O 736 C CB . ILE A 113 ? 0.537 0.759 0.413 0.102 -0.020 -0.018 119 ILE AAA CB 737 C CG1 . ILE A 113 ? 0.552 0.774 0.426 0.115 -0.012 -0.029 119 ILE AAA CG1 738 C CG2 . ILE A 113 ? 0.554 0.809 0.436 0.093 -0.016 -0.009 119 ILE AAA CG2 739 C CD1 . ILE A 113 ? 0.544 0.775 0.441 0.134 -0.011 -0.027 119 ILE AAA CD1 740 N N . LEU A 114 ? 0.500 0.706 0.360 0.078 -0.030 -0.016 120 LEU AAA N 741 C CA . LEU A 114 ? 0.518 0.730 0.388 0.072 -0.032 -0.016 120 LEU AAA CA 742 C C . LEU A 114 ? 0.528 0.755 0.395 0.062 -0.026 -0.011 120 LEU AAA C 743 O O . LEU A 114 ? 0.481 0.709 0.335 0.058 -0.021 -0.011 120 LEU AAA O 744 C CB . LEU A 114 ? 0.527 0.729 0.391 0.077 -0.038 -0.024 120 LEU AAA CB 745 C CG . LEU A 114 ? 0.527 0.723 0.396 0.082 -0.047 -0.031 120 LEU AAA CG 746 C CD1 . LEU A 114 ? 0.525 0.719 0.389 0.091 -0.057 -0.037 120 LEU AAA CD1 747 C CD2 . LEU A 114 ? 0.510 0.715 0.400 0.074 -0.048 -0.031 120 LEU AAA CD2 748 N N . GLU A 115 ? 0.531 0.770 0.406 0.054 -0.024 -0.009 121 GLU AAA N 749 C CA . GLU A 115 ? 0.547 0.799 0.414 0.042 -0.018 -0.011 121 GLU AAA CA 750 C C . GLU A 115 ? 0.567 0.798 0.418 0.044 -0.015 -0.021 121 GLU AAA C 751 O O . GLU A 115 ? 0.589 0.807 0.444 0.056 -0.018 -0.028 121 GLU AAA O 752 C CB . GLU A 115 ? 0.569 0.835 0.443 0.034 -0.015 -0.011 121 GLU AAA CB 753 C CG . GLU A 115 ? 0.586 0.867 0.446 0.020 -0.008 -0.014 121 GLU AAA CG 754 C CD . GLU A 115 ? 0.593 0.890 0.456 0.010 -0.000 -0.019 121 GLU AAA CD 755 O OE1 . GLU A 115 ? 0.566 0.869 0.442 0.008 -0.002 -0.012 121 GLU AAA OE1 756 O OE2 . GLU A 115 ? 0.560 0.864 0.410 0.002 0.009 -0.030 121 GLU AAA OE2 757 N N . TYR A 116 ? 0.548 0.778 0.383 0.032 -0.009 -0.023 122 TYR AAA N 758 C CA . TYR A 116 ? 0.530 0.728 0.342 0.030 -0.004 -0.032 122 TYR AAA CA 759 C C . TYR A 116 ? 0.520 0.717 0.331 0.026 0.002 -0.044 122 TYR AAA C 760 O O . TYR A 116 ? 0.590 0.814 0.401 0.011 0.006 -0.044 122 TYR AAA O 761 C CB . TYR A 116 ? 0.551 0.748 0.346 0.012 0.001 -0.030 122 TYR AAA CB 762 C CG . TYR A 116 ? 0.595 0.748 0.360 0.002 0.008 -0.037 122 TYR AAA CG 763 C CD1 . TYR A 116 ? 0.627 0.733 0.375 0.018 0.005 -0.038 122 TYR AAA CD1 764 C CD2 . TYR A 116 ? 0.616 0.771 0.365 -0.023 0.015 -0.044 122 TYR AAA CD2 765 C CE1 . TYR A 116 ? 0.677 0.730 0.392 0.011 0.011 -0.042 122 TYR AAA CE1 766 C CE2 . TYR A 116 ? 0.665 0.769 0.381 -0.035 0.023 -0.053 122 TYR AAA CE2 767 C CZ . TYR A 116 ? 0.708 0.756 0.406 -0.017 0.021 -0.051 122 TYR AAA CZ 768 O OH . TYR A 116 ? 0.789 0.773 0.450 -0.027 0.028 -0.056 122 TYR AAA OH 769 N N . ALA A 117 ? 0.489 0.660 0.299 0.042 0.003 -0.053 123 ALA AAA N 770 C CA . ALA A 117 ? 0.510 0.674 0.319 0.046 0.011 -0.070 123 ALA AAA CA 771 C C . ALA A 117 ? 0.593 0.709 0.369 0.038 0.018 -0.078 123 ALA AAA C 772 O O . ALA A 117 ? 0.654 0.725 0.418 0.056 0.015 -0.080 123 ALA AAA O 773 C CB . ALA A 117 ? 0.477 0.644 0.309 0.072 0.006 -0.076 123 ALA AAA CB 774 N N . PRO A 118 ? 0.626 0.994 0.391 -0.038 0.045 0.012 124 PRO AAA N 775 C CA . PRO A 118 ? 0.647 1.020 0.412 -0.060 0.043 0.021 124 PRO AAA CA 776 C C . PRO A 118 ? 0.670 1.002 0.414 -0.070 0.034 0.030 124 PRO AAA C 777 O O . PRO A 118 ? 0.705 1.035 0.443 -0.089 0.035 0.040 124 PRO AAA O 778 C CB . PRO A 118 ? 0.635 1.023 0.421 -0.059 0.037 0.018 124 PRO AAA CB 779 C CG . PRO A 118 ? 0.601 1.009 0.403 -0.038 0.040 0.009 124 PRO AAA CG 780 C CD . PRO A 118 ? 0.589 0.969 0.375 -0.025 0.041 0.006 124 PRO AAA CD 781 N N . ARG A 119 ? 0.706 1.007 0.440 -0.058 0.026 0.027 125 ARG AAA N 782 C CA . ARG A 119 ? 0.773 1.035 0.490 -0.062 0.016 0.032 125 ARG AAA CA 783 C C . ARG A 119 ? 0.782 1.027 0.478 -0.058 0.017 0.036 125 ARG AAA C 784 O O . ARG A 119 ? 0.855 1.069 0.538 -0.056 0.008 0.039 125 ARG AAA O 785 C CB . ARG A 119 ? 0.828 1.076 0.549 -0.051 0.006 0.025 125 ARG AAA CB 786 C CG . ARG A 119 ? 0.884 1.143 0.619 -0.060 0.001 0.022 125 ARG AAA CG 787 C CD . ARG A 119 ? 0.944 1.188 0.677 -0.050 -0.010 0.014 125 ARG AAA CD 788 N NE . ARG A 119 ? 1.028 1.264 0.763 -0.064 -0.019 0.012 125 ARG AAA NE 789 C CZ . ARG A 119 ? 1.089 1.290 0.812 -0.071 -0.029 0.011 125 ARG AAA CZ 790 N NH1 . ARG A 119 ? 1.150 1.323 0.857 -0.064 -0.030 0.015 125 ARG AAA NH1 791 N NH2 . ARG A 119 ? 1.085 1.279 0.814 -0.085 -0.038 0.007 125 ARG AAA NH2 792 N N . GLY A 120 ? 0.771 1.037 0.466 -0.055 0.027 0.034 126 GLY AAA N 793 C CA . GLY A 120 ? 0.776 1.034 0.450 -0.053 0.028 0.038 126 GLY AAA CA 794 C C . GLY A 120 ? 0.792 1.028 0.459 -0.039 0.021 0.032 126 GLY AAA C 795 O O . GLY A 120 ? 0.795 1.033 0.476 -0.028 0.020 0.023 126 GLY AAA O 796 N N . GLU A 121 ? 0.854 1.073 0.501 -0.040 0.016 0.039 127 GLU AAA N 797 C CA . GLU A 121 ? 0.838 1.044 0.478 -0.027 0.009 0.034 127 GLU AAA CA 798 C C . GLU A 121 ? 0.791 0.974 0.436 -0.021 -0.002 0.035 127 GLU AAA C 799 O O . GLU A 121 ? 0.789 0.955 0.430 -0.028 -0.007 0.042 127 GLU AAA O 800 C CB . GLU A 121 ? 0.909 1.112 0.526 -0.030 0.006 0.041 127 GLU AAA CB 801 C CG . GLU A 121 ? 0.976 1.174 0.586 -0.018 -0.001 0.035 127 GLU AAA CG 802 C CD . GLU A 121 ? 1.032 1.236 0.618 -0.020 -0.002 0.040 127 GLU AAA CD 803 O OE1 . GLU A 121 ? 1.158 1.383 0.737 -0.025 0.007 0.037 127 GLU AAA OE1 804 O OE2 . GLU A 121 ? 0.898 1.086 0.471 -0.016 -0.014 0.048 127 GLU AAA OE2 805 N N . LEU A 122 ? 0.757 0.941 0.411 -0.009 -0.005 0.026 128 LEU AAA N 806 C CA . LEU A 122 ? 0.738 0.909 0.397 -0.001 -0.013 0.024 128 LEU AAA CA 807 C C . LEU A 122 ? 0.823 0.971 0.466 0.002 -0.023 0.030 128 LEU AAA C 808 O O . LEU A 122 ? 0.882 1.011 0.523 0.004 -0.030 0.031 128 LEU AAA O 809 C CB . LEU A 122 ? 0.711 0.896 0.384 0.009 -0.012 0.017 128 LEU AAA CB 810 C CG . LEU A 122 ? 0.713 0.895 0.391 0.019 -0.018 0.013 128 LEU AAA CG 811 C CD1 . LEU A 122 ? 0.679 0.854 0.359 0.018 -0.019 0.012 128 LEU AAA CD1 812 C CD2 . LEU A 122 ? 0.724 0.924 0.417 0.024 -0.014 0.010 128 LEU AAA CD2 813 N N . TYR A 123 ? 0.884 1.035 0.516 0.004 -0.025 0.033 129 TYR AAA N 814 C CA . TYR A 123 ? 0.868 0.999 0.484 0.010 -0.037 0.041 129 TYR AAA CA 815 C C . TYR A 123 ? 0.868 0.972 0.471 -0.000 -0.041 0.053 129 TYR AAA C 816 O O . TYR A 123 ? 0.848 0.925 0.446 0.007 -0.053 0.057 129 TYR AAA O 817 C CB . TYR A 123 ? 0.877 1.020 0.481 0.010 -0.039 0.043 129 TYR AAA CB 818 C CG . TYR A 123 ? 0.933 1.056 0.520 0.018 -0.053 0.053 129 TYR AAA CG 819 C CD1 . TYR A 123 ? 0.920 1.042 0.516 0.034 -0.063 0.047 129 TYR AAA CD1 820 C CD2 . TYR A 123 ? 0.981 1.090 0.544 0.010 -0.056 0.069 129 TYR AAA CD2 821 C CE1 . TYR A 123 ? 0.947 1.051 0.531 0.044 -0.077 0.056 129 TYR AAA CE1 822 C CE2 . TYR A 123 ? 1.009 1.097 0.557 0.018 -0.070 0.080 129 TYR AAA CE2 823 C CZ . TYR A 123 ? 1.001 1.085 0.559 0.037 -0.082 0.073 129 TYR AAA CZ 824 O OH . TYR A 123 ? 1.052 1.116 0.597 0.048 -0.097 0.084 129 TYR AAA OH 825 N N . LYS A 124 ? 0.864 0.976 0.464 -0.016 -0.032 0.060 130 LYS AAA N 826 C CA . LYS A 124 ? 0.877 0.968 0.467 -0.031 -0.035 0.074 130 LYS AAA CA 827 C C . LYS A 124 ? 0.811 0.883 0.414 -0.031 -0.040 0.068 130 LYS AAA C 828 O O . LYS A 124 ? 0.823 0.860 0.419 -0.034 -0.051 0.075 130 LYS AAA O 829 C CB . LYS A 124 ? 0.888 1.004 0.475 -0.048 -0.021 0.081 130 LYS AAA CB 830 C CG . LYS A 124 ? 0.946 1.045 0.522 -0.068 -0.022 0.100 130 LYS AAA CG 831 C CD . LYS A 124 ? 0.967 1.096 0.554 -0.086 -0.009 0.101 130 LYS AAA CD 832 C CE . LYS A 124 ? 1.003 1.111 0.589 -0.108 -0.012 0.117 130 LYS AAA CE 833 N NZ . LYS A 124 ? 0.991 1.135 0.596 -0.123 0.000 0.114 130 LYS AAA NZ 834 N N . GLU A 125 ? 0.777 0.870 0.399 -0.027 -0.034 0.054 131 GLU AAA N 835 C CA . GLU A 125 ? 0.819 0.901 0.453 -0.025 -0.039 0.045 131 GLU AAA CA 836 C C . GLU A 125 ? 0.826 0.884 0.456 -0.008 -0.052 0.038 131 GLU AAA C 837 O O . GLU A 125 ? 0.827 0.858 0.456 -0.008 -0.061 0.034 131 GLU AAA O 838 C CB . GLU A 125 ? 0.807 0.921 0.458 -0.022 -0.030 0.033 131 GLU AAA CB 839 C CG . GLU A 125 ? 0.819 0.929 0.479 -0.019 -0.036 0.023 131 GLU AAA CG 840 C CD . GLU A 125 ? 0.917 1.004 0.576 -0.034 -0.043 0.025 131 GLU AAA CD 841 O OE1 . GLU A 125 ? 0.987 1.080 0.647 -0.051 -0.038 0.036 131 GLU AAA OE1 842 O OE2 . GLU A 125 ? 0.968 1.033 0.625 -0.028 -0.054 0.016 131 GLU AAA OE2 843 N N . LEU A 126 ? 0.830 0.899 0.459 0.007 -0.052 0.035 132 LEU AAA N 844 C CA . LEU A 126 ? 0.868 0.924 0.496 0.027 -0.063 0.027 132 LEU AAA CA 845 C C . LEU A 126 ? 0.951 0.965 0.564 0.028 -0.077 0.037 132 LEU AAA C 846 O O . LEU A 126 ? 1.061 1.050 0.675 0.039 -0.087 0.029 132 LEU AAA O 847 C CB . LEU A 126 ? 0.819 0.902 0.452 0.038 -0.060 0.025 132 LEU AAA CB 848 C CG . LEU A 126 ? 0.830 0.911 0.466 0.059 -0.069 0.017 132 LEU AAA CG 849 C CD1 . LEU A 126 ? 0.848 0.936 0.495 0.069 -0.069 0.002 132 LEU AAA CD1 850 C CD2 . LEU A 126 ? 0.827 0.938 0.470 0.066 -0.067 0.016 132 LEU AAA CD2 851 N N . GLN A 127 ? 0.993 0.999 0.592 0.018 -0.077 0.054 133 GLN AAA N 852 C CA . GLN A 127 ? 1.120 1.082 0.702 0.018 -0.092 0.068 133 GLN AAA CA 853 C C . GLN A 127 ? 1.104 1.032 0.687 0.006 -0.098 0.069 133 GLN AAA C 854 O O . GLN A 127 ? 1.143 1.029 0.721 0.016 -0.113 0.069 133 GLN AAA O 855 C CB . GLN A 127 ? 1.221 1.187 0.784 0.006 -0.089 0.089 133 GLN AAA CB 856 C CG . GLN A 127 ? 1.280 1.273 0.838 0.019 -0.089 0.088 133 GLN AAA CG 857 C CD . GLN A 127 ? 1.502 1.501 1.039 0.006 -0.086 0.107 133 GLN AAA CD 858 O OE1 . GLN A 127 ? 1.613 1.642 1.149 -0.007 -0.072 0.107 133 GLN AAA OE1 859 N NE2 . GLN A 127 ? 1.625 1.595 1.142 0.010 -0.100 0.124 133 GLN AAA NE2 860 N N . LYS A 128 ? 1.084 1.028 0.675 -0.014 -0.087 0.069 134 LYS AAA N 861 C CA . LYS A 128 ? 1.139 1.057 0.734 -0.031 -0.092 0.069 134 LYS AAA CA 862 C C . LYS A 128 ? 1.116 1.022 0.722 -0.015 -0.100 0.046 134 LYS AAA C 863 O O . LYS A 128 ? 1.168 1.032 0.772 -0.020 -0.113 0.043 134 LYS AAA O 864 C CB . LYS A 128 ? 1.200 1.151 0.804 -0.054 -0.077 0.073 134 LYS AAA CB 865 C CG . LYS A 128 ? 1.300 1.241 0.916 -0.070 -0.080 0.067 134 LYS AAA CG 866 C CD . LYS A 128 ? 1.353 1.335 0.981 -0.091 -0.066 0.071 134 LYS AAA CD 867 C CE . LYS A 128 ? 1.318 1.314 0.964 -0.095 -0.067 0.055 134 LYS AAA CE 868 N NZ . LYS A 128 ? 1.419 1.370 1.065 -0.102 -0.084 0.049 134 LYS AAA NZ 869 N N . SER A 129 ? 1.033 0.975 0.649 0.002 -0.093 0.030 135 SER AAA N 870 C CA . SER A 129 ? 0.990 0.933 0.614 0.018 -0.098 0.007 135 SER AAA CA 871 C C . SER A 129 ? 1.016 0.937 0.635 0.044 -0.111 -0.002 135 SER AAA C 872 O O . SER A 129 ? 1.024 0.939 0.647 0.059 -0.117 -0.022 135 SER AAA O 873 C CB . SER A 129 ? 0.904 0.898 0.540 0.023 -0.084 -0.003 135 SER AAA CB 874 O OG . SER A 129 ? 0.846 0.859 0.489 0.003 -0.076 0.002 135 SER AAA OG 875 N N . GLU A 130 ? 0.990 0.904 0.601 0.051 -0.114 0.011 136 GLU AAA N 876 C CA . GLU A 130 ? 1.021 0.928 0.631 0.079 -0.124 0.004 136 GLU AAA CA 877 C C . GLU A 130 ? 0.986 0.946 0.609 0.094 -0.113 -0.010 136 GLU AAA C 878 O O . GLU A 130 ? 0.990 0.973 0.615 0.103 -0.111 -0.005 136 GLU AAA O 879 C CB . GLU A 130 ? 1.101 0.960 0.708 0.094 -0.142 -0.008 136 GLU AAA CB 880 C CG . GLU A 130 ? 1.195 0.995 0.789 0.080 -0.156 0.010 136 GLU AAA CG 881 C CD . GLU A 130 ? 1.299 1.043 0.891 0.094 -0.176 -0.004 136 GLU AAA CD 882 O OE1 . GLU A 130 ? 1.371 1.122 0.969 0.124 -0.181 -0.026 136 GLU AAA OE1 883 O OE2 . GLU A 130 ? 1.331 1.026 0.917 0.074 -0.186 0.005 136 GLU AAA OE2 884 N N . LYS A 131 ? 1.015 0.994 0.647 0.096 -0.108 -0.027 137 LYS AAA N 885 C CA . LYS A 131 ? 0.975 1.006 0.619 0.107 -0.096 -0.038 137 LYS AAA CA 886 C C . LYS A 131 ? 0.894 0.945 0.542 0.093 -0.086 -0.043 137 LYS AAA C 887 O O . LYS A 131 ? 0.917 0.941 0.560 0.082 -0.092 -0.045 137 LYS AAA O 888 C CB . LYS A 131 ? 1.010 1.048 0.659 0.136 -0.103 -0.056 137 LYS AAA CB 889 C CG . LYS A 131 ? 1.070 1.064 0.711 0.147 -0.118 -0.072 137 LYS AAA CG 890 C CD . LYS A 131 ? 1.115 1.110 0.760 0.179 -0.127 -0.089 137 LYS AAA CD 891 C CE . LYS A 131 ? 1.272 1.204 0.908 0.189 -0.148 -0.092 137 LYS AAA CE 892 N NZ . LYS A 131 ? 1.420 1.352 1.060 0.223 -0.157 -0.119 137 LYS AAA NZ 893 N N . LEU A 132 ? 0.834 0.929 0.491 0.093 -0.073 -0.043 138 LEU AAA N 894 C CA . LEU A 132 ? 0.865 0.983 0.526 0.084 -0.065 -0.046 138 LEU AAA CA 895 C C . LEU A 132 ? 0.945 1.086 0.607 0.101 -0.064 -0.063 138 LEU AAA C 896 O O . LEU A 132 ? 1.000 1.162 0.666 0.117 -0.063 -0.068 138 LEU AAA O 897 C CB . LEU A 132 ? 0.822 0.970 0.491 0.073 -0.052 -0.032 138 LEU AAA CB 898 C CG . LEU A 132 ? 0.814 0.950 0.482 0.053 -0.048 -0.020 138 LEU AAA CG 899 C CD1 . LEU A 132 ? 0.834 0.937 0.493 0.048 -0.056 -0.012 138 LEU AAA CD1 900 C CD2 . LEU A 132 ? 0.759 0.922 0.437 0.046 -0.037 -0.011 138 LEU AAA CD2 901 N N . ASP A 133 ? 0.978 1.119 0.636 0.097 -0.067 -0.073 139 ASP AAA N 902 C CA . ASP A 133 ? 0.988 1.157 0.643 0.112 -0.066 -0.090 139 ASP AAA CA 903 C C . ASP A 133 ? 0.968 1.187 0.631 0.113 -0.051 -0.081 139 ASP AAA C 904 O O . ASP A 133 ? 0.983 1.207 0.654 0.100 -0.044 -0.063 139 ASP AAA O 905 C CB . ASP A 133 ? 1.035 1.196 0.683 0.104 -0.072 -0.101 139 ASP AAA CB 906 C CG . ASP A 133 ? 1.050 1.219 0.703 0.082 -0.066 -0.086 139 ASP AAA CG 907 O OD1 . ASP A 133 ? 1.041 1.239 0.701 0.078 -0.054 -0.071 139 ASP AAA OD1 908 O OD2 . ASP A 133 ? 1.154 1.300 0.806 0.069 -0.074 -0.089 139 ASP AAA OD2 909 N N . GLU A 134 ? 0.966 1.220 0.626 0.127 -0.047 -0.092 140 GLU AAA N 910 C CA . GLU A 134 ? 0.896 1.199 0.562 0.127 -0.033 -0.081 140 GLU AAA CA 911 C C . GLU A 134 ? 0.849 1.160 0.517 0.109 -0.027 -0.064 140 GLU AAA C 912 O O . GLU A 134 ? 0.851 1.184 0.529 0.102 -0.017 -0.048 140 GLU AAA O 913 C CB . GLU A 134 ? 0.916 1.257 0.575 0.145 -0.030 -0.097 140 GLU AAA CB 914 C CG . GLU A 134 ? 0.947 1.282 0.605 0.167 -0.037 -0.118 140 GLU AAA CG 915 C CD . GLU A 134 ? 0.995 1.377 0.646 0.187 -0.032 -0.135 140 GLU AAA CD 916 O OE1 . GLU A 134 ? 0.946 1.378 0.602 0.183 -0.018 -0.121 140 GLU AAA OE1 917 O OE2 . GLU A 134 ? 1.093 1.464 0.735 0.206 -0.041 -0.161 140 GLU AAA OE2 918 N N . GLN A 135 ? 0.829 1.121 0.490 0.101 -0.034 -0.069 141 GLN AAA N 919 C CA . GLN A 135 ? 0.831 1.135 0.495 0.088 -0.031 -0.056 141 GLN AAA CA 920 C C . GLN A 135 ? 0.767 1.056 0.444 0.074 -0.026 -0.038 141 GLN AAA C 921 O O . GLN A 135 ? 0.688 0.996 0.373 0.070 -0.018 -0.023 141 GLN AAA O 922 C CB . GLN A 135 ? 0.917 1.206 0.572 0.083 -0.041 -0.069 141 GLN AAA CB 923 C CG . GLN A 135 ? 1.004 1.322 0.658 0.078 -0.039 -0.062 141 GLN AAA CG 924 C CD . GLN A 135 ? 1.110 1.421 0.755 0.075 -0.052 -0.078 141 GLN AAA CD 925 O OE1 . GLN A 135 ? 0.981 1.308 0.612 0.086 -0.057 -0.095 141 GLN AAA OE1 926 N NE2 . GLN A 135 ? 1.162 1.452 0.817 0.060 -0.057 -0.075 141 GLN AAA NE2 927 N N . ARG A 136 ? 0.745 0.999 0.422 0.068 -0.032 -0.040 142 ARG AAA N 928 C CA . ARG A 136 ? 0.724 0.965 0.410 0.055 -0.028 -0.027 142 ARG AAA CA 929 C C . ARG A 136 ? 0.687 0.939 0.380 0.058 -0.021 -0.018 142 ARG AAA C 930 O O . ARG A 136 ? 0.666 0.924 0.368 0.050 -0.015 -0.007 142 ARG AAA O 931 C CB . ARG A 136 ? 0.774 0.980 0.456 0.049 -0.036 -0.030 142 ARG AAA CB 932 C CG . ARG A 136 ? 0.860 1.054 0.538 0.041 -0.044 -0.038 142 ARG AAA CG 933 C CD . ARG A 136 ? 0.917 1.072 0.590 0.034 -0.053 -0.040 142 ARG AAA CD 934 N NE . ARG A 136 ? 0.946 1.093 0.622 0.020 -0.048 -0.026 142 ARG AAA NE 935 C CZ . ARG A 136 ? 1.075 1.192 0.747 0.012 -0.053 -0.020 142 ARG AAA CZ 936 N NH1 . ARG A 136 ? 1.145 1.229 0.808 0.016 -0.065 -0.028 142 ARG AAA NH1 937 N NH2 . ARG A 136 ? 1.075 1.193 0.748 -0.000 -0.047 -0.007 142 ARG AAA NH2 938 N N . THR A 137 ? 0.668 0.924 0.360 0.070 -0.023 -0.024 143 THR AAA N 939 C CA . THR A 137 ? 0.646 0.916 0.346 0.073 -0.018 -0.019 143 THR AAA CA 940 C C . THR A 137 ? 0.640 0.943 0.350 0.069 -0.008 -0.008 143 THR AAA C 941 O O . THR A 137 ? 0.675 0.979 0.395 0.061 -0.004 0.002 143 THR AAA O 942 C CB . THR A 137 ? 0.647 0.921 0.346 0.089 -0.023 -0.030 143 THR AAA CB 943 O OG1 . THR A 137 ? 0.649 0.886 0.339 0.090 -0.033 -0.036 143 THR AAA OG1 944 C CG2 . THR A 137 ? 0.634 0.930 0.345 0.092 -0.019 -0.025 143 THR AAA CG2 945 N N . ALA A 138 ? 0.626 0.953 0.331 0.075 -0.006 -0.011 144 ALA AAA N 946 C CA . ALA A 138 ? 0.631 0.990 0.341 0.072 0.003 0.002 144 ALA AAA CA 947 C C . ALA A 138 ? 0.609 0.959 0.324 0.060 0.005 0.016 144 ALA AAA C 948 O O . ALA A 138 ? 0.644 1.006 0.369 0.054 0.010 0.031 144 ALA AAA O 949 C CB . ALA A 138 ? 0.627 1.016 0.326 0.083 0.005 -0.005 144 ALA AAA CB 950 N N . THR A 139 ? 0.567 0.896 0.276 0.058 -0.001 0.010 145 THR AAA N 951 C CA . THR A 139 ? 0.570 0.891 0.285 0.050 -0.001 0.020 145 THR AAA CA 952 C C . THR A 139 ? 0.555 0.860 0.282 0.043 0.002 0.027 145 THR AAA C 953 O O . THR A 139 ? 0.555 0.862 0.292 0.039 0.005 0.038 145 THR AAA O 954 C CB . THR A 139 ? 0.590 0.899 0.300 0.049 -0.007 0.012 145 THR AAA CB 955 O OG1 . THR A 139 ? 0.555 0.878 0.252 0.055 -0.012 0.002 145 THR AAA OG1 956 C CG2 . THR A 139 ? 0.582 0.892 0.300 0.043 -0.007 0.021 145 THR AAA CG2 957 N N . ILE A 140 ? 0.553 0.841 0.279 0.043 -0.000 0.019 146 ILE AAA N 958 C CA . ILE A 140 ? 0.558 0.834 0.292 0.037 0.001 0.021 146 ILE AAA CA 959 C C . ILE A 140 ? 0.559 0.848 0.304 0.034 0.005 0.029 146 ILE AAA C 960 O O . ILE A 140 ? 0.581 0.864 0.336 0.028 0.007 0.036 146 ILE AAA O 961 C CB . ILE A 140 ? 0.563 0.821 0.288 0.037 -0.003 0.013 146 ILE AAA CB 962 C CG1 . ILE A 140 ? 0.559 0.802 0.277 0.033 -0.006 0.009 146 ILE AAA CG1 963 C CG2 . ILE A 140 ? 0.589 0.841 0.320 0.033 -0.003 0.014 146 ILE AAA CG2 964 C CD1 . ILE A 140 ? 0.557 0.782 0.264 0.035 -0.013 0.003 146 ILE AAA CD1 965 N N . ILE A 141 ? 0.535 0.844 0.280 0.039 0.006 0.028 147 ILE AAA N 966 C CA . ILE A 141 ? 0.540 0.869 0.298 0.035 0.010 0.035 147 ILE AAA CA 967 C C . ILE A 141 ? 0.554 0.887 0.320 0.027 0.014 0.051 147 ILE AAA C 968 O O . ILE A 141 ? 0.534 0.865 0.315 0.017 0.016 0.059 147 ILE AAA O 969 C CB . ILE A 141 ? 0.551 0.909 0.307 0.044 0.012 0.030 147 ILE AAA CB 970 C CG1 . ILE A 141 ? 0.587 0.934 0.337 0.054 0.005 0.016 147 ILE AAA CG1 971 C CG2 . ILE A 141 ? 0.537 0.924 0.310 0.037 0.017 0.041 147 ILE AAA CG2 972 C CD1 . ILE A 141 ? 0.594 0.931 0.353 0.048 0.001 0.015 147 ILE AAA CD1 973 N N . GLU A 142 ? 0.602 0.942 0.360 0.031 0.016 0.057 148 GLU AAA N 974 C CA . GLU A 142 ? 0.643 0.986 0.407 0.025 0.018 0.075 148 GLU AAA CA 975 C C . GLU A 142 ? 0.659 0.970 0.431 0.021 0.015 0.075 148 GLU AAA C 976 O O . GLU A 142 ? 0.624 0.926 0.410 0.013 0.015 0.086 148 GLU AAA O 977 C CB . GLU A 142 ? 0.654 1.015 0.404 0.032 0.018 0.079 148 GLU AAA CB 978 C CG . GLU A 142 ? 0.654 1.016 0.407 0.028 0.019 0.100 148 GLU AAA CG 979 C CD . GLU A 142 ? 0.653 1.037 0.390 0.035 0.018 0.105 148 GLU AAA CD 980 O OE1 . GLU A 142 ? 0.695 1.086 0.432 0.033 0.018 0.126 148 GLU AAA OE1 981 O OE2 . GLU A 142 ? 0.607 1.000 0.331 0.043 0.015 0.089 148 GLU AAA OE2 982 N N . GLU A 143 ? 0.673 0.971 0.438 0.027 0.011 0.064 149 GLU AAA N 983 C CA . GLU A 143 ? 0.727 1.002 0.499 0.026 0.009 0.060 149 GLU AAA CA 984 C C . GLU A 143 ? 0.702 0.963 0.485 0.019 0.009 0.058 149 GLU AAA C 985 O O . GLU A 143 ? 0.715 0.960 0.509 0.017 0.008 0.063 149 GLU AAA O 986 C CB . GLU A 143 ? 0.757 1.027 0.520 0.029 0.007 0.047 149 GLU AAA CB 987 C CG . GLU A 143 ? 0.780 1.061 0.538 0.034 0.005 0.048 149 GLU AAA CG 988 C CD . GLU A 143 ? 0.827 1.105 0.580 0.033 0.003 0.037 149 GLU AAA CD 989 O OE1 . GLU A 143 ? 0.923 1.205 0.682 0.035 0.002 0.037 149 GLU AAA OE1 990 O OE2 . GLU A 143 ? 0.755 1.027 0.500 0.031 0.002 0.028 149 GLU AAA OE2 991 N N . LEU A 144 ? 0.624 0.889 0.404 0.017 0.009 0.049 150 LEU AAA N 992 C CA . LEU A 144 ? 0.671 0.927 0.460 0.010 0.007 0.044 150 LEU AAA CA 993 C C . LEU A 144 ? 0.695 0.955 0.500 0.001 0.008 0.057 150 LEU AAA C 994 O O . LEU A 144 ? 0.767 1.007 0.583 -0.005 0.005 0.056 150 LEU AAA O 995 C CB . LEU A 144 ? 0.676 0.940 0.457 0.012 0.005 0.035 150 LEU AAA CB 996 C CG . LEU A 144 ? 0.639 0.891 0.406 0.016 0.003 0.024 150 LEU AAA CG 997 C CD1 . LEU A 144 ? 0.630 0.889 0.388 0.020 -0.001 0.018 150 LEU AAA CD1 998 C CD2 . LEU A 144 ? 0.629 0.865 0.399 0.013 0.002 0.017 150 LEU AAA CD2 999 N N . ALA A 145 ? 0.644 0.928 0.448 -0.000 0.011 0.067 151 ALA AAA N 1000 C CA . ALA A 145 ? 0.660 0.954 0.480 -0.012 0.013 0.084 151 ALA AAA CA 1001 C C . ALA A 145 ? 0.653 0.921 0.480 -0.016 0.011 0.096 151 ALA AAA C 1002 O O . ALA A 145 ? 0.685 0.940 0.528 -0.028 0.009 0.104 151 ALA AAA O 1003 C CB . ALA A 145 ? 0.687 1.017 0.502 -0.011 0.020 0.094 151 ALA AAA CB 1004 N N . ASP A 146 ? 0.641 0.901 0.458 -0.005 0.011 0.096 152 ASP AAA N 1005 C CA . ASP A 146 ? 0.692 0.929 0.515 -0.004 0.007 0.108 152 ASP AAA CA 1006 C C . ASP A 146 ? 0.652 0.857 0.486 -0.004 0.002 0.095 152 ASP AAA C 1007 O O . ASP A 146 ? 0.641 0.822 0.490 -0.012 -0.002 0.103 152 ASP AAA O 1008 C CB . ASP A 146 ? 0.729 0.973 0.540 0.009 0.007 0.111 152 ASP AAA CB 1009 C CG . ASP A 146 ? 0.778 1.005 0.597 0.013 0.003 0.127 152 ASP AAA CG 1010 O OD1 . ASP A 146 ? 0.778 0.990 0.608 0.004 0.001 0.144 152 ASP AAA OD1 1011 O OD2 . ASP A 146 ? 0.814 1.042 0.628 0.025 -0.000 0.125 152 ASP AAA OD2 1012 N N . ALA A 147 ? 0.648 0.850 0.474 0.004 0.002 0.075 153 ALA AAA N 1013 C CA . ALA A 147 ? 0.667 0.846 0.498 0.007 -0.001 0.057 153 ALA AAA CA 1014 C C . ALA A 147 ? 0.661 0.825 0.504 -0.006 -0.005 0.054 153 ALA AAA C 1015 O O . ALA A 147 ? 0.661 0.797 0.514 -0.006 -0.011 0.047 153 ALA AAA O 1016 C CB . ALA A 147 ? 0.644 0.834 0.461 0.013 0.001 0.040 153 ALA AAA CB 1017 N N . LEU A 148 ? 0.652 0.838 0.496 -0.016 -0.004 0.058 154 LEU AAA N 1018 C CA . LEU A 148 ? 0.704 0.884 0.562 -0.030 -0.008 0.055 154 LEU AAA CA 1019 C C . LEU A 148 ? 0.756 0.921 0.632 -0.043 -0.011 0.074 154 LEU AAA C 1020 O O . LEU A 148 ? 0.780 0.921 0.671 -0.053 -0.018 0.068 154 LEU AAA O 1021 C CB . LEU A 148 ? 0.714 0.928 0.568 -0.034 -0.006 0.053 154 LEU AAA CB 1022 C CG . LEU A 148 ? 0.719 0.939 0.557 -0.025 -0.007 0.034 154 LEU AAA CG 1023 C CD1 . LEU A 148 ? 0.691 0.942 0.523 -0.023 -0.005 0.035 154 LEU AAA CD1 1024 C CD2 . LEU A 148 ? 0.701 0.905 0.542 -0.029 -0.014 0.016 154 LEU AAA CD2 1025 N N . THR A 149 ? 0.769 0.948 0.644 -0.044 -0.006 0.097 155 THR AAA N 1026 C CA . THR A 149 ? 0.781 0.944 0.670 -0.056 -0.008 0.122 155 THR AAA CA 1027 C C . THR A 149 ? 0.811 0.925 0.708 -0.050 -0.017 0.118 155 THR AAA C 1028 O O . THR A 149 ? 0.825 0.910 0.740 -0.064 -0.024 0.123 155 THR AAA O 1029 C CB . THR A 149 ? 0.786 0.974 0.666 -0.053 -0.001 0.147 155 THR AAA CB 1030 O OG1 . THR A 149 ? 0.777 1.010 0.649 -0.056 0.007 0.147 155 THR AAA OG1 1031 C CG2 . THR A 149 ? 0.795 0.968 0.686 -0.067 -0.003 0.177 155 THR AAA CG2 1032 N N . TYR A 150 ? 0.827 0.935 0.713 -0.030 -0.017 0.108 156 TYR AAA N 1033 C CA . TYR A 150 ? 0.869 0.938 0.761 -0.018 -0.024 0.097 156 TYR AAA CA 1034 C C . TYR A 150 ? 0.886 0.930 0.787 -0.023 -0.030 0.072 156 TYR AAA C 1035 O O . TYR A 150 ? 0.935 0.939 0.852 -0.026 -0.039 0.071 156 TYR AAA O 1036 C CB . TYR A 150 ? 0.856 0.939 0.735 0.003 -0.020 0.086 156 TYR AAA CB 1037 C CG . TYR A 150 ? 0.899 0.952 0.785 0.020 -0.026 0.073 156 TYR AAA CG 1038 C CD1 . TYR A 150 ? 0.938 0.959 0.837 0.024 -0.034 0.089 156 TYR AAA CD1 1039 C CD2 . TYR A 150 ? 0.932 0.991 0.813 0.032 -0.024 0.046 156 TYR AAA CD2 1040 C CE1 . TYR A 150 ? 0.980 0.975 0.888 0.043 -0.040 0.076 156 TYR AAA CE1 1041 C CE2 . TYR A 150 ? 0.960 0.999 0.849 0.050 -0.028 0.033 156 TYR AAA CE2 1042 C CZ . TYR A 150 ? 0.976 0.983 0.880 0.057 -0.037 0.046 156 TYR AAA CZ 1043 O OH . TYR A 150 ? 0.980 0.967 0.894 0.077 -0.042 0.031 156 TYR AAA OH 1044 N N . CYS A 151 ? 0.861 0.929 0.753 -0.025 -0.027 0.053 157 CYS AAA N 1045 C CA . CYS A 151 ? 0.918 0.970 0.813 -0.028 -0.033 0.026 157 CYS AAA CA 1046 C C . CYS A 151 ? 0.993 1.026 0.908 -0.050 -0.041 0.031 157 CYS AAA C 1047 O O . CYS A 151 ? 1.066 1.066 0.990 -0.051 -0.051 0.012 157 CYS AAA O 1048 C CB . CYS A 151 ? 0.885 0.970 0.763 -0.026 -0.028 0.010 157 CYS AAA CB 1049 S SG . CYS A 151 ? 0.850 0.945 0.709 -0.004 -0.022 -0.007 157 CYS AAA SG 1050 N N . HIS A 152 ? 0.995 1.050 0.918 -0.067 -0.038 0.055 158 HIS AAA N 1051 C CA . HIS A 152 ? 1.035 1.080 0.980 -0.092 -0.045 0.063 158 HIS AAA CA 1052 C C . HIS A 152 ? 1.028 1.028 0.988 -0.099 -0.051 0.083 158 HIS AAA C 1053 O O . HIS A 152 ? 1.028 0.995 1.007 -0.115 -0.062 0.078 158 HIS AAA O 1054 C CB . HIS A 152 ? 1.065 1.160 1.013 -0.107 -0.037 0.079 158 HIS AAA CB 1055 C CG . HIS A 152 ? 1.131 1.264 1.064 -0.097 -0.033 0.061 158 HIS AAA CG 1056 N ND1 . HIS A 152 ? 1.250 1.373 1.166 -0.081 -0.035 0.035 158 HIS AAA ND1 1057 C CD2 . HIS A 152 ? 1.110 1.289 1.042 -0.101 -0.027 0.066 158 HIS AAA CD2 1058 C CE1 . HIS A 152 ? 1.183 1.342 1.087 -0.076 -0.032 0.027 158 HIS AAA CE1 1059 N NE2 . HIS A 152 ? 1.121 1.313 1.035 -0.087 -0.027 0.045 158 HIS AAA NE2 1060 N N . ASP A 153 ? 1.041 1.039 0.994 -0.087 -0.046 0.105 159 ASP AAA N 1061 C CA . ASP A 153 ? 1.097 1.050 1.062 -0.089 -0.054 0.127 159 ASP AAA CA 1062 C C . ASP A 153 ? 1.085 0.984 1.058 -0.078 -0.067 0.101 159 ASP AAA C 1063 O O . ASP A 153 ? 1.071 0.925 1.063 -0.092 -0.078 0.107 159 ASP AAA O 1064 C CB . ASP A 153 ? 1.112 1.078 1.063 -0.073 -0.048 0.150 159 ASP AAA CB 1065 C CG . ASP A 153 ? 1.142 1.143 1.090 -0.088 -0.040 0.185 159 ASP AAA CG 1066 O OD1 . ASP A 153 ? 1.155 1.181 1.111 -0.110 -0.036 0.189 159 ASP AAA OD1 1067 O OD2 . ASP A 153 ? 1.169 1.175 1.107 -0.078 -0.037 0.207 159 ASP AAA OD2 1068 N N . LYS A 154 ? 1.103 1.009 1.062 -0.054 -0.064 0.072 160 LYS AAA N 1069 C CA . LYS A 154 ? 1.147 1.011 1.111 -0.036 -0.074 0.043 160 LYS AAA CA 1070 C C . LYS A 154 ? 1.156 1.011 1.125 -0.047 -0.081 0.012 160 LYS AAA C 1071 O O . LYS A 154 ? 1.179 1.001 1.151 -0.034 -0.089 -0.016 160 LYS AAA O 1072 C CB . LYS A 154 ? 1.125 1.011 1.073 -0.007 -0.067 0.029 160 LYS AAA CB 1073 C CG . LYS A 154 ? 1.121 1.021 1.063 0.004 -0.061 0.057 160 LYS AAA CG 1074 C CD . LYS A 154 ? 1.169 1.022 1.127 0.011 -0.072 0.077 160 LYS AAA CD 1075 C CE . LYS A 154 ? 1.175 1.047 1.125 0.024 -0.068 0.103 160 LYS AAA CE 1076 N NZ . LYS A 154 ? 1.221 1.052 1.183 0.022 -0.079 0.135 160 LYS AAA NZ 1077 N N . LYS A 155 ? 1.151 1.037 1.121 -0.070 -0.078 0.016 161 LYS AAA N 1078 C CA . LYS A 155 ? 1.178 1.061 1.155 -0.086 -0.087 -0.009 161 LYS AAA CA 1079 C C . LYS A 155 ? 1.149 1.039 1.107 -0.065 -0.087 -0.048 161 LYS AAA C 1080 O O . LYS A 155 ? 1.236 1.093 1.201 -0.064 -0.098 -0.075 161 LYS AAA O 1081 C CB . LYS A 155 ? 1.239 1.066 1.242 -0.104 -0.102 -0.008 161 LYS AAA CB 1082 C CG . LYS A 155 ? 1.257 1.085 1.279 -0.134 -0.103 0.030 161 LYS AAA CG 1083 C CD . LYS A 155 ? 1.322 1.131 1.369 -0.165 -0.116 0.023 161 LYS AAA CD 1084 C CE . LYS A 155 ? 1.432 1.165 1.496 -0.167 -0.134 0.010 161 LYS AAA CE 1085 N NZ . LYS A 155 ? 1.483 1.179 1.567 -0.186 -0.138 0.051 161 LYS AAA NZ 1086 N N . VAL A 156 ? 1.061 0.995 0.997 -0.052 -0.074 -0.049 162 VAL AAA N 1087 C CA . VAL A 156 ? 1.006 0.957 0.921 -0.033 -0.071 -0.080 162 VAL AAA CA 1088 C C . VAL A 156 ? 0.943 0.943 0.842 -0.039 -0.064 -0.080 162 VAL AAA C 1089 O O . VAL A 156 ? 0.890 0.916 0.790 -0.048 -0.058 -0.055 162 VAL AAA O 1090 C CB . VAL A 156 ? 0.973 0.925 0.878 -0.008 -0.063 -0.080 162 VAL AAA CB 1091 C CG1 . VAL A 156 ? 1.010 0.913 0.933 0.002 -0.071 -0.081 162 VAL AAA CG1 1092 C CG2 . VAL A 156 ? 0.907 0.893 0.804 -0.005 -0.051 -0.053 162 VAL AAA CG2 1093 N N . ILE A 157 ? 0.950 0.962 0.833 -0.034 -0.067 -0.108 163 ILE AAA N 1094 C CA . ILE A 157 ? 0.931 0.986 0.795 -0.035 -0.062 -0.109 163 ILE AAA CA 1095 C C . ILE A 157 ? 0.881 0.958 0.726 -0.019 -0.049 -0.099 163 ILE AAA C 1096 O O . ILE A 157 ? 0.918 0.980 0.764 -0.005 -0.045 -0.101 163 ILE AAA O 1097 C CB . ILE A 157 ? 0.990 1.051 0.840 -0.034 -0.070 -0.141 163 ILE AAA CB 1098 C CG1 . ILE A 157 ? 1.084 1.130 0.920 -0.015 -0.069 -0.166 163 ILE AAA CG1 1099 C CG2 . ILE A 157 ? 1.010 1.056 0.880 -0.054 -0.085 -0.150 163 ILE AAA CG2 1100 C CD1 . ILE A 157 ? 1.127 1.192 0.940 -0.010 -0.073 -0.195 163 ILE AAA CD1 1101 N N . HIS A 158 ? 0.835 0.944 0.667 -0.021 -0.043 -0.087 164 HIS AAA N 1102 C CA . HIS A 158 ? 0.826 0.956 0.641 -0.009 -0.032 -0.077 164 HIS AAA CA 1103 C C . HIS A 158 ? 0.875 1.032 0.669 -0.010 -0.032 -0.082 164 HIS AAA C 1104 O O . HIS A 158 ? 0.915 1.080 0.712 -0.020 -0.040 -0.086 164 HIS AAA O 1105 C CB . HIS A 158 ? 0.778 0.913 0.603 -0.012 -0.027 -0.051 164 HIS AAA CB 1106 C CG . HIS A 158 ? 0.738 0.891 0.570 -0.025 -0.029 -0.038 164 HIS AAA CG 1107 N ND1 . HIS A 158 ? 0.681 0.861 0.499 -0.023 -0.027 -0.036 164 HIS AAA ND1 1108 C CD2 . HIS A 158 ? 0.740 0.890 0.593 -0.039 -0.033 -0.028 164 HIS AAA CD2 1109 C CE1 . HIS A 158 ? 0.676 0.872 0.507 -0.033 -0.030 -0.027 164 HIS AAA CE1 1110 N NE2 . HIS A 158 ? 0.705 0.886 0.558 -0.045 -0.033 -0.021 164 HIS AAA NE2 1111 N N . ARG A 159 ? 0.872 1.042 0.645 0.000 -0.024 -0.081 165 ARG AAA N 1112 C CA . ARG A 159 ? 0.904 1.096 0.655 0.000 -0.024 -0.080 165 ARG AAA CA 1113 C C . ARG A 159 ? 0.927 1.130 0.684 -0.005 -0.027 -0.063 165 ARG AAA C 1114 O O . ARG A 159 ? 0.926 1.129 0.690 -0.003 -0.021 -0.048 165 ARG AAA O 1115 C CB . ARG A 159 ? 0.911 1.112 0.644 0.009 -0.015 -0.078 165 ARG AAA CB 1116 C CG . ARG A 159 ? 0.942 1.160 0.648 0.009 -0.015 -0.077 165 ARG AAA CG 1117 C CD . ARG A 159 ? 0.951 1.178 0.638 0.015 -0.008 -0.087 165 ARG AAA CD 1118 N NE . ARG A 159 ? 1.019 1.260 0.683 0.013 -0.005 -0.076 165 ARG AAA NE 1119 C CZ . ARG A 159 ? 1.112 1.368 0.755 0.015 0.002 -0.079 165 ARG AAA CZ 1120 N NH1 . ARG A 159 ? 1.129 1.393 0.751 0.011 0.004 -0.064 165 ARG AAA NH1 1121 N NH2 . ARG A 159 ? 1.093 1.357 0.738 0.021 0.008 -0.097 165 ARG AAA NH2 1122 N N . ASP A 160 ? 1.048 1.264 0.804 -0.010 -0.035 -0.067 166 ASP AAA N 1123 C CA . ASP A 160 ? 1.098 1.331 0.860 -0.012 -0.038 -0.054 166 ASP AAA CA 1124 C C . ASP A 160 ? 1.021 1.257 0.771 -0.004 -0.031 -0.040 166 ASP AAA C 1125 O O . ASP A 160 ? 0.980 1.212 0.710 0.001 -0.027 -0.042 166 ASP AAA O 1126 C CB . ASP A 160 ? 1.204 1.454 0.959 -0.014 -0.049 -0.062 166 ASP AAA CB 1127 C CG . ASP A 160 ? 1.367 1.639 1.129 -0.012 -0.053 -0.050 166 ASP AAA CG 1128 O OD1 . ASP A 160 ? 1.516 1.793 1.298 -0.015 -0.048 -0.040 166 ASP AAA OD1 1129 O OD2 . ASP A 160 ? 1.285 1.568 1.031 -0.006 -0.060 -0.051 166 ASP AAA OD2 1130 N N . ILE A 161 ? 0.934 1.178 0.696 -0.004 -0.029 -0.028 167 ILE AAA N 1131 C CA . ILE A 161 ? 0.936 1.180 0.689 0.004 -0.022 -0.017 167 ILE AAA CA 1132 C C . ILE A 161 ? 0.913 1.166 0.652 0.011 -0.028 -0.016 167 ILE AAA C 1133 O O . ILE A 161 ? 0.932 1.201 0.680 0.011 -0.035 -0.017 167 ILE AAA O 1134 C CB . ILE A 161 ? 0.908 1.157 0.678 0.002 -0.017 -0.007 167 ILE AAA CB 1135 C CG1 . ILE A 161 ? 0.897 1.169 0.681 0.001 -0.020 -0.002 167 ILE AAA CG1 1136 C CG2 . ILE A 161 ? 0.889 1.125 0.672 -0.004 -0.014 -0.007 167 ILE AAA CG2 1137 C CD1 . ILE A 161 ? 0.900 1.183 0.676 0.012 -0.019 0.002 167 ILE AAA CD1 1138 N N . LYS A 162 ? 0.881 1.123 0.601 0.016 -0.026 -0.012 168 LYS AAA N 1139 C CA . LYS A 162 ? 0.868 1.108 0.572 0.023 -0.033 -0.008 168 LYS AAA CA 1140 C C . LYS A 162 ? 0.828 1.051 0.514 0.023 -0.028 -0.002 168 LYS AAA C 1141 O O . LYS A 162 ? 0.847 1.067 0.530 0.017 -0.021 -0.005 168 LYS AAA O 1142 C CB . LYS A 162 ? 0.927 1.175 0.621 0.025 -0.043 -0.012 168 LYS AAA CB 1143 C CG . LYS A 162 ? 0.978 1.223 0.659 0.018 -0.043 -0.019 168 LYS AAA CG 1144 C CD . LYS A 162 ? 0.960 1.213 0.624 0.021 -0.054 -0.021 168 LYS AAA CD 1145 C CE . LYS A 162 ? 0.957 1.230 0.638 0.021 -0.064 -0.028 168 LYS AAA CE 1146 N NZ . LYS A 162 ? 0.969 1.249 0.648 0.014 -0.067 -0.043 168 LYS AAA NZ 1147 N N . PRO A 163 ? 0.835 1.048 0.511 0.028 -0.032 0.004 169 PRO AAA N 1148 C CA . PRO A 163 ? 0.861 1.058 0.526 0.025 -0.028 0.010 169 PRO AAA CA 1149 C C . PRO A 163 ? 0.856 1.052 0.507 0.016 -0.023 0.012 169 PRO AAA C 1150 O O . PRO A 163 ? 0.792 0.987 0.444 0.010 -0.016 0.013 169 PRO AAA O 1151 C CB . PRO A 163 ? 0.887 1.069 0.542 0.032 -0.037 0.016 169 PRO AAA CB 1152 C CG . PRO A 163 ? 0.887 1.082 0.555 0.043 -0.043 0.011 169 PRO AAA CG 1153 C CD . PRO A 163 ? 0.839 1.055 0.516 0.039 -0.042 0.006 169 PRO AAA CD 1154 N N . GLU A 164 ? 0.876 1.077 0.513 0.016 -0.028 0.011 170 GLU AAA N 1155 C CA . GLU A 164 ? 0.911 1.117 0.530 0.009 -0.023 0.011 170 GLU AAA CA 1156 C C . GLU A 164 ? 0.871 1.089 0.503 0.006 -0.013 -0.000 170 GLU AAA C 1157 O O . GLU A 164 ? 0.873 1.098 0.497 0.001 -0.004 0.000 170 GLU AAA O 1158 C CB . GLU A 164 ? 0.914 1.128 0.517 0.012 -0.032 0.010 170 GLU AAA CB 1159 C CG . GLU A 164 ? 0.951 1.154 0.542 0.018 -0.044 0.021 170 GLU AAA CG 1160 C CD . GLU A 164 ? 0.952 1.161 0.560 0.028 -0.054 0.015 170 GLU AAA CD 1161 O OE1 . GLU A 164 ? 0.956 1.167 0.587 0.029 -0.050 0.010 170 GLU AAA OE1 1162 O OE2 . GLU A 164 ? 0.973 1.189 0.573 0.033 -0.065 0.016 170 GLU AAA OE2 1163 N N . ASN A 165 ? 0.800 1.022 0.452 0.009 -0.014 -0.010 171 ASN AAA N 1164 C CA . ASN A 165 ? 0.778 1.005 0.444 0.009 -0.008 -0.022 171 ASN AAA CA 1165 C C . ASN A 165 ? 0.740 0.964 0.423 0.009 -0.001 -0.019 171 ASN AAA C 1166 O O . ASN A 165 ? 0.698 0.923 0.394 0.011 0.003 -0.027 171 ASN AAA O 1167 C CB . ASN A 165 ? 0.817 1.046 0.496 0.009 -0.015 -0.031 171 ASN AAA CB 1168 C CG . ASN A 165 ? 0.832 1.068 0.496 0.009 -0.022 -0.040 171 ASN AAA CG 1169 O OD1 . ASN A 165 ? 0.767 1.009 0.413 0.009 -0.019 -0.046 171 ASN AAA OD1 1170 N ND2 . ASN A 165 ? 0.819 1.060 0.492 0.008 -0.032 -0.042 171 ASN AAA ND2 1171 N N . LEU A 166 ? 0.709 0.928 0.391 0.009 -0.001 -0.008 172 LEU AAA N 1172 C CA . LEU A 166 ? 0.643 0.862 0.339 0.010 0.004 -0.004 172 LEU AAA CA 1173 C C . LEU A 166 ? 0.639 0.861 0.328 0.005 0.008 0.001 172 LEU AAA C 1174 O O . LEU A 166 ? 0.647 0.861 0.320 0.001 0.005 0.008 172 LEU AAA O 1175 C CB . LEU A 166 ? 0.619 0.835 0.322 0.013 -0.002 0.001 172 LEU AAA CB 1176 C CG . LEU A 166 ? 0.628 0.848 0.343 0.015 -0.005 -0.002 172 LEU AAA CG 1177 C CD1 . LEU A 166 ? 0.629 0.854 0.349 0.019 -0.008 0.003 172 LEU AAA CD1 1178 C CD2 . LEU A 166 ? 0.624 0.846 0.356 0.014 -0.001 -0.005 172 LEU AAA CD2 1179 N N . LEU A 167 ? 0.614 0.846 0.315 0.005 0.015 -0.001 173 LEU AAA N 1180 C CA . LEU A 167 ? 0.617 0.858 0.317 -0.001 0.019 0.003 173 LEU AAA CA 1181 C C . LEU A 167 ? 0.645 0.886 0.358 0.000 0.017 0.006 173 LEU AAA C 1182 O O . LEU A 167 ? 0.665 0.902 0.386 0.007 0.014 0.006 173 LEU AAA O 1183 C CB . LEU A 167 ? 0.599 0.860 0.303 -0.000 0.028 -0.004 173 LEU AAA CB 1184 C CG . LEU A 167 ? 0.608 0.874 0.294 -0.002 0.031 -0.008 173 LEU AAA CG 1185 C CD1 . LEU A 167 ? 0.596 0.881 0.290 0.005 0.039 -0.023 173 LEU AAA CD1 1186 C CD2 . LEU A 167 ? 0.617 0.890 0.286 -0.015 0.034 0.003 173 LEU AAA CD2 1187 N N . LEU A 168 ? 0.625 0.874 0.340 -0.007 0.019 0.010 174 LEU AAA N 1188 C CA . LEU A 168 ? 0.605 0.855 0.329 -0.007 0.014 0.012 174 LEU AAA CA 1189 C C . LEU A 168 ? 0.609 0.883 0.348 -0.009 0.019 0.011 174 LEU AAA C 1190 O O . LEU A 168 ? 0.586 0.873 0.324 -0.019 0.024 0.012 174 LEU AAA O 1191 C CB . LEU A 168 ? 0.625 0.858 0.337 -0.015 0.008 0.016 174 LEU AAA CB 1192 C CG . LEU A 168 ? 0.622 0.833 0.322 -0.009 0.001 0.017 174 LEU AAA CG 1193 C CD1 . LEU A 168 ? 0.630 0.819 0.317 -0.017 -0.007 0.020 174 LEU AAA CD1 1194 C CD2 . LEU A 168 ? 0.593 0.807 0.300 0.001 -0.002 0.013 174 LEU AAA CD2 1195 N N . GLY A 169 ? 0.611 0.895 0.364 -0.001 0.017 0.010 175 GLY AAA N 1196 C CA . GLY A 169 ? 0.614 0.924 0.384 -0.001 0.018 0.009 175 GLY AAA CA 1197 C C . GLY A 169 ? 0.598 0.914 0.369 -0.013 0.014 0.010 175 GLY AAA C 1198 O O . GLY A 169 ? 0.578 0.874 0.335 -0.022 0.009 0.012 175 GLY AAA O 1199 N N . PHE A 170 ? 0.607 0.952 0.396 -0.014 0.013 0.009 176 PHE AAA N 1200 C CA . PHE A 170 ? 0.649 1.006 0.443 -0.028 0.008 0.009 176 PHE AAA CA 1201 C C . PHE A 170 ? 0.653 0.990 0.436 -0.028 -0.004 0.007 176 PHE AAA C 1202 O O . PHE A 170 ? 0.681 1.010 0.461 -0.043 -0.010 0.006 176 PHE AAA O 1203 C CB . PHE A 170 ? 0.638 1.035 0.456 -0.025 0.008 0.007 176 PHE AAA CB 1204 C CG . PHE A 170 ? 0.628 1.041 0.455 -0.041 0.000 0.005 176 PHE AAA CG 1205 C CD1 . PHE A 170 ? 0.634 1.049 0.462 -0.063 0.002 0.008 176 PHE AAA CD1 1206 C CD2 . PHE A 170 ? 0.664 1.088 0.497 -0.035 -0.011 0.002 176 PHE AAA CD2 1207 C CE1 . PHE A 170 ? 0.657 1.085 0.496 -0.080 -0.006 0.006 176 PHE AAA CE1 1208 C CE2 . PHE A 170 ? 0.662 1.100 0.503 -0.051 -0.020 -0.002 176 PHE AAA CE2 1209 C CZ . PHE A 170 ? 0.659 1.098 0.504 -0.074 -0.018 -0.000 176 PHE AAA CZ 1210 N N . ARG A 171 ? 0.648 0.979 0.427 -0.013 -0.007 0.007 177 ARG AAA N 1211 C CA . ARG A 171 ? 0.716 1.032 0.481 -0.010 -0.015 0.004 177 ARG AAA CA 1212 C C . ARG A 171 ? 0.703 0.993 0.453 -0.004 -0.013 0.005 177 ARG AAA C 1213 O O . ARG A 171 ? 0.726 1.014 0.468 0.006 -0.016 0.004 177 ARG AAA O 1214 C CB . ARG A 171 ? 0.753 1.090 0.523 0.000 -0.021 0.004 177 ARG AAA CB 1215 C CG . ARG A 171 ? 0.800 1.166 0.585 -0.006 -0.026 0.001 177 ARG AAA CG 1216 C CD . ARG A 171 ? 0.876 1.266 0.670 0.009 -0.029 0.006 177 ARG AAA CD 1217 N NE . ARG A 171 ? 1.057 1.460 0.844 0.011 -0.040 0.003 177 ARG AAA NE 1218 C CZ . ARG A 171 ? 1.122 1.541 0.907 0.025 -0.044 0.010 177 ARG AAA CZ 1219 N NH1 . ARG A 171 ? 1.090 1.508 0.881 0.037 -0.038 0.022 177 ARG AAA NH1 1220 N NH2 . ARG A 171 ? 1.199 1.634 0.974 0.026 -0.054 0.005 177 ARG AAA NH2 1221 N N . GLY A 172 ? 0.664 0.940 0.410 -0.008 -0.008 0.007 178 GLY AAA N 1222 C CA . GLY A 172 ? 0.654 0.907 0.386 -0.004 -0.008 0.008 178 GLY AAA CA 1223 C C . GLY A 172 ? 0.614 0.872 0.349 0.008 -0.004 0.010 178 GLY AAA C 1224 O O . GLY A 172 ? 0.662 0.909 0.388 0.014 -0.006 0.010 178 GLY AAA O 1225 N N . GLU A 173 ? 0.576 0.849 0.323 0.012 0.000 0.013 179 GLU AAA N 1226 C CA . GLU A 173 ? 0.597 0.869 0.350 0.020 0.003 0.018 179 GLU AAA CA 1227 C C . GLU A 173 ? 0.643 0.902 0.393 0.019 0.007 0.015 179 GLU AAA C 1228 O O . GLU A 173 ? 0.651 0.912 0.401 0.014 0.011 0.012 179 GLU AAA O 1229 C CB . GLU A 173 ? 0.590 0.875 0.358 0.026 0.005 0.021 179 GLU AAA CB 1230 C CG . GLU A 173 ? 0.616 0.920 0.389 0.029 -0.000 0.024 179 GLU AAA CG 1231 C CD . GLU A 173 ? 0.626 0.947 0.408 0.025 -0.001 0.019 179 GLU AAA CD 1232 O OE1 . GLU A 173 ? 0.620 0.939 0.400 0.016 0.003 0.014 179 GLU AAA OE1 1233 O OE2 . GLU A 173 ? 0.649 0.989 0.439 0.029 -0.006 0.022 179 GLU AAA OE2 1234 N N . VAL A 174 ? 0.631 0.882 0.377 0.021 0.007 0.017 180 VAL AAA N 1235 C CA . VAL A 174 ? 0.616 0.856 0.359 0.019 0.008 0.014 180 VAL AAA CA 1236 C C . VAL A 174 ? 0.625 0.866 0.378 0.022 0.012 0.011 180 VAL AAA C 1237 O O . VAL A 174 ? 0.615 0.859 0.380 0.026 0.012 0.015 180 VAL AAA O 1238 C CB . VAL A 174 ? 0.601 0.838 0.342 0.021 0.005 0.016 180 VAL AAA CB 1239 C CG1 . VAL A 174 ? 0.590 0.832 0.344 0.023 0.007 0.022 180 VAL AAA CG1 1240 C CG2 . VAL A 174 ? 0.577 0.806 0.311 0.019 0.004 0.011 180 VAL AAA CG2 1241 N N . LYS A 175 ? 0.625 0.863 0.373 0.019 0.014 0.004 181 LYS AAA N 1242 C CA . LYS A 175 ? 0.638 0.875 0.393 0.023 0.017 -0.004 181 LYS AAA CA 1243 C C . LYS A 175 ? 0.668 0.897 0.415 0.021 0.015 -0.010 181 LYS AAA C 1244 O O . LYS A 175 ? 0.700 0.932 0.431 0.016 0.016 -0.012 181 LYS AAA O 1245 C CB . LYS A 175 ? 0.668 0.921 0.424 0.024 0.023 -0.009 181 LYS AAA CB 1246 C CG . LYS A 175 ? 0.671 0.938 0.435 0.023 0.023 -0.003 181 LYS AAA CG 1247 C CD . LYS A 175 ? 0.668 0.942 0.450 0.034 0.023 -0.003 181 LYS AAA CD 1248 C CE . LYS A 175 ? 0.611 0.898 0.399 0.034 0.020 0.005 181 LYS AAA CE 1249 N NZ . LYS A 175 ? 0.600 0.896 0.407 0.046 0.018 0.006 181 LYS AAA NZ 1250 N N . ILE A 176 ? 0.656 0.874 0.412 0.022 0.012 -0.013 182 ILE AAA N 1251 C CA . ILE A 176 ? 0.678 0.890 0.431 0.020 0.009 -0.023 182 ILE AAA CA 1252 C C . ILE A 176 ? 0.709 0.926 0.456 0.024 0.013 -0.037 182 ILE AAA C 1253 O O . ILE A 176 ? 0.776 0.992 0.535 0.031 0.016 -0.041 182 ILE AAA O 1254 C CB . ILE A 176 ? 0.693 0.892 0.462 0.018 0.004 -0.023 182 ILE AAA CB 1255 C CG1 . ILE A 176 ? 0.666 0.869 0.439 0.013 0.002 -0.009 182 ILE AAA CG1 1256 C CG2 . ILE A 176 ? 0.746 0.938 0.512 0.015 -0.001 -0.037 182 ILE AAA CG2 1257 C CD1 . ILE A 176 ? 0.657 0.852 0.448 0.009 -0.001 -0.002 182 ILE AAA CD1 1258 N N . ALA A 177 ? 0.671 0.895 0.399 0.021 0.014 -0.044 183 ALA AAA N 1259 C CA . ALA A 177 ? 0.696 0.935 0.414 0.024 0.021 -0.054 183 ALA AAA CA 1260 C C . ALA A 177 ? 0.718 0.953 0.446 0.034 0.021 -0.072 183 ALA AAA C 1261 O O . ALA A 177 ? 0.726 0.978 0.455 0.040 0.029 -0.080 183 ALA AAA O 1262 C CB . ALA A 177 ? 0.718 0.966 0.411 0.019 0.020 -0.054 183 ALA AAA CB 1263 N N . ASP A 178 ? 0.732 0.948 0.471 0.034 0.013 -0.079 184 ASP AAA N 1264 C CA . ASP A 178 ? 0.760 0.961 0.510 0.042 0.010 -0.098 184 ASP AAA CA 1265 C C . ASP A 178 ? 0.768 0.944 0.530 0.035 -0.001 -0.099 184 ASP AAA C 1266 O O . ASP A 178 ? 0.767 0.944 0.528 0.025 -0.004 -0.084 184 ASP AAA O 1267 C CB . ASP A 178 ? 0.807 1.025 0.541 0.048 0.014 -0.119 184 ASP AAA CB 1268 C CG . ASP A 178 ? 0.846 1.074 0.556 0.039 0.011 -0.121 184 ASP AAA CG 1269 O OD1 . ASP A 178 ? 0.864 1.077 0.576 0.032 0.001 -0.121 184 ASP AAA OD1 1270 O OD2 . ASP A 178 ? 0.854 1.106 0.542 0.039 0.018 -0.121 184 ASP AAA OD2 1271 N N . PHE A 179 ? 0.783 0.939 0.556 0.040 -0.006 -0.117 185 PHE AAA N 1272 C CA . PHE A 179 ? 0.824 0.954 0.611 0.031 -0.018 -0.121 185 PHE AAA CA 1273 C C . PHE A 179 ? 0.894 1.032 0.666 0.024 -0.025 -0.138 185 PHE AAA C 1274 O O . PHE A 179 ? 0.914 1.031 0.696 0.018 -0.036 -0.152 185 PHE AAA O 1275 C CB . PHE A 179 ? 0.847 0.946 0.655 0.039 -0.023 -0.130 185 PHE AAA CB 1276 C CG . PHE A 179 ? 0.868 0.958 0.691 0.045 -0.020 -0.110 185 PHE AAA CG 1277 C CD1 . PHE A 179 ? 0.860 0.936 0.698 0.033 -0.024 -0.086 185 PHE AAA CD1 1278 C CD2 . PHE A 179 ? 0.884 0.986 0.708 0.061 -0.012 -0.113 185 PHE AAA CD2 1279 C CE1 . PHE A 179 ? 0.839 0.910 0.688 0.039 -0.022 -0.067 185 PHE AAA CE1 1280 C CE2 . PHE A 179 ? 0.861 0.958 0.698 0.067 -0.011 -0.093 185 PHE AAA CE2 1281 C CZ . PHE A 179 ? 0.837 0.918 0.686 0.056 -0.016 -0.070 185 PHE AAA CZ 1282 N N . GLY A 180 ? 0.892 1.058 0.639 0.024 -0.020 -0.137 186 GLY AAA N 1283 C CA . GLY A 180 ? 0.962 1.142 0.692 0.017 -0.027 -0.144 186 GLY AAA CA 1284 C C . GLY A 180 ? 1.042 1.215 0.766 0.019 -0.035 -0.174 186 GLY AAA C 1285 O O . GLY A 180 ? 1.105 1.269 0.838 0.009 -0.047 -0.182 186 GLY AAA O 1286 N N . TRP A 181 ? 1.054 1.236 0.765 0.032 -0.028 -0.193 187 TRP AAA N 1287 C CA . TRP A 181 ? 1.037 1.217 0.736 0.038 -0.035 -0.227 187 TRP AAA CA 1288 C C . TRP A 181 ? 1.016 1.229 0.681 0.035 -0.036 -0.232 187 TRP AAA C 1289 O O . TRP A 181 ? 1.008 1.220 0.665 0.033 -0.048 -0.255 187 TRP AAA O 1290 C CB . TRP A 181 ? 1.022 1.200 0.724 0.056 -0.026 -0.246 187 TRP AAA CB 1291 C CG . TRP A 181 ? 0.980 1.195 0.663 0.064 -0.010 -0.238 187 TRP AAA CG 1292 C CD1 . TRP A 181 ? 0.924 1.148 0.615 0.065 0.001 -0.213 187 TRP AAA CD1 1293 C CD2 . TRP A 181 ? 0.983 1.234 0.635 0.072 -0.002 -0.255 187 TRP AAA CD2 1294 N NE1 . TRP A 181 ? 0.922 1.182 0.593 0.070 0.015 -0.212 187 TRP AAA NE1 1295 C CE2 . TRP A 181 ? 0.948 1.227 0.594 0.074 0.014 -0.237 187 TRP AAA CE2 1296 C CE3 . TRP A 181 ? 1.007 1.271 0.636 0.076 -0.007 -0.284 187 TRP AAA CE3 1297 C CZ2 . TRP A 181 ? 0.967 1.288 0.585 0.079 0.026 -0.243 187 TRP AAA CZ2 1298 C CZ3 . TRP A 181 ? 1.014 1.321 0.612 0.082 0.005 -0.291 187 TRP AAA CZ3 1299 C CH2 . TRP A 181 ? 1.001 1.337 0.595 0.083 0.022 -0.270 187 TRP AAA CH2 1300 N N . SER A 182 ? 1.033 1.271 0.679 0.034 -0.026 -0.210 188 SER AAA N 1301 C CA . SER A 182 ? 1.046 1.313 0.657 0.032 -0.027 -0.206 188 SER AAA CA 1302 C C . SER A 182 ? 1.063 1.329 0.676 0.020 -0.038 -0.188 188 SER AAA C 1303 O O . SER A 182 ? 1.040 1.327 0.626 0.019 -0.040 -0.179 188 SER AAA O 1304 C CB . SER A 182 ? 1.046 1.338 0.638 0.035 -0.011 -0.190 188 SER AAA CB 1305 O OG . SER A 182 ? 1.108 1.405 0.707 0.046 0.001 -0.204 188 SER AAA OG 1306 N N . VAL A 183 ? 1.136 1.380 0.780 0.014 -0.044 -0.180 189 VAL AAA N 1307 C CA . VAL A 183 ? 1.165 1.411 0.817 0.004 -0.055 -0.166 189 VAL AAA CA 1308 C C . VAL A 183 ? 1.226 1.482 0.871 -0.000 -0.071 -0.187 189 VAL AAA C 1309 O O . VAL A 183 ? 1.199 1.439 0.856 -0.003 -0.077 -0.211 189 VAL AAA O 1310 C CB . VAL A 183 ? 1.201 1.428 0.890 -0.003 -0.056 -0.153 189 VAL AAA CB 1311 C CG1 . VAL A 183 ? 1.178 1.409 0.884 -0.014 -0.070 -0.152 189 VAL AAA CG1 1312 C CG2 . VAL A 183 ? 1.246 1.473 0.938 0.000 -0.045 -0.127 189 VAL AAA CG2 1313 N N . HIS A 184 ? 1.303 1.582 0.927 -0.001 -0.079 -0.180 190 HIS AAA N 1314 C CA . HIS A 184 ? 1.365 1.660 0.978 -0.005 -0.096 -0.198 190 HIS AAA CA 1315 C C . HIS A 184 ? 1.388 1.685 1.031 -0.016 -0.109 -0.190 190 HIS AAA C 1316 O O . HIS A 184 ? 1.488 1.787 1.143 -0.015 -0.104 -0.165 190 HIS AAA O 1317 C CB . HIS A 184 ? 1.387 1.709 0.957 0.002 -0.097 -0.192 190 HIS AAA CB 1318 C CG . HIS A 184 ? 1.490 1.832 1.041 0.001 -0.113 -0.214 190 HIS AAA CG 1319 N ND1 . HIS A 184 ? 1.489 1.831 1.030 0.002 -0.116 -0.248 190 HIS AAA ND1 1320 C CD2 . HIS A 184 ? 1.447 1.811 0.986 -0.001 -0.130 -0.210 190 HIS AAA CD2 1321 C CE1 . HIS A 184 ? 1.456 1.820 0.978 0.001 -0.133 -0.263 190 HIS AAA CE1 1322 N NE2 . HIS A 184 ? 1.413 1.793 0.935 -0.001 -0.142 -0.240 190 HIS AAA NE2 1323 N N . THR A 185 ? 1.352 1.649 1.010 -0.025 -0.123 -0.213 191 THR AAA N 1324 C CA . THR A 185 ? 1.334 1.640 1.023 -0.038 -0.137 -0.209 191 THR AAA CA 1325 C C . THR A 185 ? 1.288 1.623 0.968 -0.032 -0.141 -0.187 191 THR AAA C 1326 O O . THR A 185 ? 1.268 1.626 0.922 -0.027 -0.152 -0.192 191 THR AAA O 1327 C CB . THR A 185 ? 1.438 1.749 1.135 -0.048 -0.155 -0.240 191 THR AAA CB 1328 O OG1 . THR A 185 ? 1.572 1.893 1.228 -0.039 -0.159 -0.261 191 THR AAA OG1 1329 C CG2 . THR A 185 ? 1.424 1.700 1.151 -0.060 -0.156 -0.255 191 THR AAA CG2 1330 N N . PRO A 186 ? 1.349 1.684 1.049 -0.031 -0.133 -0.162 192 PRO AAA N 1331 C CA . PRO A 186 ? 1.279 1.634 0.967 -0.021 -0.134 -0.141 192 PRO AAA CA 1332 C C . PRO A 186 ? 1.190 1.578 0.879 -0.021 -0.154 -0.146 192 PRO AAA C 1333 O O . PRO A 186 ? 1.227 1.629 0.948 -0.033 -0.163 -0.153 192 PRO AAA O 1334 C CB . PRO A 186 ? 1.282 1.630 0.997 -0.021 -0.124 -0.121 192 PRO AAA CB 1335 C CG . PRO A 186 ? 1.309 1.645 1.058 -0.037 -0.122 -0.131 192 PRO AAA CG 1336 C CD . PRO A 186 ? 1.325 1.640 1.058 -0.039 -0.123 -0.153 192 PRO AAA CD 1337 N N . SER A 187 ? 1.065 1.467 0.719 -0.009 -0.161 -0.140 193 SER AAA N 1338 C CA . SER A 187 ? 0.984 1.420 0.634 -0.005 -0.181 -0.141 193 SER AAA CA 1339 C C . SER A 187 ? 0.971 1.420 0.637 0.006 -0.183 -0.118 193 SER AAA C 1340 O O . SER A 187 ? 1.048 1.475 0.705 0.014 -0.169 -0.100 193 SER AAA O 1341 C CB . SER A 187 ? 0.977 1.421 0.579 0.003 -0.189 -0.144 193 SER AAA CB 1342 O OG . SER A 187 ? 0.969 1.446 0.565 0.010 -0.209 -0.142 193 SER AAA OG 1343 N N . LEU A 188 ? 0.925 1.408 0.615 0.006 -0.199 -0.121 194 LEU AAA N 1344 C CA . LEU A 188 ? 0.880 1.382 0.583 0.021 -0.204 -0.103 194 LEU AAA CA 1345 C C . LEU A 188 ? 0.907 1.400 0.568 0.040 -0.209 -0.086 194 LEU AAA C 1346 O O . LEU A 188 ? 0.893 1.367 0.550 0.052 -0.201 -0.067 194 LEU AAA O 1347 C CB . LEU A 188 ? 0.866 1.416 0.602 0.016 -0.222 -0.114 194 LEU AAA CB 1348 C CG . LEU A 188 ? 0.858 1.439 0.622 0.031 -0.228 -0.101 194 LEU AAA CG 1349 C CD1 . LEU A 188 ? 0.853 1.419 0.638 0.032 -0.208 -0.089 194 LEU AAA CD1 1350 C CD2 . LEU A 188 ? 0.870 1.503 0.672 0.021 -0.244 -0.114 194 LEU AAA CD2 1351 N N . ALA A 189 ? 0.970 1.472 0.597 0.041 -0.222 -0.093 195 ALA AAA N 1352 C CA . ALA A 189 ? 1.057 1.552 0.639 0.057 -0.230 -0.075 195 ALA AAA CA 1353 C C . ALA A 189 ? 1.073 1.527 0.629 0.058 -0.210 -0.059 195 ALA AAA C 1354 O O . ALA A 189 ? 1.071 1.509 0.610 0.071 -0.211 -0.035 195 ALA AAA O 1355 C CB . ALA A 189 ? 1.081 1.599 0.633 0.054 -0.245 -0.088 195 ALA AAA CB 1356 N N . ALA A 190 ? 1.076 1.513 0.631 0.044 -0.193 -0.071 196 ALA AAA N 1357 C CA . ALA A 190 ? 1.069 1.473 0.602 0.043 -0.174 -0.059 196 ALA AAA CA 1358 C C . ALA A 190 ? 1.037 1.418 0.591 0.048 -0.164 -0.042 196 ALA AAA C 1359 O O . ALA A 190 ? 1.032 1.391 0.564 0.055 -0.159 -0.021 196 ALA AAA O 1360 C CB . ALA A 190 ? 1.057 1.454 0.594 0.030 -0.160 -0.080 196 ALA AAA CB 1361 N N . ALA A 191 ? 1.006 1.394 0.602 0.045 -0.161 -0.050 197 ALA AAA N 1362 C CA . ALA A 191 ? 0.957 1.331 0.577 0.050 -0.151 -0.039 197 ALA AAA CA 1363 C C . ALA A 191 ? 0.957 1.331 0.571 0.068 -0.163 -0.022 197 ALA AAA C 1364 O O . ALA A 191 ? 0.934 1.282 0.545 0.075 -0.155 -0.009 197 ALA AAA O 1365 C CB . ALA A 191 ? 0.939 1.330 0.602 0.041 -0.148 -0.052 197 ALA AAA CB 1366 N N . THR A 192 ? 0.983 1.386 0.598 0.076 -0.182 -0.024 198 THR AAA N 1367 C CA . THR A 192 ? 1.053 1.458 0.661 0.098 -0.198 -0.009 198 THR AAA CA 1368 C C . THR A 192 ? 1.125 1.492 0.692 0.103 -0.196 0.012 198 THR AAA C 1369 O O . THR A 192 ? 1.229 1.569 0.796 0.114 -0.195 0.026 198 THR AAA O 1370 C CB . THR A 192 ? 1.058 1.504 0.671 0.104 -0.220 -0.016 198 THR AAA CB 1371 O OG1 . THR A 192 ? 1.018 1.499 0.677 0.098 -0.220 -0.033 198 THR AAA OG1 1372 C CG2 . THR A 192 ? 1.074 1.521 0.677 0.129 -0.238 0.000 198 THR AAA CG2 1373 N N . MET A 193 ? 1.102 1.466 0.634 0.093 -0.196 0.013 199 MET AAA N 1374 C CA . MET A 193 ? 1.147 1.482 0.636 0.094 -0.194 0.035 199 MET AAA CA 1375 C C . MET A 193 ? 1.148 1.449 0.638 0.084 -0.173 0.042 199 MET AAA C 1376 O O . MET A 193 ? 1.173 1.442 0.648 0.089 -0.173 0.063 199 MET AAA O 1377 C CB . MET A 193 ? 1.211 1.563 0.664 0.085 -0.196 0.032 199 MET AAA CB 1378 C CG . MET A 193 ? 1.252 1.637 0.695 0.094 -0.219 0.028 199 MET AAA CG 1379 S SD . MET A 193 ? 1.351 1.743 0.733 0.092 -0.226 0.043 199 MET AAA SD 1380 C CE . MET A 193 ? 1.379 1.770 0.750 0.071 -0.200 0.025 199 MET AAA CE 1381 N N . CYS A 194 ? 1.162 1.468 0.669 0.070 -0.156 0.024 200 CYS AAA N 1382 C CA . CYS A 194 ? 1.230 1.510 0.742 0.061 -0.136 0.027 200 CYS AAA CA 1383 C C . CYS A 194 ? 1.126 1.386 0.661 0.070 -0.136 0.035 200 CYS AAA C 1384 O O . CYS A 194 ? 1.065 1.298 0.597 0.065 -0.124 0.043 200 CYS AAA O 1385 C CB . CYS A 194 ? 1.249 1.540 0.780 0.049 -0.122 0.006 200 CYS AAA CB 1386 S SG . CYS A 194 ? 1.407 1.709 0.908 0.037 -0.113 -0.003 200 CYS AAA SG 1387 N N . GLY A 195 ? 1.054 1.329 0.612 0.084 -0.148 0.030 201 GLY AAA N 1388 C CA . GLY A 195 ? 1.043 1.307 0.625 0.096 -0.148 0.032 201 GLY AAA CA 1389 C C . GLY A 195 ? 0.982 1.255 0.595 0.087 -0.132 0.018 201 GLY AAA C 1390 O O . GLY A 195 ? 0.947 1.202 0.569 0.091 -0.125 0.020 201 GLY AAA O 1391 N N . THR A 196 ? 1.041 1.339 0.666 0.075 -0.128 0.004 202 THR AAA N 1392 C CA . THR A 196 ? 1.037 1.340 0.687 0.063 -0.113 -0.007 202 THR AAA CA 1393 C C . THR A 196 ? 1.009 1.348 0.692 0.062 -0.119 -0.019 202 THR AAA C 1394 O O . THR A 196 ? 0.971 1.319 0.675 0.049 -0.110 -0.028 202 THR AAA O 1395 C CB . THR A 196 ? 1.026 1.320 0.663 0.048 -0.103 -0.013 202 THR AAA CB 1396 O OG1 . THR A 196 ? 1.036 1.343 0.655 0.045 -0.112 -0.019 202 THR AAA OG1 1397 C CG2 . THR A 196 ? 1.029 1.294 0.646 0.046 -0.092 -0.002 202 THR AAA CG2 1398 N N . LEU A 197 ? 0.941 1.302 0.629 0.075 -0.134 -0.018 203 LEU AAA N 1399 C CA . LEU A 197 ? 0.870 1.273 0.592 0.075 -0.141 -0.027 203 LEU AAA CA 1400 C C . LEU A 197 ? 0.822 1.237 0.575 0.074 -0.129 -0.028 203 LEU AAA C 1401 O O . LEU A 197 ? 0.746 1.193 0.529 0.063 -0.127 -0.036 203 LEU AAA O 1402 C CB . LEU A 197 ? 0.860 1.283 0.579 0.094 -0.160 -0.024 203 LEU AAA CB 1403 C CG . LEU A 197 ? 0.885 1.357 0.631 0.091 -0.173 -0.035 203 LEU AAA CG 1404 C CD1 . LEU A 197 ? 0.894 1.372 0.633 0.071 -0.177 -0.046 203 LEU AAA CD1 1405 C CD2 . LEU A 197 ? 0.939 1.431 0.681 0.114 -0.193 -0.030 203 LEU AAA CD2 1406 N N . ASP A 198 ? 0.815 1.206 0.560 0.084 -0.121 -0.021 204 ASP AAA N 1407 C CA . ASP A 198 ? 0.827 1.230 0.595 0.087 -0.109 -0.021 204 ASP AAA CA 1408 C C . ASP A 198 ? 0.782 1.188 0.566 0.065 -0.095 -0.024 204 ASP AAA C 1409 O O . ASP A 198 ? 0.758 1.193 0.568 0.062 -0.089 -0.025 204 ASP AAA O 1410 C CB . ASP A 198 ? 0.895 1.263 0.645 0.100 -0.105 -0.015 204 ASP AAA CB 1411 C CG . ASP A 198 ? 0.989 1.344 0.724 0.122 -0.120 -0.011 204 ASP AAA CG 1412 O OD1 . ASP A 198 ? 1.014 1.344 0.722 0.120 -0.128 -0.003 204 ASP AAA OD1 1413 O OD2 . ASP A 198 ? 1.060 1.431 0.810 0.141 -0.124 -0.014 204 ASP AAA OD2 1414 N N . TYR A 199 ? 0.747 1.125 0.512 0.052 -0.091 -0.024 205 TYR AAA N 1415 C CA . TYR A 199 ? 0.720 1.091 0.496 0.034 -0.080 -0.026 205 TYR AAA CA 1416 C C . TYR A 199 ? 0.734 1.124 0.529 0.019 -0.086 -0.035 205 TYR AAA C 1417 O O . TYR A 199 ? 0.718 1.092 0.515 0.004 -0.081 -0.040 205 TYR AAA O 1418 C CB . TYR A 199 ? 0.703 1.036 0.453 0.031 -0.073 -0.024 205 TYR AAA CB 1419 C CG . TYR A 199 ? 0.689 1.002 0.426 0.041 -0.066 -0.016 205 TYR AAA CG 1420 C CD1 . TYR A 199 ? 0.684 0.983 0.401 0.054 -0.073 -0.011 205 TYR AAA CD1 1421 C CD2 . TYR A 199 ? 0.692 0.999 0.438 0.037 -0.054 -0.013 205 TYR AAA CD2 1422 C CE1 . TYR A 199 ? 0.685 0.962 0.391 0.061 -0.069 -0.005 205 TYR AAA CE1 1423 C CE2 . TYR A 199 ? 0.707 0.997 0.442 0.045 -0.050 -0.008 205 TYR AAA CE2 1424 C CZ . TYR A 199 ? 0.722 0.996 0.438 0.056 -0.057 -0.005 205 TYR AAA CZ 1425 O OH . TYR A 199 ? 0.761 1.015 0.467 0.062 -0.055 -0.001 205 TYR AAA OH 1426 N N . LEU A 200 ? 0.742 1.165 0.550 0.022 -0.098 -0.039 206 LEU AAA N 1427 C CA . LEU A 200 ? 0.766 1.214 0.597 0.006 -0.106 -0.049 206 LEU AAA CA 1428 C C . LEU A 200 ? 0.772 1.266 0.639 0.005 -0.106 -0.046 206 LEU AAA C 1429 O O . LEU A 200 ? 0.812 1.333 0.683 0.022 -0.114 -0.046 206 LEU AAA O 1430 C CB . LEU A 200 ? 0.778 1.231 0.590 0.011 -0.123 -0.058 206 LEU AAA CB 1431 C CG . LEU A 200 ? 0.762 1.191 0.556 -0.001 -0.125 -0.069 206 LEU AAA CG 1432 C CD1 . LEU A 200 ? 0.758 1.147 0.519 0.005 -0.115 -0.064 206 LEU AAA CD1 1433 C CD2 . LEU A 200 ? 0.788 1.236 0.570 0.001 -0.144 -0.080 206 LEU AAA CD2 1434 N N . PRO A 201 ? 0.762 1.267 0.657 -0.014 -0.098 -0.044 207 PRO AAA N 1435 C CA . PRO A 201 ? 0.775 1.331 0.706 -0.018 -0.096 -0.040 207 PRO AAA CA 1436 C C . PRO A 201 ? 0.786 1.382 0.740 -0.026 -0.112 -0.049 207 PRO AAA C 1437 O O . PRO A 201 ? 0.763 1.344 0.706 -0.034 -0.124 -0.060 207 PRO AAA O 1438 C CB . PRO A 201 ? 0.760 1.308 0.708 -0.039 -0.082 -0.031 207 PRO AAA CB 1439 C CG . PRO A 201 ? 0.748 1.246 0.679 -0.051 -0.085 -0.037 207 PRO AAA CG 1440 C CD . PRO A 201 ? 0.755 1.226 0.648 -0.031 -0.090 -0.043 207 PRO AAA CD 1441 N N . PRO A 202 ? 0.798 1.452 0.784 -0.024 -0.113 -0.047 208 PRO AAA N 1442 C CA . PRO A 202 ? 0.799 1.500 0.814 -0.034 -0.128 -0.056 208 PRO AAA CA 1443 C C . PRO A 202 ? 0.833 1.521 0.858 -0.063 -0.137 -0.065 208 PRO AAA C 1444 O O . PRO A 202 ? 0.920 1.619 0.942 -0.063 -0.155 -0.078 208 PRO AAA O 1445 C CB . PRO A 202 ? 0.801 1.563 0.856 -0.038 -0.118 -0.048 208 PRO AAA CB 1446 C CG . PRO A 202 ? 0.792 1.546 0.829 -0.011 -0.105 -0.041 208 PRO AAA CG 1447 C CD . PRO A 202 ? 0.795 1.477 0.793 -0.011 -0.099 -0.038 208 PRO AAA CD 1448 N N . GLU A 203 ? 0.841 1.505 0.877 -0.087 -0.126 -0.059 209 GLU AAA N 1449 C CA . GLU A 203 ? 0.908 1.550 0.955 -0.116 -0.135 -0.069 209 GLU AAA CA 1450 C C . GLU A 203 ? 0.927 1.531 0.938 -0.107 -0.149 -0.087 209 GLU AAA C 1451 O O . GLU A 203 ? 0.947 1.565 0.968 -0.120 -0.166 -0.103 209 GLU AAA O 1452 C CB . GLU A 203 ? 0.954 1.556 1.006 -0.136 -0.122 -0.058 209 GLU AAA CB 1453 C CG . GLU A 203 ? 0.998 1.626 1.069 -0.137 -0.103 -0.036 209 GLU AAA CG 1454 C CD . GLU A 203 ? 1.009 1.614 1.048 -0.111 -0.089 -0.027 209 GLU AAA CD 1455 O OE1 . GLU A 203 ? 0.925 1.475 0.938 -0.109 -0.085 -0.027 209 GLU AAA OE1 1456 O OE2 . GLU A 203 ? 1.107 1.750 1.147 -0.092 -0.083 -0.022 209 GLU AAA OE2 1457 N N . MET A 204 ? 0.906 1.468 0.878 -0.088 -0.141 -0.084 210 MET AAA N 1458 C CA . MET A 204 ? 0.909 1.438 0.842 -0.077 -0.150 -0.097 210 MET AAA CA 1459 C C . MET A 204 ? 0.869 1.432 0.791 -0.061 -0.166 -0.103 210 MET AAA C 1460 O O . MET A 204 ? 0.920 1.482 0.829 -0.065 -0.181 -0.120 210 MET AAA O 1461 C CB . MET A 204 ? 0.934 1.420 0.832 -0.061 -0.135 -0.089 210 MET AAA CB 1462 C CG . MET A 204 ? 0.952 1.403 0.857 -0.073 -0.121 -0.082 210 MET AAA CG 1463 S SD . MET A 204 ? 0.991 1.390 0.854 -0.059 -0.111 -0.084 210 MET AAA SD 1464 C CE . MET A 204 ? 0.969 1.351 0.822 -0.070 -0.126 -0.110 210 MET AAA CE 1465 N N . ILE A 205 ? 0.824 1.416 0.751 -0.042 -0.163 -0.091 211 ILE AAA N 1466 C CA . ILE A 205 ? 0.834 1.457 0.751 -0.021 -0.179 -0.093 211 ILE AAA CA 1467 C C . ILE A 205 ? 0.876 1.542 0.818 -0.035 -0.199 -0.108 211 ILE AAA C 1468 O O . ILE A 205 ? 0.967 1.635 0.885 -0.028 -0.216 -0.118 211 ILE AAA O 1469 C CB . ILE A 205 ? 0.840 1.491 0.770 0.001 -0.173 -0.080 211 ILE AAA CB 1470 C CG1 . ILE A 205 ? 0.847 1.454 0.745 0.019 -0.160 -0.069 211 ILE AAA CG1 1471 C CG2 . ILE A 205 ? 0.863 1.558 0.799 0.019 -0.193 -0.083 211 ILE AAA CG2 1472 C CD1 . ILE A 205 ? 0.866 1.442 0.720 0.036 -0.169 -0.067 211 ILE AAA CD1 1473 N N . GLU A 206 ? 0.836 1.535 0.823 -0.057 -0.197 -0.109 212 GLU AAA N 1474 C CA . GLU A 206 ? 0.805 1.549 0.825 -0.077 -0.215 -0.123 212 GLU AAA CA 1475 C C . GLU A 206 ? 0.819 1.523 0.833 -0.103 -0.219 -0.138 212 GLU AAA C 1476 O O . GLU A 206 ? 0.789 1.437 0.771 -0.100 -0.209 -0.138 212 GLU AAA O 1477 C CB . GLU A 206 ? 0.782 1.582 0.855 -0.089 -0.208 -0.114 212 GLU AAA CB 1478 C CG . GLU A 206 ? 0.764 1.602 0.840 -0.058 -0.204 -0.103 212 GLU AAA CG 1479 C CD . GLU A 206 ? 0.718 1.621 0.844 -0.065 -0.196 -0.095 212 GLU AAA CD 1480 O OE1 . GLU A 206 ? 0.695 1.588 0.829 -0.071 -0.174 -0.082 212 GLU AAA OE1 1481 O OE2 . GLU A 206 ? 0.700 1.667 0.857 -0.063 -0.210 -0.101 212 GLU AAA OE2 1482 N N . GLY A 207 ? 0.895 1.627 0.940 -0.128 -0.235 -0.153 213 GLY AAA N 1483 C CA . GLY A 207 ? 0.988 1.680 1.027 -0.151 -0.243 -0.173 213 GLY AAA CA 1484 C C . GLY A 207 ? 1.028 1.675 1.080 -0.170 -0.226 -0.164 213 GLY AAA C 1485 O O . GLY A 207 ? 1.085 1.686 1.126 -0.184 -0.231 -0.181 213 GLY AAA O 1486 N N . ARG A 208 ? 1.050 1.707 1.121 -0.170 -0.207 -0.141 214 ARG AAA N 1487 C CA . ARG A 208 ? 1.114 1.757 1.219 -0.198 -0.195 -0.128 214 ARG AAA CA 1488 C C . ARG A 208 ? 1.094 1.665 1.174 -0.197 -0.183 -0.126 214 ARG AAA C 1489 O O . ARG A 208 ? 1.033 1.575 1.071 -0.172 -0.176 -0.127 214 ARG AAA O 1490 C CB . ARG A 208 ? 1.158 1.850 1.291 -0.196 -0.180 -0.104 214 ARG AAA CB 1491 C CG . ARG A 208 ? 1.211 1.919 1.390 -0.231 -0.173 -0.090 214 ARG AAA CG 1492 C CD . ARG A 208 ? 1.220 1.985 1.423 -0.226 -0.156 -0.068 214 ARG AAA CD 1493 N NE . ARG A 208 ? 1.255 2.070 1.452 -0.196 -0.161 -0.073 214 ARG AAA NE 1494 C CZ . ARG A 208 ? 1.269 2.091 1.444 -0.164 -0.148 -0.064 214 ARG AAA CZ 1495 N NH1 . ARG A 208 ? 1.268 2.132 1.440 -0.137 -0.157 -0.071 214 ARG AAA NH1 1496 N NH2 . ARG A 208 ? 1.300 2.087 1.456 -0.157 -0.129 -0.049 214 ARG AAA NH2 1497 N N . THR A 209 ? 1.122 1.665 1.227 -0.226 -0.180 -0.121 215 THR AAA N 1498 C CA . THR A 209 ? 1.107 1.581 1.196 -0.228 -0.171 -0.118 215 THR AAA CA 1499 C C . THR A 209 ? 1.094 1.563 1.169 -0.210 -0.148 -0.092 215 THR AAA C 1500 O O . THR A 209 ? 0.986 1.503 1.080 -0.210 -0.139 -0.074 215 THR AAA O 1501 C CB . THR A 209 ? 1.120 1.568 1.245 -0.264 -0.176 -0.116 215 THR AAA CB 1502 O OG1 . THR A 209 ? 1.135 1.625 1.296 -0.282 -0.166 -0.089 215 THR AAA OG1 1503 C CG2 . THR A 209 ? 1.149 1.596 1.289 -0.285 -0.200 -0.144 215 THR AAA CG2 1504 N N . TYR A 210 ? 1.173 1.588 1.217 -0.196 -0.140 -0.093 216 TYR AAA N 1505 C CA . TYR A 210 ? 1.116 1.519 1.139 -0.175 -0.121 -0.074 216 TYR AAA CA 1506 C C . TYR A 210 ? 1.104 1.449 1.123 -0.181 -0.115 -0.069 216 TYR AAA C 1507 O O . TYR A 210 ? 1.129 1.434 1.142 -0.186 -0.125 -0.088 216 TYR AAA O 1508 C CB . TYR A 210 ? 1.149 1.555 1.133 -0.145 -0.121 -0.083 216 TYR AAA CB 1509 C CG . TYR A 210 ? 1.160 1.524 1.114 -0.137 -0.127 -0.104 216 TYR AAA CG 1510 C CD1 . TYR A 210 ? 1.190 1.512 1.123 -0.125 -0.116 -0.101 216 TYR AAA CD1 1511 C CD2 . TYR A 210 ? 1.180 1.551 1.127 -0.140 -0.145 -0.128 216 TYR AAA CD2 1512 C CE1 . TYR A 210 ? 1.228 1.518 1.135 -0.116 -0.121 -0.122 216 TYR AAA CE1 1513 C CE2 . TYR A 210 ? 1.244 1.582 1.162 -0.131 -0.149 -0.149 216 TYR AAA CE2 1514 C CZ . TYR A 210 ? 1.266 1.565 1.164 -0.119 -0.136 -0.146 216 TYR AAA CZ 1515 O OH . TYR A 210 ? 1.374 1.646 1.244 -0.109 -0.139 -0.168 216 TYR AAA OH 1516 N N . ASP A 211 ? 1.060 1.403 1.083 -0.180 -0.099 -0.043 217 ASP AAA N 1517 C CA . ASP A 211 ? 1.034 1.324 1.052 -0.181 -0.092 -0.033 217 ASP AAA CA 1518 C C . ASP A 211 ? 0.975 1.264 0.965 -0.155 -0.077 -0.022 217 ASP AAA C 1519 O O . ASP A 211 ? 0.915 1.234 0.887 -0.138 -0.075 -0.026 217 ASP AAA O 1520 C CB . ASP A 211 ? 1.130 1.417 1.181 -0.210 -0.091 -0.011 217 ASP AAA CB 1521 C CG . ASP A 211 ? 1.210 1.550 1.275 -0.213 -0.076 0.016 217 ASP AAA CG 1522 O OD1 . ASP A 211 ? 1.263 1.653 1.324 -0.201 -0.074 0.011 217 ASP AAA OD1 1523 O OD2 . ASP A 211 ? 1.183 1.514 1.259 -0.226 -0.068 0.041 217 ASP AAA OD2 1524 N N . GLU A 212 ? 1.035 1.291 1.021 -0.154 -0.069 -0.007 218 GLU AAA N 1525 C CA . GLU A 212 ? 0.974 1.227 0.935 -0.131 -0.056 0.003 218 GLU AAA CA 1526 C C . GLU A 212 ? 0.894 1.194 0.858 -0.128 -0.045 0.022 218 GLU AAA C 1527 O O . GLU A 212 ? 0.854 1.155 0.798 -0.111 -0.036 0.029 218 GLU AAA O 1528 C CB . GLU A 212 ? 1.003 1.210 0.963 -0.130 -0.053 0.013 218 GLU AAA CB 1529 C CG . GLU A 212 ? 1.087 1.249 1.034 -0.121 -0.061 -0.010 218 GLU AAA CG 1530 C CD . GLU A 212 ? 1.058 1.224 0.975 -0.097 -0.058 -0.027 218 GLU AAA CD 1531 O OE1 . GLU A 212 ? 0.933 1.101 0.835 -0.082 -0.048 -0.016 218 GLU AAA OE1 1532 O OE2 . GLU A 212 ? 1.064 1.231 0.971 -0.095 -0.066 -0.050 218 GLU AAA OE2 1533 N N . LYS A 213 ? 0.860 1.202 0.847 -0.143 -0.047 0.027 219 LYS AAA N 1534 C CA . LYS A 213 ? 0.822 1.219 0.812 -0.135 -0.037 0.038 219 LYS AAA CA 1535 C C . LYS A 213 ? 0.777 1.191 0.747 -0.111 -0.040 0.022 219 LYS AAA C 1536 O O . LYS A 213 ? 0.711 1.160 0.676 -0.098 -0.033 0.028 219 LYS AAA O 1537 C CB . LYS A 213 ? 0.848 1.290 0.873 -0.158 -0.038 0.048 219 LYS AAA CB 1538 C CG . LYS A 213 ? 0.900 1.346 0.943 -0.178 -0.028 0.075 219 LYS AAA CG 1539 C CD . LYS A 213 ? 0.965 1.444 1.047 -0.210 -0.031 0.085 219 LYS AAA CD 1540 C CE . LYS A 213 ? 1.050 1.504 1.147 -0.236 -0.027 0.111 219 LYS AAA CE 1541 N NZ . LYS A 213 ? 1.118 1.501 1.215 -0.245 -0.041 0.102 219 LYS AAA NZ 1542 N N . VAL A 214 ? 0.819 1.206 0.773 -0.105 -0.051 0.002 220 VAL AAA N 1543 C CA . VAL A 214 ? 0.825 1.219 0.754 -0.082 -0.054 -0.010 220 VAL AAA CA 1544 C C . VAL A 214 ? 0.804 1.179 0.708 -0.064 -0.043 -0.003 220 VAL AAA C 1545 O O . VAL A 214 ? 0.801 1.195 0.693 -0.047 -0.042 -0.003 220 VAL AAA O 1546 C CB . VAL A 214 ? 0.906 1.276 0.822 -0.082 -0.067 -0.031 220 VAL AAA CB 1547 C CG1 . VAL A 214 ? 0.963 1.330 0.847 -0.060 -0.069 -0.038 220 VAL AAA CG1 1548 C CG2 . VAL A 214 ? 0.937 1.332 0.877 -0.098 -0.080 -0.041 220 VAL AAA CG2 1549 N N . ASP A 215 ? 0.807 1.146 0.705 -0.068 -0.038 0.002 221 ASP AAA N 1550 C CA . ASP A 215 ? 0.792 1.115 0.670 -0.054 -0.029 0.010 221 ASP AAA CA 1551 C C . ASP A 215 ? 0.766 1.123 0.645 -0.046 -0.021 0.021 221 ASP AAA C 1552 O O . ASP A 215 ? 0.805 1.160 0.664 -0.029 -0.018 0.019 221 ASP AAA O 1553 C CB . ASP A 215 ? 0.788 1.079 0.670 -0.061 -0.025 0.018 221 ASP AAA CB 1554 C CG . ASP A 215 ? 0.767 1.021 0.644 -0.062 -0.031 0.003 221 ASP AAA CG 1555 O OD1 . ASP A 215 ? 0.739 0.992 0.600 -0.054 -0.036 -0.013 221 ASP AAA OD1 1556 O OD2 . ASP A 215 ? 0.704 0.930 0.590 -0.068 -0.031 0.008 221 ASP AAA OD2 1557 N N . LEU A 216 ? 0.719 1.107 0.621 -0.058 -0.017 0.033 222 LEU AAA N 1558 C CA . LEU A 216 ? 0.704 1.130 0.608 -0.050 -0.008 0.043 222 LEU AAA CA 1559 C C . LEU A 216 ? 0.687 1.136 0.582 -0.031 -0.012 0.030 222 LEU AAA C 1560 O O . LEU A 216 ? 0.654 1.106 0.533 -0.014 -0.007 0.029 222 LEU AAA O 1561 C CB . LEU A 216 ? 0.702 1.165 0.635 -0.069 -0.003 0.057 222 LEU AAA CB 1562 C CG . LEU A 216 ? 0.712 1.162 0.650 -0.084 0.005 0.078 222 LEU AAA CG 1563 C CD1 . LEU A 216 ? 0.727 1.120 0.652 -0.084 0.001 0.077 222 LEU AAA CD1 1564 C CD2 . LEU A 216 ? 0.736 1.210 0.705 -0.110 0.005 0.092 222 LEU AAA CD2 1565 N N . TRP A 217 ? 0.715 1.176 0.620 -0.033 -0.022 0.020 223 TRP AAA N 1566 C CA . TRP A 217 ? 0.717 1.197 0.615 -0.014 -0.029 0.009 223 TRP AAA CA 1567 C C . TRP A 217 ? 0.689 1.130 0.554 0.003 -0.030 0.004 223 TRP AAA C 1568 O O . TRP A 217 ? 0.711 1.159 0.566 0.021 -0.027 0.003 223 TRP AAA O 1569 C CB . TRP A 217 ? 0.722 1.216 0.633 -0.021 -0.042 -0.001 223 TRP AAA CB 1570 C CG . TRP A 217 ? 0.724 1.230 0.625 -0.001 -0.052 -0.011 223 TRP AAA CG 1571 C CD1 . TRP A 217 ? 0.762 1.236 0.636 0.011 -0.061 -0.018 223 TRP AAA CD1 1572 C CD2 . TRP A 217 ? 0.715 1.271 0.635 0.011 -0.056 -0.014 223 TRP AAA CD2 1573 N NE1 . TRP A 217 ? 0.770 1.265 0.643 0.028 -0.071 -0.023 223 TRP AAA NE1 1574 C CE2 . TRP A 217 ? 0.748 1.293 0.649 0.030 -0.069 -0.022 223 TRP AAA CE2 1575 C CE3 . TRP A 217 ? 0.727 1.339 0.679 0.007 -0.051 -0.010 223 TRP AAA CE3 1576 C CZ2 . TRP A 217 ? 0.782 1.366 0.696 0.048 -0.077 -0.027 223 TRP AAA CZ2 1577 C CZ3 . TRP A 217 ? 0.706 1.363 0.672 0.024 -0.058 -0.017 223 TRP AAA CZ3 1578 C CH2 . TRP A 217 ? 0.739 1.379 0.685 0.046 -0.072 -0.026 223 TRP AAA CH2 1579 N N . CYS A 218 ? 0.662 1.064 0.513 -0.003 -0.033 0.000 224 CYS AAA N 1580 C CA . CYS A 218 ? 0.688 1.056 0.509 0.009 -0.034 -0.004 224 CYS AAA CA 1581 C C . CYS A 218 ? 0.648 1.009 0.459 0.019 -0.026 0.003 224 CYS AAA C 1582 O O . CYS A 218 ? 0.608 0.959 0.402 0.033 -0.028 -0.000 224 CYS AAA O 1583 C CB . CYS A 218 ? 0.734 1.071 0.546 0.000 -0.036 -0.008 224 CYS AAA CB 1584 S SG . CYS A 218 ? 0.808 1.154 0.626 -0.008 -0.050 -0.020 224 CYS AAA SG 1585 N N . ILE A 219 ? 0.698 1.064 0.519 0.011 -0.017 0.011 225 ILE AAA N 1586 C CA . ILE A 219 ? 0.679 1.043 0.490 0.019 -0.009 0.017 225 ILE AAA CA 1587 C C . ILE A 219 ? 0.672 1.061 0.481 0.034 -0.010 0.012 225 ILE AAA C 1588 O O . ILE A 219 ? 0.709 1.085 0.501 0.047 -0.010 0.008 225 ILE AAA O 1589 C CB . ILE A 219 ? 0.685 1.055 0.507 0.007 -0.001 0.029 225 ILE AAA CB 1590 C CG1 . ILE A 219 ? 0.701 1.038 0.523 -0.003 -0.002 0.032 225 ILE AAA CG1 1591 C CG2 . ILE A 219 ? 0.735 1.114 0.546 0.016 0.006 0.034 225 ILE AAA CG2 1592 C CD1 . ILE A 219 ? 0.762 1.100 0.598 -0.017 0.003 0.046 225 ILE AAA CD1 1593 N N . GLY A 220 ? 0.605 1.032 0.433 0.034 -0.010 0.012 226 GLY AAA N 1594 C CA . GLY A 220 ? 0.586 1.044 0.418 0.052 -0.012 0.004 226 GLY AAA CA 1595 C C . GLY A 220 ? 0.579 1.011 0.393 0.068 -0.023 -0.006 226 GLY AAA C 1596 O O . GLY A 220 ? 0.557 0.987 0.361 0.086 -0.024 -0.012 226 GLY AAA O 1597 N N . VAL A 221 ? 0.573 0.988 0.385 0.062 -0.032 -0.007 227 VAL AAA N 1598 C CA . VAL A 221 ? 0.602 0.990 0.395 0.075 -0.043 -0.012 227 VAL AAA CA 1599 C C . VAL A 221 ? 0.626 0.974 0.395 0.077 -0.041 -0.010 227 VAL AAA C 1600 O O . VAL A 221 ? 0.631 0.965 0.388 0.093 -0.046 -0.014 227 VAL AAA O 1601 C CB . VAL A 221 ? 0.600 0.981 0.391 0.065 -0.052 -0.012 227 VAL AAA CB 1602 C CG1 . VAL A 221 ? 0.609 0.965 0.378 0.078 -0.064 -0.013 227 VAL AAA CG1 1603 C CG2 . VAL A 221 ? 0.603 1.025 0.421 0.059 -0.055 -0.015 227 VAL AAA CG2 1604 N N . LEU A 222 ? 0.644 0.975 0.409 0.062 -0.034 -0.005 228 LEU AAA N 1605 C CA . LEU A 222 ? 0.665 0.964 0.412 0.061 -0.031 -0.003 228 LEU AAA CA 1606 C C . LEU A 222 ? 0.639 0.940 0.382 0.072 -0.029 -0.007 228 LEU AAA C 1607 O O . LEU A 222 ? 0.640 0.914 0.367 0.078 -0.034 -0.009 228 LEU AAA O 1608 C CB . LEU A 222 ? 0.665 0.956 0.415 0.046 -0.023 0.001 228 LEU AAA CB 1609 C CG . LEU A 222 ? 0.640 0.907 0.375 0.044 -0.020 0.003 228 LEU AAA CG 1610 C CD1 . LEU A 222 ? 0.654 0.897 0.371 0.044 -0.026 0.002 228 LEU AAA CD1 1611 C CD2 . LEU A 222 ? 0.618 0.883 0.360 0.034 -0.013 0.007 228 LEU AAA CD2 1612 N N . CYS A 223 ? 0.641 0.974 0.398 0.074 -0.022 -0.007 229 CYS AAA N 1613 C CA . CYS A 223 ? 0.675 1.017 0.427 0.086 -0.019 -0.012 229 CYS AAA CA 1614 C C . CYS A 223 ? 0.706 1.041 0.452 0.106 -0.029 -0.023 229 CYS AAA C 1615 O O . CYS A 223 ? 0.743 1.053 0.474 0.113 -0.033 -0.030 229 CYS AAA O 1616 C CB . CYS A 223 ? 0.677 1.061 0.443 0.084 -0.010 -0.009 229 CYS AAA CB 1617 S SG . CYS A 223 ? 0.715 1.106 0.468 0.093 -0.004 -0.014 229 CYS AAA SG 1618 N N . TYR A 224 ? 0.684 1.039 0.441 0.114 -0.034 -0.025 230 TYR AAA N 1619 C CA . TYR A 224 ? 0.700 1.048 0.454 0.136 -0.046 -0.035 230 TYR AAA CA 1620 C C . TYR A 224 ? 0.752 1.046 0.484 0.136 -0.056 -0.033 230 TYR AAA C 1621 O O . TYR A 224 ? 0.855 1.126 0.577 0.150 -0.063 -0.041 230 TYR AAA O 1622 C CB . TYR A 224 ? 0.695 1.077 0.467 0.143 -0.051 -0.036 230 TYR AAA CB 1623 C CG . TYR A 224 ? 0.727 1.107 0.498 0.170 -0.063 -0.047 230 TYR AAA CG 1624 C CD1 . TYR A 224 ? 0.742 1.078 0.497 0.177 -0.078 -0.044 230 TYR AAA CD1 1625 C CD2 . TYR A 224 ? 0.732 1.155 0.519 0.189 -0.061 -0.059 230 TYR AAA CD2 1626 C CE1 . TYR A 224 ? 0.769 1.098 0.524 0.203 -0.091 -0.053 230 TYR AAA CE1 1627 C CE2 . TYR A 224 ? 0.766 1.187 0.555 0.217 -0.073 -0.070 230 TYR AAA CE2 1628 C CZ . TYR A 224 ? 0.787 1.157 0.560 0.225 -0.090 -0.067 230 TYR AAA CZ 1629 O OH . TYR A 224 ? 0.814 1.177 0.588 0.255 -0.104 -0.077 230 TYR AAA OH 1630 N N . GLU A 225 ? 0.727 1.003 0.453 0.120 -0.057 -0.023 231 GLU AAA N 1631 C CA . GLU A 225 ? 0.739 0.970 0.444 0.116 -0.066 -0.017 231 GLU AAA CA 1632 C C . GLU A 225 ? 0.748 0.950 0.441 0.112 -0.063 -0.018 231 GLU AAA C 1633 O O . GLU A 225 ? 0.767 0.936 0.448 0.120 -0.073 -0.019 231 GLU AAA O 1634 C CB . GLU A 225 ? 0.729 0.959 0.430 0.099 -0.064 -0.007 231 GLU AAA CB 1635 C CG . GLU A 225 ? 0.779 0.971 0.457 0.095 -0.071 0.001 231 GLU AAA CG 1636 C CD . GLU A 225 ? 0.822 1.017 0.492 0.087 -0.075 0.008 231 GLU AAA CD 1637 O OE1 . GLU A 225 ? 0.811 1.037 0.495 0.085 -0.073 0.004 231 GLU AAA OE1 1638 O OE2 . GLU A 225 ? 0.840 1.009 0.489 0.082 -0.080 0.017 231 GLU AAA OE2 1639 N N . LEU A 226 ? 0.726 0.939 0.423 0.099 -0.052 -0.017 232 LEU AAA N 1640 C CA . LEU A 226 ? 0.744 0.937 0.432 0.093 -0.050 -0.019 232 LEU AAA CA 1641 C C . LEU A 226 ? 0.751 0.934 0.436 0.109 -0.057 -0.032 232 LEU AAA C 1642 O O . LEU A 226 ? 0.751 0.899 0.424 0.107 -0.064 -0.034 232 LEU AAA O 1643 C CB . LEU A 226 ? 0.726 0.940 0.422 0.081 -0.038 -0.016 232 LEU AAA CB 1644 C CG . LEU A 226 ? 0.719 0.937 0.419 0.066 -0.032 -0.006 232 LEU AAA CG 1645 C CD1 . LEU A 226 ? 0.718 0.959 0.429 0.059 -0.022 -0.003 232 LEU AAA CD1 1646 C CD2 . LEU A 226 ? 0.731 0.921 0.418 0.055 -0.034 -0.001 232 LEU AAA CD2 1647 N N . LEU A 227 ? 0.761 0.976 0.456 0.125 -0.056 -0.041 233 LEU AAA N 1648 C CA . LEU A 227 ? 0.817 1.031 0.509 0.145 -0.061 -0.058 233 LEU AAA CA 1649 C C . LEU A 227 ? 0.832 1.014 0.518 0.162 -0.076 -0.065 233 LEU AAA C 1650 O O . LEU A 227 ? 0.871 1.022 0.547 0.171 -0.085 -0.077 233 LEU AAA O 1651 C CB . LEU A 227 ? 0.828 1.096 0.533 0.155 -0.051 -0.065 233 LEU AAA CB 1652 C CG . LEU A 227 ? 0.810 1.107 0.517 0.141 -0.037 -0.059 233 LEU AAA CG 1653 C CD1 . LEU A 227 ? 0.824 1.177 0.545 0.148 -0.027 -0.061 233 LEU AAA CD1 1654 C CD2 . LEU A 227 ? 0.812 1.091 0.506 0.139 -0.039 -0.067 233 LEU AAA CD2 1655 N N . VAL A 228 ? 0.822 1.008 0.513 0.167 -0.081 -0.057 234 VAL AAA N 1656 C CA . VAL A 228 ? 0.838 1.001 0.527 0.189 -0.097 -0.062 234 VAL AAA CA 1657 C C . VAL A 228 ? 0.872 0.981 0.544 0.179 -0.108 -0.047 234 VAL AAA C 1658 O O . VAL A 228 ? 0.907 0.975 0.571 0.193 -0.123 -0.051 234 VAL AAA O 1659 C CB . VAL A 228 ? 0.840 1.047 0.546 0.203 -0.097 -0.063 234 VAL AAA CB 1660 C CG1 . VAL A 228 ? 0.894 1.080 0.600 0.231 -0.115 -0.069 234 VAL AAA CG1 1661 C CG2 . VAL A 228 ? 0.841 1.107 0.565 0.208 -0.084 -0.073 234 VAL AAA CG2 1662 N N . GLY A 229 ? 0.871 0.980 0.538 0.155 -0.101 -0.031 235 GLY AAA N 1663 C CA . GLY A 229 ? 0.864 0.933 0.514 0.141 -0.108 -0.014 235 GLY AAA CA 1664 C C . GLY A 229 ? 0.844 0.926 0.491 0.140 -0.111 -0.002 235 GLY AAA C 1665 O O . GLY A 229 ? 0.882 0.940 0.513 0.126 -0.114 0.014 235 GLY AAA O 1666 N N . TYR A 230 ? 0.810 0.932 0.473 0.154 -0.111 -0.008 236 TYR AAA N 1667 C CA . TYR A 230 ? 0.812 0.952 0.475 0.156 -0.117 -0.000 236 TYR AAA CA 1668 C C . TYR A 230 ? 0.779 0.976 0.466 0.156 -0.108 -0.009 236 TYR AAA C 1669 O O . TYR A 230 ? 0.790 1.012 0.493 0.164 -0.101 -0.021 236 TYR AAA O 1670 C CB . TYR A 230 ? 0.858 0.976 0.515 0.179 -0.136 0.003 236 TYR AAA CB 1671 C CG . TYR A 230 ? 0.891 1.019 0.564 0.207 -0.143 -0.014 236 TYR AAA CG 1672 C CD1 . TYR A 230 ? 0.880 1.063 0.577 0.220 -0.139 -0.026 236 TYR AAA CD1 1673 C CD2 . TYR A 230 ? 0.948 1.031 0.613 0.220 -0.152 -0.020 236 TYR AAA CD2 1674 C CE1 . TYR A 230 ? 0.899 1.098 0.611 0.248 -0.144 -0.043 236 TYR AAA CE1 1675 C CE2 . TYR A 230 ? 0.971 1.063 0.649 0.249 -0.159 -0.039 236 TYR AAA CE2 1676 C CZ . TYR A 230 ? 0.951 1.104 0.653 0.264 -0.154 -0.050 236 TYR AAA CZ 1677 O OH . TYR A 230 ? 0.986 1.156 0.702 0.294 -0.158 -0.071 236 TYR AAA OH 1678 N N . PRO A 231 ? 0.802 1.021 0.491 0.147 -0.109 -0.004 237 PRO AAA N 1679 C CA . PRO A 231 ? 0.761 1.031 0.476 0.143 -0.101 -0.011 237 PRO AAA CA 1680 C C . PRO A 231 ? 0.763 1.067 0.498 0.166 -0.108 -0.020 237 PRO AAA C 1681 O O . PRO A 231 ? 0.828 1.119 0.557 0.185 -0.124 -0.019 237 PRO AAA O 1682 C CB . PRO A 231 ? 0.767 1.044 0.475 0.129 -0.104 -0.004 237 PRO AAA CB 1683 C CG . PRO A 231 ? 0.788 1.021 0.465 0.122 -0.108 0.007 237 PRO AAA CG 1684 C CD . PRO A 231 ? 0.816 1.015 0.484 0.139 -0.117 0.009 237 PRO AAA CD 1685 N N . PRO A 232 ? 0.745 1.096 0.506 0.165 -0.098 -0.028 238 PRO AAA N 1686 C CA . PRO A 232 ? 0.757 1.148 0.539 0.188 -0.102 -0.038 238 PRO AAA CA 1687 C C . PRO A 232 ? 0.799 1.213 0.591 0.201 -0.118 -0.038 238 PRO AAA C 1688 O O . PRO A 232 ? 0.813 1.235 0.612 0.228 -0.128 -0.045 238 PRO AAA O 1689 C CB . PRO A 232 ? 0.736 1.176 0.542 0.175 -0.086 -0.042 238 PRO AAA CB 1690 C CG . PRO A 232 ? 0.726 1.154 0.527 0.146 -0.078 -0.032 238 PRO AAA CG 1691 C CD . PRO A 232 ? 0.736 1.105 0.506 0.142 -0.083 -0.026 238 PRO AAA CD 1692 N N . PHE A 233 ? 0.841 1.264 0.633 0.183 -0.121 -0.031 239 PHE AAA N 1693 C CA . PHE A 233 ? 0.861 1.319 0.668 0.191 -0.135 -0.032 239 PHE AAA CA 1694 C C . PHE A 233 ? 0.913 1.331 0.691 0.202 -0.154 -0.024 239 PHE AAA C 1695 O O . PHE A 233 ? 0.909 1.354 0.697 0.215 -0.169 -0.024 239 PHE AAA O 1696 C CB . PHE A 233 ? 0.824 1.316 0.647 0.164 -0.130 -0.032 239 PHE AAA CB 1697 C CG . PHE A 233 ? 0.823 1.355 0.674 0.152 -0.114 -0.037 239 PHE AAA CG 1698 C CD1 . PHE A 233 ? 0.788 1.373 0.669 0.166 -0.112 -0.044 239 PHE AAA CD1 1699 C CD2 . PHE A 233 ? 0.811 1.328 0.659 0.126 -0.099 -0.033 239 PHE AAA CD2 1700 C CE1 . PHE A 233 ? 0.739 1.364 0.644 0.153 -0.096 -0.045 239 PHE AAA CE1 1701 C CE2 . PHE A 233 ? 0.758 1.309 0.630 0.114 -0.085 -0.033 239 PHE AAA CE2 1702 C CZ . PHE A 233 ? 0.736 1.342 0.636 0.126 -0.082 -0.038 239 PHE AAA CZ 1703 N N . GLU A 234 ? 1.016 1.377 0.763 0.196 -0.153 -0.014 240 GLU AAA N 1704 C CA . GLU A 234 ? 1.211 1.532 0.927 0.201 -0.169 -0.001 240 GLU AAA CA 1705 C C . GLU A 234 ? 1.270 1.587 0.990 0.234 -0.187 -0.001 240 GLU AAA C 1706 O O . GLU A 234 ? 1.244 1.570 0.982 0.252 -0.184 -0.013 240 GLU AAA O 1707 C CB . GLU A 234 ? 1.287 1.551 0.973 0.187 -0.162 0.010 240 GLU AAA CB 1708 C CG . GLU A 234 ? 1.243 1.467 0.923 0.203 -0.164 0.010 240 GLU AAA CG 1709 C CD . GLU A 234 ? 1.206 1.370 0.853 0.193 -0.167 0.025 240 GLU AAA CD 1710 O OE1 . GLU A 234 ? 1.155 1.281 0.793 0.211 -0.181 0.031 240 GLU AAA OE1 1711 O OE2 . GLU A 234 ? 1.198 1.355 0.832 0.169 -0.156 0.032 240 GLU AAA OE2 1712 N N . SER A 235 ? 1.331 1.638 1.034 0.243 -0.206 0.010 241 SER AAA N 1713 C CA . SER A 235 ? 1.342 1.640 1.046 0.277 -0.228 0.013 241 SER AAA CA 1714 C C . SER A 235 ? 1.300 1.554 0.967 0.276 -0.244 0.036 241 SER AAA C 1715 O O . SER A 235 ? 1.335 1.555 0.974 0.252 -0.235 0.047 241 SER AAA O 1716 C CB . SER A 235 ? 1.316 1.680 1.054 0.294 -0.235 0.001 241 SER AAA CB 1717 O OG . SER A 235 ? 1.338 1.731 1.072 0.282 -0.244 0.007 241 SER AAA OG 1718 N N . ALA A 236 ? 1.318 1.575 0.983 0.303 -0.267 0.042 242 ALA AAA N 1719 C CA . ALA A 236 ? 1.383 1.608 1.012 0.304 -0.286 0.067 242 ALA AAA CA 1720 C C . ALA A 236 ? 1.338 1.618 0.968 0.298 -0.294 0.066 242 ALA AAA C 1721 O O . ALA A 236 ? 1.396 1.662 0.992 0.284 -0.299 0.083 242 ALA AAA O 1722 C CB . ALA A 236 ? 1.443 1.629 1.066 0.338 -0.308 0.076 242 ALA AAA CB 1723 N N . SER A 237 ? 1.291 1.635 0.960 0.309 -0.296 0.047 243 SER AAA N 1724 C CA . SER A 237 ? 1.292 1.697 0.972 0.302 -0.305 0.042 243 SER AAA CA 1725 C C . SER A 237 ? 1.269 1.703 0.961 0.268 -0.283 0.027 243 SER AAA C 1726 O O . SER A 237 ? 1.267 1.700 0.979 0.260 -0.263 0.017 243 SER AAA O 1727 C CB . SER A 237 ? 1.312 1.770 1.030 0.332 -0.321 0.030 243 SER AAA CB 1728 O OG . SER A 237 ? 1.395 1.916 1.128 0.324 -0.330 0.023 243 SER AAA OG 1729 N N . HIS A 238 ? 1.293 1.753 0.974 0.250 -0.288 0.027 244 HIS AAA N 1730 C CA . HIS A 238 ? 1.230 1.715 0.922 0.218 -0.272 0.012 244 HIS AAA CA 1731 C C . HIS A 238 ? 1.116 1.667 0.859 0.219 -0.272 -0.006 244 HIS AAA C 1732 O O . HIS A 238 ? 1.033 1.596 0.799 0.199 -0.253 -0.017 244 HIS AAA O 1733 C CB . HIS A 238 ? 1.284 1.768 0.941 0.202 -0.279 0.017 244 HIS AAA CB 1734 C CG . HIS A 238 ? 1.364 1.791 0.974 0.198 -0.275 0.036 244 HIS AAA CG 1735 N ND1 . HIS A 238 ? 1.378 1.762 0.981 0.188 -0.254 0.041 244 HIS AAA ND1 1736 C CD2 . HIS A 238 ? 1.447 1.855 1.014 0.202 -0.289 0.055 244 HIS AAA CD2 1737 C CE1 . HIS A 238 ? 1.384 1.726 0.945 0.184 -0.255 0.060 244 HIS AAA CE1 1738 N NE2 . HIS A 238 ? 1.449 1.804 0.986 0.193 -0.276 0.070 244 HIS AAA NE2 1739 N N . SER A 239 ? 1.124 1.716 0.882 0.240 -0.294 -0.008 245 SER AAA N 1740 C CA . SER A 239 ? 1.102 1.766 0.913 0.245 -0.298 -0.024 245 SER AAA CA 1741 C C . SER A 239 ? 1.086 1.755 0.926 0.255 -0.280 -0.030 245 SER AAA C 1742 O O . SER A 239 ? 1.059 1.778 0.940 0.241 -0.269 -0.042 245 SER AAA O 1743 C CB . SER A 239 ? 1.117 1.819 0.935 0.272 -0.326 -0.021 245 SER AAA CB 1744 O OG . SER A 239 ? 1.097 1.870 0.969 0.281 -0.328 -0.036 245 SER AAA OG 1745 N N . GLU A 240 ? 1.082 1.701 0.903 0.276 -0.279 -0.021 246 GLU AAA N 1746 C CA . GLU A 240 ? 1.015 1.631 0.857 0.289 -0.263 -0.028 246 GLU AAA CA 1747 C C . GLU A 240 ? 0.956 1.560 0.799 0.257 -0.236 -0.032 246 GLU AAA C 1748 O O . GLU A 240 ? 0.918 1.571 0.798 0.248 -0.223 -0.043 246 GLU AAA O 1749 C CB . GLU A 240 ? 1.048 1.603 0.864 0.317 -0.270 -0.018 246 GLU AAA CB 1750 C CG . GLU A 240 ? 1.047 1.594 0.879 0.331 -0.256 -0.029 246 GLU AAA CG 1751 C CD . GLU A 240 ? 1.029 1.630 0.900 0.365 -0.263 -0.043 246 GLU AAA CD 1752 O OE1 . GLU A 240 ? 1.093 1.695 0.963 0.395 -0.287 -0.039 246 GLU AAA OE1 1753 O OE2 . GLU A 240 ? 0.953 1.597 0.854 0.362 -0.245 -0.057 246 GLU AAA OE2 1754 N N . THR A 241 ? 0.936 1.482 0.742 0.239 -0.229 -0.022 247 THR AAA N 1755 C CA . THR A 241 ? 0.878 1.406 0.681 0.209 -0.206 -0.024 247 THR AAA CA 1756 C C . THR A 241 ? 0.835 1.418 0.670 0.186 -0.200 -0.035 247 THR AAA C 1757 O O . THR A 241 ? 0.756 1.351 0.611 0.171 -0.181 -0.039 247 THR AAA O 1758 C CB . THR A 241 ? 0.870 1.340 0.630 0.194 -0.203 -0.013 247 THR AAA CB 1759 O OG1 . THR A 241 ? 0.875 1.294 0.610 0.212 -0.208 -0.002 247 THR AAA OG1 1760 C CG2 . THR A 241 ? 0.853 1.308 0.612 0.166 -0.181 -0.016 247 THR AAA CG2 1761 N N . TYR A 242 ? 0.923 1.538 0.764 0.182 -0.216 -0.037 248 TYR AAA N 1762 C CA . TYR A 242 ? 0.962 1.627 0.834 0.158 -0.215 -0.048 248 TYR AAA CA 1763 C C . TYR A 242 ? 0.897 1.623 0.817 0.163 -0.209 -0.055 248 TYR AAA C 1764 O O . TYR A 242 ? 0.842 1.588 0.787 0.138 -0.194 -0.059 248 TYR AAA O 1765 C CB . TYR A 242 ? 1.031 1.716 0.893 0.158 -0.238 -0.050 248 TYR AAA CB 1766 C CG . TYR A 242 ? 1.077 1.799 0.962 0.129 -0.241 -0.063 248 TYR AAA CG 1767 C CD1 . TYR A 242 ? 1.083 1.772 0.947 0.103 -0.234 -0.067 248 TYR AAA CD1 1768 C CD2 . TYR A 242 ? 1.177 1.967 1.105 0.128 -0.250 -0.072 248 TYR AAA CD2 1769 C CE1 . TYR A 242 ? 1.161 1.879 1.046 0.077 -0.239 -0.080 248 TYR AAA CE1 1770 C CE2 . TYR A 242 ? 1.209 2.031 1.161 0.099 -0.255 -0.084 248 TYR AAA CE2 1771 C CZ . TYR A 242 ? 1.233 2.015 1.162 0.073 -0.249 -0.088 248 TYR AAA CZ 1772 O OH . TYR A 242 ? 1.294 2.103 1.246 0.044 -0.255 -0.102 248 TYR AAA OH 1773 N N . ARG A 243 ? 0.903 1.656 0.837 0.195 -0.220 -0.056 249 ARG AAA N 1774 C CA . ARG A 243 ? 0.920 1.741 0.901 0.206 -0.214 -0.064 249 ARG AAA CA 1775 C C . ARG A 243 ? 0.856 1.665 0.841 0.201 -0.189 -0.064 249 ARG AAA C 1776 O O . ARG A 243 ? 0.806 1.665 0.826 0.184 -0.175 -0.068 249 ARG AAA O 1777 C CB . ARG A 243 ? 0.999 1.841 0.986 0.247 -0.233 -0.067 249 ARG AAA CB 1778 C CG . ARG A 243 ? 1.049 1.971 1.087 0.263 -0.229 -0.077 249 ARG AAA CG 1779 C CD . ARG A 243 ? 1.133 2.060 1.173 0.311 -0.244 -0.081 249 ARG AAA CD 1780 N NE . ARG A 243 ? 1.217 2.070 1.221 0.329 -0.238 -0.077 249 ARG AAA NE 1781 C CZ . ARG A 243 ? 1.218 2.070 1.229 0.337 -0.219 -0.084 249 ARG AAA CZ 1782 N NH1 . ARG A 243 ? 1.255 2.177 1.305 0.329 -0.203 -0.093 249 ARG AAA NH1 1783 N NH2 . ARG A 243 ? 1.196 1.976 1.173 0.351 -0.217 -0.081 249 ARG AAA NH2 1784 N N . ARG A 244 ? 0.855 1.602 0.807 0.215 -0.184 -0.059 250 ARG AAA N 1785 C CA . ARG A 244 ? 0.826 1.558 0.776 0.216 -0.163 -0.060 250 ARG AAA CA 1786 C C . ARG A 244 ? 0.775 1.504 0.729 0.178 -0.144 -0.056 250 ARG AAA C 1787 O O . ARG A 244 ? 0.737 1.493 0.709 0.174 -0.126 -0.058 250 ARG AAA O 1788 C CB . ARG A 244 ? 0.867 1.525 0.777 0.233 -0.165 -0.055 250 ARG AAA CB 1789 C CG . ARG A 244 ? 0.941 1.591 0.847 0.273 -0.183 -0.059 250 ARG AAA CG 1790 C CD . ARG A 244 ? 0.998 1.581 0.873 0.289 -0.183 -0.056 250 ARG AAA CD 1791 N NE . ARG A 244 ? 1.064 1.660 0.951 0.294 -0.165 -0.067 250 ARG AAA NE 1792 C CZ . ARG A 244 ? 1.148 1.692 1.012 0.297 -0.158 -0.068 250 ARG AAA CZ 1793 N NH1 . ARG A 244 ? 1.203 1.677 1.032 0.295 -0.167 -0.057 250 ARG AAA NH1 1794 N NH2 . ARG A 244 ? 1.159 1.725 1.034 0.302 -0.142 -0.079 250 ARG AAA NH2 1795 N N . ILE A 245 ? 0.723 1.422 0.661 0.154 -0.148 -0.052 251 ILE AAA N 1796 C CA . ILE A 245 ? 0.706 1.394 0.646 0.120 -0.133 -0.048 251 ILE AAA CA 1797 C C . ILE A 245 ? 0.705 1.461 0.691 0.102 -0.128 -0.051 251 ILE AAA C 1798 O O . ILE A 245 ? 0.715 1.484 0.715 0.088 -0.110 -0.047 251 ILE AAA O 1799 C CB . ILE A 245 ? 0.709 1.351 0.621 0.103 -0.139 -0.046 251 ILE AAA CB 1800 C CG1 . ILE A 245 ? 0.743 1.321 0.612 0.114 -0.138 -0.040 251 ILE AAA CG1 1801 C CG2 . ILE A 245 ? 0.704 1.344 0.628 0.069 -0.128 -0.046 251 ILE AAA CG2 1802 C CD1 . ILE A 245 ? 0.760 1.306 0.599 0.107 -0.150 -0.039 251 ILE AAA CD1 1803 N N . LEU A 246 ? 0.722 1.519 0.728 0.101 -0.144 -0.057 252 LEU AAA N 1804 C CA . LEU A 246 ? 0.733 1.596 0.785 0.078 -0.143 -0.060 252 LEU AAA CA 1805 C C . LEU A 246 ? 0.722 1.647 0.808 0.090 -0.131 -0.060 252 LEU AAA C 1806 O O . LEU A 246 ? 0.702 1.671 0.822 0.065 -0.120 -0.056 252 LEU AAA O 1807 C CB . LEU A 246 ? 0.744 1.636 0.807 0.078 -0.167 -0.068 252 LEU AAA CB 1808 C CG . LEU A 246 ? 0.756 1.598 0.788 0.063 -0.179 -0.071 252 LEU AAA CG 1809 C CD1 . LEU A 246 ? 0.796 1.678 0.842 0.061 -0.202 -0.080 252 LEU AAA CD1 1810 C CD2 . LEU A 246 ? 0.743 1.554 0.775 0.029 -0.165 -0.069 252 LEU AAA CD2 1811 N N . LYS A 247 ? 0.739 1.667 0.815 0.127 -0.132 -0.063 253 LYS AAA N 1812 C CA . LYS A 247 ? 0.754 1.741 0.858 0.145 -0.120 -0.067 253 LYS AAA CA 1813 C C . LYS A 247 ? 0.734 1.685 0.816 0.145 -0.099 -0.062 253 LYS AAA C 1814 O O . LYS A 247 ? 0.683 1.679 0.780 0.160 -0.086 -0.066 253 LYS AAA O 1815 C CB . LYS A 247 ? 0.797 1.806 0.904 0.188 -0.135 -0.077 253 LYS AAA CB 1816 C CG . LYS A 247 ? 0.844 1.893 0.973 0.193 -0.158 -0.082 253 LYS AAA CG 1817 C CD . LYS A 247 ? 0.880 2.029 1.061 0.204 -0.158 -0.090 253 LYS AAA CD 1818 C CE . LYS A 247 ? 0.903 2.109 1.122 0.163 -0.143 -0.085 253 LYS AAA CE 1819 N NZ . LYS A 247 ? 0.918 2.119 1.144 0.129 -0.156 -0.083 253 LYS AAA NZ 1820 N N . VAL A 248 ? 0.745 1.624 0.792 0.129 -0.096 -0.055 254 VAL AAA N 1821 C CA . VAL A 248 ? 0.749 1.579 0.767 0.130 -0.080 -0.050 254 VAL AAA CA 1822 C C . VAL A 248 ? 0.785 1.618 0.794 0.168 -0.080 -0.059 254 VAL AAA C 1823 O O . VAL A 248 ? 0.812 1.657 0.820 0.172 -0.064 -0.060 254 VAL AAA O 1824 C CB . VAL A 248 ? 0.737 1.588 0.770 0.101 -0.060 -0.040 254 VAL AAA CB 1825 C CG1 . VAL A 248 ? 0.717 1.537 0.749 0.066 -0.062 -0.031 254 VAL AAA CG1 1826 C CG2 . VAL A 248 ? 0.799 1.738 0.873 0.099 -0.051 -0.040 254 VAL AAA CG2 1827 N N . ASP A 249 ? 0.795 1.614 0.795 0.197 -0.098 -0.067 255 ASP AAA N 1828 C CA . ASP A 249 ? 0.797 1.612 0.790 0.237 -0.103 -0.078 255 ASP AAA CA 1829 C C . ASP A 249 ? 0.799 1.537 0.751 0.241 -0.100 -0.077 255 ASP AAA C 1830 O O . ASP A 249 ? 0.896 1.580 0.824 0.257 -0.115 -0.076 255 ASP AAA O 1831 C CB . ASP A 249 ? 0.836 1.657 0.834 0.263 -0.127 -0.083 255 ASP AAA CB 1832 C CG . ASP A 249 ? 0.847 1.667 0.844 0.308 -0.136 -0.096 255 ASP AAA CG 1833 O OD1 . ASP A 249 ? 0.825 1.632 0.813 0.320 -0.124 -0.104 255 ASP AAA OD1 1834 O OD2 . ASP A 249 ? 0.856 1.686 0.861 0.331 -0.156 -0.099 255 ASP AAA OD2 1835 N N . VAL A 250 ? 0.771 1.509 0.719 0.228 -0.081 -0.075 256 VAL AAA N 1836 C CA . VAL A 250 ? 0.801 1.475 0.714 0.230 -0.076 -0.075 256 VAL AAA CA 1837 C C . VAL A 250 ? 0.853 1.533 0.764 0.267 -0.078 -0.092 256 VAL AAA C 1838 O O . VAL A 250 ? 0.808 1.555 0.744 0.279 -0.069 -0.102 256 VAL AAA O 1839 C CB . VAL A 250 ? 0.805 1.483 0.716 0.201 -0.056 -0.066 256 VAL AAA CB 1840 C CG1 . VAL A 250 ? 0.823 1.441 0.701 0.202 -0.053 -0.066 256 VAL AAA CG1 1841 C CG2 . VAL A 250 ? 0.788 1.466 0.707 0.167 -0.055 -0.052 256 VAL AAA CG2 1842 N N . ARG A 251 ? 0.943 1.557 0.826 0.283 -0.090 -0.096 257 ARG AAA N 1843 C CA . ARG A 251 ? 1.051 1.654 0.928 0.319 -0.096 -0.115 257 ARG AAA CA 1844 C C . ARG A 251 ? 1.099 1.638 0.945 0.314 -0.093 -0.116 257 ARG AAA C 1845 O O . ARG A 251 ? 1.170 1.643 0.993 0.306 -0.104 -0.107 257 ARG AAA O 1846 C CB . ARG A 251 ? 1.146 1.727 1.024 0.349 -0.119 -0.119 257 ARG AAA CB 1847 C CG . ARG A 251 ? 1.196 1.849 1.109 0.362 -0.124 -0.122 257 ARG AAA CG 1848 C CD . ARG A 251 ? 1.261 1.892 1.174 0.396 -0.149 -0.127 257 ARG AAA CD 1849 N NE . ARG A 251 ? 1.311 1.978 1.243 0.390 -0.160 -0.117 257 ARG AAA NE 1850 C CZ . ARG A 251 ? 1.383 2.015 1.303 0.402 -0.183 -0.108 257 ARG AAA CZ 1851 N NH1 . ARG A 251 ? 1.482 2.036 1.371 0.417 -0.197 -0.105 257 ARG AAA NH1 1852 N NH2 . ARG A 251 ? 1.368 2.041 1.305 0.395 -0.192 -0.101 257 ARG AAA NH2 1853 N N . PHE A 252 ? 1.059 1.623 0.904 0.318 -0.079 -0.128 258 PHE AAA N 1854 C CA . PHE A 252 ? 0.994 1.511 0.812 0.310 -0.074 -0.131 258 PHE AAA CA 1855 C C . PHE A 252 ? 0.995 1.473 0.800 0.343 -0.088 -0.153 258 PHE AAA C 1856 O O . PHE A 252 ? 1.021 1.536 0.840 0.374 -0.090 -0.172 258 PHE AAA O 1857 C CB . PHE A 252 ? 0.949 1.518 0.772 0.298 -0.053 -0.133 258 PHE AAA CB 1858 C CG . PHE A 252 ? 0.892 1.500 0.730 0.266 -0.040 -0.112 258 PHE AAA CG 1859 C CD1 . PHE A 252 ? 0.835 1.406 0.660 0.235 -0.036 -0.094 258 PHE AAA CD1 1860 C CD2 . PHE A 252 ? 0.864 1.546 0.733 0.267 -0.032 -0.111 258 PHE AAA CD2 1861 C CE1 . PHE A 252 ? 0.801 1.402 0.641 0.207 -0.025 -0.077 258 PHE AAA CE1 1862 C CE2 . PHE A 252 ? 0.807 1.520 0.692 0.235 -0.021 -0.091 258 PHE AAA CE2 1863 C CZ . PHE A 252 ? 0.770 1.439 0.639 0.206 -0.019 -0.075 258 PHE AAA CZ 1864 N N . PRO A 253 ? 1.000 1.401 0.779 0.337 -0.098 -0.151 259 PRO AAA N 1865 C CA . PRO A 253 ? 1.062 1.418 0.828 0.365 -0.112 -0.172 259 PRO AAA CA 1866 C C . PRO A 253 ? 1.123 1.514 0.887 0.375 -0.100 -0.194 259 PRO AAA C 1867 O O . PRO A 253 ? 1.120 1.533 0.878 0.350 -0.084 -0.186 259 PRO AAA O 1868 C CB . PRO A 253 ? 1.050 1.323 0.791 0.345 -0.123 -0.158 259 PRO AAA CB 1869 C CG . PRO A 253 ? 1.011 1.298 0.749 0.306 -0.107 -0.137 259 PRO AAA CG 1870 C CD . PRO A 253 ? 0.995 1.353 0.757 0.302 -0.096 -0.129 259 PRO AAA CD 1871 N N . LEU A 254 ? 1.178 1.573 0.945 0.412 -0.108 -0.222 260 LEU AAA N 1872 C CA . LEU A 254 ? 1.229 1.670 0.993 0.428 -0.096 -0.248 260 LEU AAA CA 1873 C C . LEU A 254 ? 1.234 1.635 0.972 0.407 -0.093 -0.251 260 LEU AAA C 1874 O O . LEU A 254 ? 1.240 1.687 0.972 0.408 -0.079 -0.263 260 LEU AAA O 1875 C CB . LEU A 254 ? 1.327 1.769 1.098 0.475 -0.109 -0.281 260 LEU AAA CB 1876 C CG . LEU A 254 ? 1.348 1.866 1.150 0.500 -0.105 -0.287 260 LEU AAA CG 1877 C CD1 . LEU A 254 ? 1.270 1.887 1.085 0.490 -0.078 -0.286 260 LEU AAA CD1 1878 C CD2 . LEU A 254 ? 1.369 1.877 1.186 0.490 -0.114 -0.260 260 LEU AAA CD2 1879 N N . SER A 255 ? 1.266 1.590 0.988 0.388 -0.106 -0.237 261 SER AAA N 1880 C CA . SER A 255 ? 1.265 1.552 0.966 0.364 -0.105 -0.236 261 SER AAA CA 1881 C C . SER A 255 ? 1.219 1.546 0.921 0.330 -0.085 -0.212 261 SER AAA C 1882 O O . SER A 255 ? 1.184 1.498 0.871 0.312 -0.081 -0.212 261 SER AAA O 1883 C CB . SER A 255 ? 1.301 1.499 0.989 0.353 -0.124 -0.228 261 SER AAA CB 1884 O OG . SER A 255 ? 1.301 1.486 0.995 0.335 -0.125 -0.198 261 SER AAA OG 1885 N N . MET A 256 ? 1.221 1.593 0.942 0.321 -0.075 -0.192 262 MET AAA N 1886 C CA . MET A 256 ? 1.167 1.570 0.891 0.289 -0.058 -0.167 262 MET AAA CA 1887 C C . MET A 256 ? 1.047 1.503 0.766 0.288 -0.042 -0.175 262 MET AAA C 1888 O O . MET A 256 ? 0.976 1.484 0.702 0.310 -0.036 -0.192 262 MET AAA O 1889 C CB . MET A 256 ? 1.175 1.618 0.923 0.283 -0.052 -0.151 262 MET AAA CB 1890 C CG . MET A 256 ? 1.158 1.633 0.912 0.252 -0.036 -0.127 262 MET AAA CG 1891 S SD . MET A 256 ? 1.260 1.697 1.017 0.224 -0.041 -0.101 262 MET AAA SD 1892 C CE . MET A 256 ? 1.295 1.650 1.026 0.220 -0.054 -0.103 262 MET AAA CE 1893 N N . PRO A 257 ? 0.978 1.425 0.684 0.263 -0.036 -0.163 263 PRO AAA N 1894 C CA . PRO A 257 ? 0.947 1.449 0.649 0.257 -0.020 -0.161 263 PRO AAA CA 1895 C C . PRO A 257 ? 0.895 1.466 0.617 0.251 -0.003 -0.145 263 PRO AAA C 1896 O O . PRO A 257 ? 0.853 1.418 0.590 0.234 -0.002 -0.125 263 PRO AAA O 1897 C CB . PRO A 257 ? 0.934 1.404 0.623 0.229 -0.019 -0.143 263 PRO AAA CB 1898 C CG . PRO A 257 ? 0.986 1.383 0.667 0.228 -0.036 -0.149 263 PRO AAA CG 1899 C CD . PRO A 257 ? 1.003 1.388 0.698 0.241 -0.044 -0.150 263 PRO AAA CD 1900 N N . LEU A 258 ? 0.891 1.526 0.613 0.264 0.009 -0.155 264 LEU AAA N 1901 C CA . LEU A 258 ? 0.842 1.552 0.585 0.260 0.026 -0.143 264 LEU AAA CA 1902 C C . LEU A 258 ? 0.798 1.513 0.547 0.224 0.036 -0.108 264 LEU AAA C 1903 O O . LEU A 258 ? 0.771 1.505 0.543 0.212 0.039 -0.092 264 LEU AAA O 1904 C CB . LEU A 258 ? 0.874 1.650 0.608 0.279 0.037 -0.160 264 LEU AAA CB 1905 C CG . LEU A 258 ? 0.905 1.766 0.664 0.283 0.053 -0.155 264 LEU AAA CG 1906 C CD1 . LEU A 258 ? 0.938 1.807 0.718 0.311 0.044 -0.176 264 LEU AAA CD1 1907 C CD2 . LEU A 258 ? 0.910 1.843 0.655 0.292 0.070 -0.162 264 LEU AAA CD2 1908 N N . GLY A 259 ? 0.804 1.501 0.532 0.210 0.038 -0.099 265 GLY AAA N 1909 C CA . GLY A 259 ? 0.788 1.479 0.520 0.179 0.045 -0.068 265 GLY AAA CA 1910 C C . GLY A 259 ? 0.760 1.410 0.509 0.163 0.037 -0.054 265 GLY AAA C 1911 O O . GLY A 259 ? 0.739 1.409 0.506 0.144 0.045 -0.033 265 GLY AAA O 1912 N N . ALA A 260 ? 0.760 1.353 0.503 0.171 0.023 -0.067 266 ALA AAA N 1913 C CA . ALA A 260 ? 0.759 1.312 0.514 0.158 0.014 -0.057 266 ALA AAA CA 1914 C C . ALA A 260 ? 0.739 1.324 0.517 0.163 0.015 -0.056 266 ALA AAA C 1915 O O . ALA A 260 ? 0.676 1.265 0.471 0.143 0.017 -0.039 266 ALA AAA O 1916 C CB . ALA A 260 ? 0.767 1.259 0.507 0.166 -0.000 -0.069 266 ALA AAA CB 1917 N N . ARG A 261 ? 0.765 1.373 0.548 0.189 0.011 -0.076 267 ARG AAA N 1918 C CA . ARG A 261 ? 0.784 1.435 0.593 0.198 0.011 -0.079 267 ARG AAA CA 1919 C C . ARG A 261 ? 0.751 1.458 0.581 0.176 0.026 -0.059 267 ARG AAA C 1920 O O . ARG A 261 ? 0.754 1.473 0.606 0.165 0.024 -0.050 267 ARG AAA O 1921 C CB . ARG A 261 ? 0.847 1.530 0.658 0.233 0.009 -0.104 267 ARG AAA CB 1922 C CG . ARG A 261 ? 0.910 1.649 0.750 0.245 0.010 -0.108 267 ARG AAA CG 1923 C CD . ARG A 261 ? 1.028 1.825 0.874 0.276 0.016 -0.131 267 ARG AAA CD 1924 N NE . ARG A 261 ? 1.140 1.892 0.968 0.307 0.002 -0.157 267 ARG AAA NE 1925 C CZ . ARG A 261 ? 1.149 1.889 0.987 0.336 -0.013 -0.173 267 ARG AAA CZ 1926 N NH1 . ARG A 261 ? 1.167 1.858 0.986 0.362 -0.027 -0.196 267 ARG AAA NH1 1927 N NH2 . ARG A 261 ? 1.104 1.879 0.969 0.338 -0.016 -0.167 267 ARG AAA NH2 1928 N N . ASP A 262 ? 0.726 1.465 0.549 0.168 0.040 -0.052 268 ASP AAA N 1929 C CA . ASP A 262 ? 0.679 1.471 0.519 0.145 0.055 -0.029 268 ASP AAA CA 1930 C C . ASP A 262 ? 0.660 1.413 0.508 0.115 0.052 -0.007 268 ASP AAA C 1931 O O . ASP A 262 ? 0.678 1.459 0.554 0.100 0.054 0.003 268 ASP AAA O 1932 C CB . ASP A 262 ? 0.652 1.477 0.476 0.143 0.069 -0.023 268 ASP AAA CB 1933 C CG . ASP A 262 ? 0.622 1.509 0.463 0.121 0.085 0.001 268 ASP AAA CG 1934 O OD1 . ASP A 262 ? 0.592 1.457 0.437 0.093 0.087 0.026 268 ASP AAA OD1 1935 O OD2 . ASP A 262 ? 0.617 1.575 0.471 0.132 0.096 -0.005 268 ASP AAA OD2 1936 N N . LEU A 263 ? 0.652 1.346 0.479 0.107 0.046 -0.002 269 LEU AAA N 1937 C CA . LEU A 263 ? 0.676 1.331 0.508 0.081 0.044 0.016 269 LEU AAA CA 1938 C C . LEU A 263 ? 0.686 1.324 0.535 0.078 0.033 0.012 269 LEU AAA C 1939 O O . LEU A 263 ? 0.643 1.287 0.511 0.056 0.034 0.026 269 LEU AAA O 1940 C CB . LEU A 263 ? 0.683 1.283 0.489 0.081 0.038 0.016 269 LEU AAA CB 1941 C CG . LEU A 263 ? 0.689 1.244 0.497 0.061 0.035 0.030 269 LEU AAA CG 1942 C CD1 . LEU A 263 ? 0.687 1.264 0.511 0.038 0.043 0.053 269 LEU AAA CD1 1943 C CD2 . LEU A 263 ? 0.694 1.206 0.480 0.063 0.030 0.028 269 LEU AAA CD2 1944 N N . ILE A 264 ? 0.717 1.335 0.558 0.099 0.022 -0.006 270 ILE AAA N 1945 C CA . ILE A 264 ? 0.683 1.284 0.535 0.099 0.010 -0.011 270 ILE AAA CA 1946 C C . ILE A 264 ? 0.716 1.376 0.598 0.097 0.012 -0.010 270 ILE AAA C 1947 O O . ILE A 264 ? 0.698 1.354 0.595 0.084 0.005 -0.006 270 ILE AAA O 1948 C CB . ILE A 264 ? 0.639 1.203 0.472 0.123 -0.003 -0.028 270 ILE AAA CB 1949 C CG1 . ILE A 264 ? 0.628 1.134 0.435 0.119 -0.006 -0.026 270 ILE AAA CG1 1950 C CG2 . ILE A 264 ? 0.637 1.195 0.479 0.129 -0.016 -0.032 270 ILE AAA CG2 1951 C CD1 . ILE A 264 ? 0.653 1.131 0.441 0.141 -0.014 -0.041 270 ILE AAA CD1 1952 N N . SER A 265 ? 0.741 1.458 0.633 0.110 0.021 -0.016 271 SER AAA N 1953 C CA . SER A 265 ? 0.780 1.567 0.705 0.109 0.026 -0.015 271 SER AAA CA 1954 C C . SER A 265 ? 0.790 1.596 0.735 0.073 0.034 0.007 271 SER AAA C 1955 O O . SER A 265 ? 0.844 1.686 0.819 0.062 0.031 0.010 271 SER AAA O 1956 C CB . SER A 265 ? 0.801 1.646 0.728 0.131 0.036 -0.026 271 SER AAA CB 1957 O OG . SER A 265 ? 0.843 1.670 0.758 0.165 0.025 -0.049 271 SER AAA OG 1958 N N . ARG A 266 ? 0.762 1.542 0.692 0.056 0.042 0.023 272 ARG AAA N 1959 C CA . ARG A 266 ? 0.780 1.573 0.727 0.023 0.050 0.046 272 ARG AAA CA 1960 C C . ARG A 266 ? 0.726 1.462 0.675 0.004 0.039 0.051 272 ARG AAA C 1961 O O . ARG A 266 ? 0.710 1.454 0.681 -0.024 0.041 0.067 272 ARG AAA O 1962 C CB . ARG A 266 ? 0.839 1.633 0.768 0.017 0.063 0.062 272 ARG AAA CB 1963 C CG . ARG A 266 ? 0.871 1.722 0.793 0.038 0.075 0.055 272 ARG AAA CG 1964 C CD . ARG A 266 ? 1.000 1.861 0.904 0.028 0.087 0.073 272 ARG AAA CD 1965 N NE . ARG A 266 ? 1.101 2.021 1.028 0.005 0.101 0.097 272 ARG AAA NE 1966 C CZ . ARG A 266 ? 1.214 2.214 1.156 0.011 0.113 0.094 272 ARG AAA CZ 1967 N NH1 . ARG A 266 ? 1.196 2.224 1.130 0.044 0.113 0.067 272 ARG AAA NH1 1968 N NH2 . ARG A 266 ? 1.348 2.399 1.311 -0.015 0.126 0.120 272 ARG AAA NH2 1969 N N . LEU A 267 ? 0.681 1.362 0.608 0.017 0.027 0.038 273 LEU AAA N 1970 C CA . LEU A 267 ? 0.637 1.264 0.561 0.004 0.016 0.039 273 LEU AAA CA 1971 C C . LEU A 267 ? 0.627 1.265 0.566 0.007 0.004 0.026 273 LEU AAA C 1972 O O . LEU A 267 ? 0.613 1.248 0.570 -0.014 -0.001 0.030 273 LEU AAA O 1973 C CB . LEU A 267 ? 0.611 1.181 0.503 0.016 0.013 0.033 273 LEU AAA CB 1974 C CG . LEU A 267 ? 0.583 1.134 0.461 0.009 0.021 0.046 273 LEU AAA CG 1975 C CD1 . LEU A 267 ? 0.584 1.092 0.433 0.024 0.017 0.037 273 LEU AAA CD1 1976 C CD2 . LEU A 267 ? 0.571 1.100 0.460 -0.016 0.022 0.060 273 LEU AAA CD2 1977 N N . LEU A 268 ? 0.634 1.282 0.565 0.033 -0.002 0.012 274 LEU AAA N 1978 C CA . LEU A 268 ? 0.620 1.282 0.563 0.042 -0.016 0.000 274 LEU AAA CA 1979 C C . LEU A 268 ? 0.625 1.360 0.605 0.036 -0.013 0.001 274 LEU AAA C 1980 O O . LEU A 268 ? 0.623 1.398 0.610 0.060 -0.013 -0.008 274 LEU AAA O 1981 C CB . LEU A 268 ? 0.601 1.246 0.523 0.073 -0.024 -0.013 274 LEU AAA CB 1982 C CG . LEU A 268 ? 0.601 1.179 0.489 0.078 -0.028 -0.014 274 LEU AAA CG 1983 C CD1 . LEU A 268 ? 0.608 1.168 0.479 0.106 -0.039 -0.025 274 LEU AAA CD1 1984 C CD2 . LEU A 268 ? 0.637 1.179 0.519 0.059 -0.035 -0.010 274 LEU AAA CD2 1985 N N . ARG A 269 ? 0.631 1.381 0.635 0.007 -0.011 0.012 275 ARG AAA N 1986 C CA . ARG A 269 ? 0.699 1.520 0.743 -0.006 -0.009 0.015 275 ARG AAA CA 1987 C C . ARG A 269 ? 0.739 1.552 0.799 -0.026 -0.024 0.011 275 ARG AAA C 1988 O O . ARG A 269 ? 0.726 1.483 0.773 -0.042 -0.028 0.014 275 ARG AAA O 1989 C CB . ARG A 269 ? 0.751 1.602 0.808 -0.027 0.009 0.034 275 ARG AAA CB 1990 C CG . ARG A 269 ? 0.796 1.667 0.835 -0.006 0.024 0.035 275 ARG AAA CG 1991 C CD . ARG A 269 ? 0.866 1.815 0.927 0.014 0.029 0.025 275 ARG AAA CD 1992 N NE . ARG A 269 ? 0.932 1.949 1.031 -0.012 0.038 0.039 275 ARG AAA NE 1993 C CZ . ARG A 269 ? 0.957 2.055 1.089 -0.005 0.041 0.033 275 ARG AAA CZ 1994 N NH1 . ARG A 269 ? 0.953 2.071 1.084 0.031 0.033 0.011 275 ARG AAA NH1 1995 N NH2 . ARG A 269 ? 0.993 2.152 1.160 -0.034 0.051 0.049 275 ARG AAA NH2 1996 N N . TYR A 270 ? 0.747 1.615 0.837 -0.022 -0.032 0.003 276 TYR AAA N 1997 C CA . TYR A 270 ? 0.749 1.620 0.857 -0.040 -0.049 -0.004 276 TYR AAA CA 1998 C C . TYR A 270 ? 0.763 1.616 0.886 -0.080 -0.046 0.008 276 TYR AAA C 1999 O O . TYR A 270 ? 0.768 1.568 0.878 -0.092 -0.057 0.003 276 TYR AAA O 2000 C CB . TYR A 270 ? 0.738 1.689 0.883 -0.033 -0.056 -0.011 276 TYR AAA CB 2001 C CG . TYR A 270 ? 0.743 1.700 0.905 -0.047 -0.076 -0.021 276 TYR AAA CG 2002 C CD1 . TYR A 270 ? 0.762 1.731 0.953 -0.086 -0.079 -0.016 276 TYR AAA CD1 2003 C CD2 . TYR A 270 ? 0.764 1.711 0.910 -0.022 -0.094 -0.035 276 TYR AAA CD2 2004 C CE1 . TYR A 270 ? 0.775 1.749 0.979 -0.099 -0.099 -0.028 276 TYR AAA CE1 2005 C CE2 . TYR A 270 ? 0.785 1.739 0.942 -0.033 -0.114 -0.045 276 TYR AAA CE2 2006 C CZ . TYR A 270 ? 0.798 1.767 0.985 -0.072 -0.117 -0.043 276 TYR AAA CZ 2007 O OH . TYR A 270 ? 0.857 1.834 1.054 -0.084 -0.138 -0.056 276 TYR AAA OH 2008 N N . GLN A 271 ? 0.787 1.683 0.937 -0.099 -0.031 0.024 277 GLN AAA N 2009 C CA . GLN A 271 ? 0.818 1.699 0.986 -0.139 -0.028 0.040 277 GLN AAA CA 2010 C C . GLN A 271 ? 0.802 1.604 0.935 -0.141 -0.023 0.048 277 GLN AAA C 2011 O O . GLN A 271 ? 0.747 1.542 0.859 -0.126 -0.010 0.057 277 GLN AAA O 2012 C CB . GLN A 271 ? 0.835 1.786 1.037 -0.158 -0.011 0.060 277 GLN AAA CB 2013 C CG . GLN A 271 ? 0.896 1.910 1.146 -0.182 -0.018 0.059 277 GLN AAA CG 2014 C CD . GLN A 271 ? 0.972 1.939 1.232 -0.213 -0.035 0.055 277 GLN AAA CD 2015 O OE1 . GLN A 271 ? 1.023 1.924 1.268 -0.230 -0.034 0.065 277 GLN AAA OE1 2016 N NE2 . GLN A 271 ? 0.943 1.942 1.229 -0.219 -0.052 0.039 277 GLN AAA NE2 2017 N N . PRO A 272 ? 0.802 1.546 0.930 -0.157 -0.035 0.043 278 PRO AAA N 2018 C CA . PRO A 272 ? 0.795 1.468 0.895 -0.159 -0.031 0.050 278 PRO AAA CA 2019 C C . PRO A 272 ? 0.791 1.467 0.900 -0.178 -0.016 0.077 278 PRO AAA C 2020 O O . PRO A 272 ? 0.812 1.454 0.894 -0.166 -0.007 0.085 278 PRO AAA O 2021 C CB . PRO A 272 ? 0.807 1.433 0.910 -0.177 -0.047 0.038 278 PRO AAA CB 2022 C CG . PRO A 272 ? 0.814 1.478 0.931 -0.173 -0.062 0.019 278 PRO AAA CG 2023 C CD . PRO A 272 ? 0.816 1.559 0.962 -0.173 -0.053 0.028 278 PRO AAA CD 2024 N N . LEU A 273 ? 0.809 1.526 0.955 -0.208 -0.013 0.092 279 LEU AAA N 2025 C CA . LEU A 273 ? 0.801 1.514 0.958 -0.234 -0.001 0.122 279 LEU AAA CA 2026 C C . LEU A 273 ? 0.756 1.516 0.901 -0.218 0.019 0.138 279 LEU AAA C 2027 O O . LEU A 273 ? 0.773 1.529 0.918 -0.235 0.030 0.165 279 LEU AAA O 2028 C CB . LEU A 273 ? 0.858 1.601 1.059 -0.274 -0.005 0.133 279 LEU AAA CB 2029 C CG . LEU A 273 ? 0.934 1.608 1.144 -0.301 -0.020 0.133 279 LEU AAA CG 2030 C CD1 . LEU A 273 ? 1.005 1.635 1.200 -0.285 -0.039 0.100 279 LEU AAA CD1 2031 C CD2 . LEU A 273 ? 0.946 1.653 1.204 -0.344 -0.024 0.147 279 LEU AAA CD2 2032 N N . GLU A 274 ? 0.724 1.525 0.859 -0.187 0.023 0.122 280 GLU AAA N 2033 C CA . GLU A 274 ? 0.746 1.590 0.865 -0.168 0.040 0.130 280 GLU AAA CA 2034 C C . GLU A 274 ? 0.752 1.557 0.830 -0.131 0.038 0.113 280 GLU AAA C 2035 O O . GLU A 274 ? 0.740 1.586 0.809 -0.105 0.046 0.105 280 GLU AAA O 2036 C CB . GLU A 274 ? 0.743 1.681 0.893 -0.166 0.048 0.128 280 GLU AAA CB 2037 C CG . GLU A 274 ? 0.734 1.694 0.887 -0.139 0.037 0.099 280 GLU AAA CG 2038 C CD . GLU A 274 ? 0.738 1.793 0.932 -0.141 0.041 0.096 280 GLU AAA CD 2039 O OE1 . GLU A 274 ? 0.732 1.825 0.961 -0.176 0.045 0.113 280 GLU AAA OE1 2040 O OE2 . GLU A 274 ? 0.742 1.831 0.933 -0.108 0.039 0.077 280 GLU AAA OE2 2041 N N . ARG A 275 ? 0.785 1.515 0.841 -0.129 0.029 0.108 281 ARG AAA N 2042 C CA . ARG A 275 ? 0.793 1.481 0.811 -0.099 0.027 0.094 281 ARG AAA CA 2043 C C . ARG A 275 ? 0.810 1.467 0.807 -0.101 0.036 0.112 281 ARG AAA C 2044 O O . ARG A 275 ? 0.819 1.441 0.822 -0.123 0.033 0.127 281 ARG AAA O 2045 C CB . ARG A 275 ? 0.796 1.429 0.804 -0.095 0.011 0.077 281 ARG AAA CB 2046 C CG . ARG A 275 ? 0.783 1.442 0.802 -0.085 -0.001 0.057 281 ARG AAA CG 2047 C CD . ARG A 275 ? 0.744 1.350 0.739 -0.072 -0.014 0.040 281 ARG AAA CD 2048 N NE . ARG A 275 ? 0.741 1.373 0.745 -0.063 -0.026 0.024 281 ARG AAA NE 2049 C CZ . ARG A 275 ? 0.760 1.379 0.771 -0.073 -0.040 0.013 281 ARG AAA CZ 2050 N NH1 . ARG A 275 ? 0.767 1.416 0.785 -0.062 -0.051 0.001 281 ARG AAA NH1 2051 N NH2 . ARG A 275 ? 0.755 1.330 0.764 -0.092 -0.044 0.014 281 ARG AAA NH2 2052 N N . LEU A 276 ? 0.802 1.471 0.775 -0.078 0.044 0.109 282 LEU AAA N 2053 C CA . LEU A 276 ? 0.806 1.458 0.757 -0.077 0.052 0.125 282 LEU AAA CA 2054 C C . LEU A 276 ? 0.810 1.393 0.753 -0.087 0.044 0.131 282 LEU AAA C 2055 O O . LEU A 276 ? 0.824 1.366 0.752 -0.073 0.035 0.113 282 LEU AAA O 2056 C CB . LEU A 276 ? 0.804 1.465 0.728 -0.047 0.056 0.111 282 LEU AAA CB 2057 C CG . LEU A 276 ? 0.812 1.482 0.715 -0.043 0.066 0.126 282 LEU AAA CG 2058 C CD1 . LEU A 276 ? 0.794 1.533 0.710 -0.053 0.080 0.142 282 LEU AAA CD1 2059 C CD2 . LEU A 276 ? 0.812 1.472 0.686 -0.014 0.064 0.106 282 LEU AAA CD2 2060 N N . PRO A 277 ? 0.802 1.371 0.757 -0.110 0.046 0.155 283 PRO AAA N 2061 C CA . PRO A 277 ? 0.773 1.275 0.721 -0.117 0.037 0.159 283 PRO AAA CA 2062 C C . PRO A 277 ? 0.735 1.206 0.653 -0.096 0.037 0.155 283 PRO AAA C 2063 O O . PRO A 277 ? 0.660 1.160 0.560 -0.081 0.045 0.156 283 PRO AAA O 2064 C CB . PRO A 277 ? 0.820 1.321 0.784 -0.144 0.041 0.190 283 PRO AAA CB 2065 C CG . PRO A 277 ? 0.829 1.396 0.817 -0.159 0.049 0.199 283 PRO AAA CG 2066 C CD . PRO A 277 ? 0.807 1.422 0.782 -0.133 0.056 0.180 283 PRO AAA CD 2067 N N . LEU A 278 ? 0.775 1.189 0.688 -0.095 0.028 0.150 284 LEU AAA N 2068 C CA . LEU A 278 ? 0.782 1.165 0.670 -0.076 0.026 0.144 284 LEU AAA CA 2069 C C . LEU A 278 ? 0.822 1.221 0.698 -0.074 0.034 0.167 284 LEU AAA C 2070 O O . LEU A 278 ? 0.836 1.250 0.691 -0.055 0.037 0.159 284 LEU AAA O 2071 C CB . LEU A 278 ? 0.795 1.122 0.687 -0.079 0.017 0.140 284 LEU AAA CB 2072 C CG . LEU A 278 ? 0.778 1.085 0.676 -0.078 0.008 0.115 284 LEU AAA CG 2073 C CD1 . LEU A 278 ? 0.770 1.025 0.672 -0.081 -0.000 0.110 284 LEU AAA CD1 2074 C CD2 . LEU A 278 ? 0.756 1.071 0.633 -0.058 0.009 0.094 284 LEU AAA CD2 2075 N N . ALA A 279 ? 0.838 1.234 0.726 -0.092 0.036 0.194 285 ALA AAA N 2076 C CA . ALA A 279 ? 0.863 1.275 0.738 -0.093 0.042 0.221 285 ALA AAA CA 2077 C C . ALA A 279 ? 0.843 1.314 0.702 -0.080 0.053 0.217 285 ALA AAA C 2078 O O . ALA A 279 ? 0.823 1.302 0.660 -0.068 0.056 0.224 285 ALA AAA O 2079 C CB . ALA A 279 ? 0.885 1.295 0.780 -0.119 0.044 0.252 285 ALA AAA CB 2080 N N . GLN A 280 ? 0.829 1.340 0.698 -0.081 0.058 0.203 286 GLN AAA N 2081 C CA . GLN A 280 ? 0.836 1.407 0.694 -0.068 0.068 0.196 286 GLN AAA CA 2082 C C . GLN A 280 ? 0.793 1.358 0.635 -0.042 0.064 0.164 286 GLN AAA C 2083 O O . GLN A 280 ? 0.757 1.360 0.584 -0.027 0.070 0.155 286 GLN AAA O 2084 C CB . GLN A 280 ? 0.881 1.505 0.763 -0.082 0.076 0.201 286 GLN AAA CB 2085 C CG . GLN A 280 ? 0.954 1.611 0.844 -0.105 0.087 0.236 286 GLN AAA CG 2086 C CD . GLN A 280 ? 1.008 1.655 0.932 -0.134 0.084 0.250 286 GLN AAA CD 2087 O OE1 . GLN A 280 ? 0.995 1.684 0.942 -0.143 0.087 0.244 286 GLN AAA OE1 2088 N NE2 . GLN A 280 ? 1.030 1.621 0.957 -0.149 0.075 0.268 286 GLN AAA NE2 2089 N N . ILE A 281 ? 0.806 1.325 0.650 -0.038 0.053 0.147 287 ILE AAA N 2090 C CA . ILE A 281 ? 0.775 1.279 0.602 -0.016 0.048 0.121 287 ILE AAA CA 2091 C C . ILE A 281 ? 0.778 1.269 0.581 -0.006 0.048 0.124 287 ILE AAA C 2092 O O . ILE A 281 ? 0.796 1.302 0.582 0.011 0.048 0.109 287 ILE AAA O 2093 C CB . ILE A 281 ? 0.723 1.184 0.555 -0.016 0.038 0.105 287 ILE AAA CB 2094 C CG1 . ILE A 281 ? 0.708 1.185 0.562 -0.025 0.036 0.100 287 ILE AAA CG1 2095 C CG2 . ILE A 281 ? 0.690 1.134 0.502 0.003 0.033 0.084 287 ILE AAA CG2 2096 C CD1 . ILE A 281 ? 0.700 1.136 0.560 -0.030 0.026 0.089 287 ILE AAA CD1 2097 N N . LEU A 282 ? 0.780 1.243 0.584 -0.015 0.045 0.142 288 LEU AAA N 2098 C CA . LEU A 282 ? 0.798 1.253 0.584 -0.007 0.044 0.150 288 LEU AAA CA 2099 C C . LEU A 282 ? 0.847 1.351 0.616 -0.002 0.052 0.158 288 LEU AAA C 2100 O O . LEU A 282 ? 0.866 1.376 0.614 0.012 0.050 0.147 288 LEU AAA O 2101 C CB . LEU A 282 ? 0.790 1.211 0.584 -0.019 0.040 0.172 288 LEU AAA CB 2102 C CG . LEU A 282 ? 0.757 1.131 0.565 -0.022 0.032 0.161 288 LEU AAA CG 2103 C CD1 . LEU A 282 ? 0.767 1.109 0.587 -0.033 0.027 0.182 288 LEU AAA CD1 2104 C CD2 . LEU A 282 ? 0.723 1.078 0.518 -0.006 0.026 0.141 288 LEU AAA CD2 2105 N N . LYS A 283 ? 0.849 1.389 0.628 -0.015 0.061 0.176 289 LYS AAA N 2106 C CA . LYS A 283 ? 0.793 1.388 0.558 -0.013 0.071 0.189 289 LYS AAA CA 2107 C C . LYS A 283 ? 0.737 1.376 0.496 0.003 0.077 0.164 289 LYS AAA C 2108 O O . LYS A 283 ? 0.748 1.436 0.491 0.008 0.086 0.168 289 LYS AAA O 2109 C CB . LYS A 283 ? 0.811 1.429 0.592 -0.036 0.080 0.222 289 LYS AAA CB 2110 C CG . LYS A 283 ? 0.860 1.438 0.643 -0.050 0.074 0.251 289 LYS AAA CG 2111 C CD . LYS A 283 ? 0.909 1.501 0.710 -0.076 0.080 0.285 289 LYS AAA CD 2112 C CE . LYS A 283 ? 0.976 1.529 0.774 -0.087 0.074 0.317 289 LYS AAA CE 2113 N NZ . LYS A 283 ? 1.003 1.581 0.810 -0.112 0.082 0.356 289 LYS AAA NZ 2114 N N . HIS A 284 ? 0.736 1.358 0.505 0.010 0.072 0.139 290 HIS AAA N 2115 C CA . HIS A 284 ? 0.743 1.403 0.511 0.027 0.076 0.116 290 HIS AAA CA 2116 C C . HIS A 284 ? 0.728 1.398 0.468 0.048 0.074 0.098 290 HIS AAA C 2117 O O . HIS A 284 ? 0.717 1.345 0.444 0.054 0.064 0.089 290 HIS AAA O 2118 C CB . HIS A 284 ? 0.734 1.369 0.517 0.032 0.068 0.095 290 HIS AAA CB 2119 C CG . HIS A 284 ? 0.720 1.398 0.506 0.049 0.071 0.074 290 HIS AAA CG 2120 N ND1 . HIS A 284 ? 0.713 1.384 0.480 0.073 0.066 0.048 290 HIS AAA ND1 2121 C CD2 . HIS A 284 ? 0.717 1.446 0.522 0.048 0.079 0.075 290 HIS AAA CD2 2122 C CE1 . HIS A 284 ? 0.709 1.422 0.483 0.088 0.070 0.033 290 HIS AAA CE1 2123 N NE2 . HIS A 284 ? 0.710 1.463 0.509 0.073 0.078 0.049 290 HIS AAA NE2 2124 N N . PRO A 285 ? 0.680 1.407 0.410 0.060 0.083 0.090 291 PRO AAA N 2125 C CA . PRO A 285 ? 0.658 1.398 0.360 0.080 0.081 0.071 291 PRO AAA CA 2126 C C . PRO A 285 ? 0.656 1.344 0.348 0.094 0.067 0.043 291 PRO AAA C 2127 O O . PRO A 285 ? 0.671 1.340 0.344 0.097 0.060 0.040 291 PRO AAA O 2128 C CB . PRO A 285 ? 0.664 1.470 0.365 0.094 0.092 0.058 291 PRO AAA CB 2129 C CG . PRO A 285 ? 0.667 1.490 0.401 0.083 0.098 0.066 291 PRO AAA CG 2130 C CD . PRO A 285 ? 0.677 1.463 0.424 0.055 0.096 0.096 291 PRO AAA CD 2131 N N . TRP A 286 ? 0.678 1.346 0.385 0.101 0.061 0.026 292 TRP AAA N 2132 C CA . TRP A 286 ? 0.684 1.305 0.385 0.114 0.048 0.001 292 TRP AAA CA 2133 C C . TRP A 286 ? 0.675 1.242 0.371 0.102 0.039 0.009 292 TRP AAA C 2134 O O . TRP A 286 ? 0.644 1.186 0.325 0.109 0.030 -0.006 292 TRP AAA O 2135 C CB . TRP A 286 ? 0.665 1.275 0.383 0.121 0.043 -0.012 292 TRP AAA CB 2136 C CG . TRP A 286 ? 0.664 1.223 0.373 0.133 0.029 -0.034 292 TRP AAA CG 2137 C CD1 . TRP A 286 ? 0.687 1.241 0.380 0.152 0.022 -0.059 292 TRP AAA CD1 2138 C CD2 . TRP A 286 ? 0.670 1.176 0.384 0.123 0.020 -0.030 292 TRP AAA CD2 2139 N NE1 . TRP A 286 ? 0.702 1.201 0.392 0.154 0.009 -0.069 292 TRP AAA NE1 2140 C CE2 . TRP A 286 ? 0.687 1.158 0.389 0.136 0.008 -0.051 292 TRP AAA CE2 2141 C CE3 . TRP A 286 ? 0.680 1.165 0.408 0.105 0.020 -0.013 292 TRP AAA CE3 2142 C CZ2 . TRP A 286 ? 0.693 1.112 0.394 0.130 -0.002 -0.052 292 TRP AAA CZ2 2143 C CZ3 . TRP A 286 ? 0.674 1.110 0.400 0.102 0.010 -0.016 292 TRP AAA CZ3 2144 C CH2 . TRP A 286 ? 0.693 1.099 0.406 0.113 0.000 -0.034 292 TRP AAA CH2 2145 N N . VAL A 287 ? 0.681 1.233 0.393 0.083 0.041 0.031 293 VAL AAA N 2146 C CA . VAL A 287 ? 0.703 1.211 0.414 0.072 0.034 0.041 293 VAL AAA CA 2147 C C . VAL A 287 ? 0.716 1.233 0.409 0.074 0.033 0.046 293 VAL AAA C 2148 O O . VAL A 287 ? 0.736 1.229 0.419 0.079 0.025 0.034 293 VAL AAA O 2149 C CB . VAL A 287 ? 0.746 1.243 0.477 0.054 0.038 0.063 293 VAL AAA CB 2150 C CG1 . VAL A 287 ? 0.772 1.236 0.502 0.046 0.033 0.075 293 VAL AAA CG1 2151 C CG2 . VAL A 287 ? 0.727 1.209 0.475 0.052 0.035 0.055 293 VAL AAA CG2 2152 N N . GLN A 288 ? 0.751 1.307 0.440 0.070 0.042 0.065 294 GLN AAA N 2153 C CA . GLN A 288 ? 0.718 1.294 0.388 0.072 0.042 0.075 294 GLN AAA CA 2154 C C . GLN A 288 ? 0.715 1.290 0.364 0.088 0.034 0.047 294 GLN AAA C 2155 O O . GLN A 288 ? 0.746 1.308 0.384 0.088 0.026 0.047 294 GLN AAA O 2156 C CB . GLN A 288 ? 0.764 1.391 0.430 0.068 0.054 0.095 294 GLN AAA CB 2157 C CG . GLN A 288 ? 0.838 1.470 0.498 0.057 0.056 0.127 294 GLN AAA CG 2158 C CD . GLN A 288 ? 0.849 1.437 0.531 0.041 0.052 0.147 294 GLN AAA CD 2159 O OE1 . GLN A 288 ? 0.824 1.397 0.527 0.033 0.054 0.145 294 GLN AAA OE1 2160 N NE2 . GLN A 288 ? 0.860 1.427 0.538 0.038 0.046 0.164 294 GLN AAA NE2 2161 N N . ALA A 289 ? 0.712 1.301 0.359 0.101 0.035 0.023 295 ALA AAA N 2162 C CA . ALA A 289 ? 0.747 1.342 0.373 0.118 0.028 -0.006 295 ALA AAA CA 2163 C C . ALA A 289 ? 0.763 1.304 0.390 0.118 0.013 -0.024 295 ALA AAA C 2164 O O . ALA A 289 ? 0.783 1.323 0.394 0.126 0.004 -0.044 295 ALA AAA O 2165 C CB . ALA A 289 ? 0.731 1.358 0.356 0.134 0.033 -0.026 295 ALA AAA CB 2166 N N . HIS A 290 ? 0.720 1.223 0.366 0.108 0.011 -0.017 296 HIS AAA N 2167 C CA . HIS A 290 ? 0.702 1.158 0.351 0.107 -0.000 -0.032 296 HIS AAA CA 2168 C C . HIS A 290 ? 0.685 1.109 0.345 0.091 -0.003 -0.016 296 HIS AAA C 2169 O O . HIS A 290 ? 0.683 1.075 0.343 0.088 -0.012 -0.026 296 HIS AAA O 2170 C CB . HIS A 290 ? 0.697 1.136 0.353 0.115 -0.002 -0.045 296 HIS AAA CB 2171 C CG . HIS A 290 ? 0.723 1.188 0.370 0.134 -0.002 -0.067 296 HIS AAA CG 2172 N ND1 . HIS A 290 ? 0.715 1.226 0.365 0.142 0.009 -0.064 296 HIS AAA ND1 2173 C CD2 . HIS A 290 ? 0.761 1.211 0.394 0.148 -0.012 -0.094 296 HIS AAA CD2 2174 C CE1 . HIS A 290 ? 0.773 1.301 0.412 0.162 0.007 -0.089 296 HIS AAA CE1 2175 N NE2 . HIS A 290 ? 0.776 1.263 0.404 0.167 -0.007 -0.109 296 HIS AAA NE2 2176 N N . SER A 291 ? 0.683 1.116 0.354 0.082 0.005 0.007 297 SER AAA N 2177 C CA . SER A 291 ? 0.695 1.102 0.377 0.070 0.003 0.020 297 SER AAA CA 2178 C C . SER A 291 ? 0.730 1.140 0.405 0.070 -0.004 0.020 297 SER AAA C 2179 O O . SER A 291 ? 0.733 1.172 0.394 0.075 -0.004 0.023 297 SER AAA O 2180 C CB . SER A 291 ? 0.683 1.097 0.379 0.062 0.010 0.043 297 SER AAA CB 2181 O OG . SER A 291 ? 0.655 1.043 0.363 0.055 0.008 0.052 297 SER AAA OG 2182 N N . ARG A 292 ? 0.719 1.103 0.401 0.064 -0.010 0.015 298 ARG AAA N 2183 C CA . ARG A 292 ? 0.756 1.144 0.437 0.062 -0.018 0.016 298 ARG AAA CA 2184 C C . ARG A 292 ? 0.719 1.092 0.417 0.056 -0.016 0.030 298 ARG AAA C 2185 O O . ARG A 292 ? 0.748 1.115 0.453 0.052 -0.021 0.025 298 ARG AAA O 2186 C CB . ARG A 292 ? 0.824 1.199 0.499 0.061 -0.027 -0.006 298 ARG AAA CB 2187 C CG . ARG A 292 ? 0.939 1.319 0.598 0.070 -0.031 -0.025 298 ARG AAA CG 2188 C CD . ARG A 292 ? 1.054 1.468 0.696 0.078 -0.034 -0.028 298 ARG AAA CD 2189 N NE . ARG A 292 ? 1.179 1.598 0.805 0.088 -0.039 -0.053 298 ARG AAA NE 2190 C CZ . ARG A 292 ? 1.262 1.672 0.880 0.087 -0.052 -0.074 298 ARG AAA CZ 2191 N NH1 . ARG A 292 ? 1.290 1.692 0.917 0.076 -0.060 -0.073 298 ARG AAA NH1 2192 N NH2 . ARG A 292 ? 1.230 1.641 0.834 0.099 -0.057 -0.099 298 ARG AAA NH2 2193 N N . ARG A 293 ? 0.693 1.064 0.400 0.054 -0.009 0.046 299 ARG AAA N 2194 C CA . ARG A 293 ? 0.728 1.082 0.452 0.050 -0.007 0.056 299 ARG AAA CA 2195 C C . ARG A 293 ? 0.757 1.124 0.485 0.054 -0.013 0.065 299 ARG AAA C 2196 O O . ARG A 293 ? 0.806 1.192 0.524 0.059 -0.014 0.077 299 ARG AAA O 2197 C CB . ARG A 293 ? 0.759 1.106 0.491 0.048 -0.001 0.070 299 ARG AAA CB 2198 C CG . ARG A 293 ? 0.784 1.114 0.533 0.046 -0.001 0.080 299 ARG AAA CG 2199 C CD . ARG A 293 ? 0.884 1.201 0.641 0.041 0.004 0.090 299 ARG AAA CD 2200 N NE . ARG A 293 ? 0.960 1.265 0.730 0.041 0.002 0.106 299 ARG AAA NE 2201 C CZ . ARG A 293 ? 1.043 1.324 0.826 0.043 -0.000 0.103 299 ARG AAA CZ 2202 N NH1 . ARG A 293 ? 0.949 1.221 0.735 0.043 0.001 0.085 299 ARG AAA NH1 2203 N NH2 . ARG A 293 ? 1.167 1.434 0.961 0.045 -0.003 0.119 299 ARG AAA NH2 2204 N N . VAL A 294 ? 0.720 1.077 0.462 0.053 -0.015 0.061 300 VAL AAA N 2205 C CA . VAL A 294 ? 0.721 1.091 0.472 0.059 -0.021 0.069 300 VAL AAA CA 2206 C C . VAL A 294 ? 0.632 0.986 0.402 0.060 -0.019 0.068 300 VAL AAA C 2207 O O . VAL A 294 ? 0.619 0.965 0.393 0.054 -0.016 0.054 300 VAL AAA O 2208 C CB . VAL A 294 ? 0.768 1.160 0.513 0.059 -0.029 0.058 300 VAL AAA CB 2209 C CG1 . VAL A 294 ? 0.809 1.191 0.555 0.050 -0.029 0.039 300 VAL AAA CG1 2210 C CG2 . VAL A 294 ? 0.794 1.204 0.551 0.066 -0.037 0.065 300 VAL AAA CG2 2211 N N . LEU A 295 ? 0.606 0.954 0.387 0.067 -0.020 0.082 301 LEU AAA N 2212 C CA . LEU A 295 ? 0.595 0.930 0.395 0.073 -0.019 0.079 301 LEU AAA CA 2213 C C . LEU A 295 ? 0.568 0.924 0.379 0.073 -0.021 0.066 301 LEU AAA C 2214 O O . LEU A 295 ? 0.550 0.930 0.359 0.075 -0.027 0.066 301 LEU AAA O 2215 C CB . LEU A 295 ? 0.619 0.948 0.429 0.084 -0.024 0.097 301 LEU AAA CB 2216 C CG . LEU A 295 ? 0.641 0.953 0.444 0.081 -0.023 0.116 301 LEU AAA CG 2217 C CD1 . LEU A 295 ? 0.669 0.960 0.486 0.091 -0.029 0.132 301 LEU AAA CD1 2218 C CD2 . LEU A 295 ? 0.649 0.942 0.448 0.069 -0.015 0.109 301 LEU AAA CD2 2219 N N . PRO A 296 ? 0.567 0.916 0.389 0.072 -0.015 0.054 302 PRO AAA N 2220 C CA . PRO A 296 ? 0.564 0.938 0.399 0.072 -0.015 0.044 302 PRO AAA CA 2221 C C . PRO A 296 ? 0.574 0.964 0.430 0.088 -0.021 0.049 302 PRO AAA C 2222 O O . PRO A 296 ? 0.614 0.985 0.474 0.100 -0.023 0.058 302 PRO AAA O 2223 C CB . PRO A 296 ? 0.567 0.930 0.404 0.065 -0.006 0.032 302 PRO AAA CB 2224 C CG . PRO A 296 ? 0.584 0.916 0.417 0.070 -0.003 0.036 302 PRO AAA CG 2225 C CD . PRO A 296 ? 0.559 0.882 0.380 0.069 -0.008 0.050 302 PRO AAA CD 2226 N N . PRO A 297 ? 0.547 0.972 0.416 0.090 -0.025 0.044 303 PRO AAA N 2227 C CA . PRO A 297 ? 0.568 1.013 0.458 0.109 -0.032 0.047 303 PRO AAA CA 2228 C C . PRO A 297 ? 0.614 1.046 0.521 0.123 -0.027 0.042 303 PRO AAA C 2229 O O . PRO A 297 ? 0.688 1.120 0.598 0.117 -0.016 0.029 303 PRO AAA O 2230 C CB . PRO A 297 ? 0.544 1.034 0.449 0.103 -0.034 0.037 303 PRO AAA CB 2231 C CG . PRO A 297 ? 0.534 1.022 0.420 0.081 -0.034 0.034 303 PRO AAA CG 2232 C CD . PRO A 297 ? 0.531 0.978 0.397 0.074 -0.025 0.034 303 PRO AAA CD 2233 N N . CYS A 298 ? 0.658 1.077 0.575 0.143 -0.034 0.053 304 CYS AAA N 2234 C CA . CYS A 298 ? 0.718 1.126 0.655 0.163 -0.034 0.046 304 CYS AAA CA 2235 C C . CYS A 298 ? 0.807 1.251 0.768 0.183 -0.043 0.047 304 CYS AAA C 2236 O O . CYS A 298 ? 0.868 1.342 0.828 0.180 -0.051 0.055 304 CYS AAA O 2237 C CB . CYS A 298 ? 0.739 1.097 0.671 0.170 -0.039 0.060 304 CYS AAA CB 2238 S SG . CYS A 298 ? 0.759 1.081 0.662 0.147 -0.032 0.066 304 CYS AAA SG 2239 N N . ALA A 299 ? 0.875 1.317 0.859 0.205 -0.043 0.037 305 ALA AAA N 2240 C CA . ALA A 299 ? 0.941 1.414 0.952 0.231 -0.053 0.037 305 ALA AAA CA 2241 C C . ALA A 299 ? 1.055 1.482 1.070 0.253 -0.065 0.052 305 ALA AAA C 2242 O O . ALA A 299 ? 1.018 1.394 1.017 0.245 -0.063 0.058 305 ALA AAA O 2243 C CB . ALA A 299 ? 0.926 1.436 0.962 0.241 -0.043 0.013 305 ALA AAA CB 2244 N N . GLN A 300 ? 1.206 1.652 1.242 0.279 -0.079 0.058 306 GLN AAA N 2245 C CA . GLN A 300 ? 1.296 1.702 1.345 0.308 -0.092 0.069 306 GLN AAA CA 2246 C C . GLN A 300 ? 1.341 1.787 1.414 0.335 -0.107 0.076 306 GLN AAA C 2247 O O . GLN A 300 ? 1.370 1.862 1.441 0.328 -0.113 0.084 306 GLN AAA O 2248 C CB . GLN A 300 ? 1.311 1.658 1.336 0.297 -0.099 0.097 306 GLN AAA CB 2249 C CG . GLN A 300 ? 1.289 1.576 1.305 0.289 -0.091 0.090 306 GLN AAA CG 2250 C CD . GLN A 300 ? 1.251 1.499 1.289 0.316 -0.099 0.081 306 GLN AAA CD 2251 O OE1 . GLN A 300 ? 1.175 1.405 1.218 0.317 -0.090 0.056 306 GLN AAA OE1 2252 N NE2 . GLN A 300 ? 1.291 1.521 1.340 0.340 -0.116 0.101 306 GLN AAA NE2 2253 N N . SER B 26 ? 1.673 1.431 1.505 0.471 0.099 -0.081 32 SER BBB N 2254 C CA . SER B 26 ? 1.550 1.425 1.442 0.454 0.098 -0.074 32 SER BBB CA 2255 C C . SER B 26 ? 1.601 1.551 1.564 0.490 0.128 -0.090 32 SER BBB C 2256 O O . SER B 26 ? 1.588 1.549 1.541 0.482 0.162 -0.113 32 SER BBB O 2257 C CB . SER B 26 ? 1.462 1.343 1.313 0.399 0.104 -0.079 32 SER BBB CB 2258 O OG . SER B 26 ? 1.446 1.318 1.272 0.366 0.073 -0.057 32 SER BBB OG 2259 N N . PRO B 27 ? 1.692 1.701 1.730 0.530 0.115 -0.078 33 PRO BBB N 2260 C CA . PRO B 27 ? 1.681 1.783 1.801 0.561 0.142 -0.090 33 PRO BBB CA 2261 C C . PRO B 27 ? 1.621 1.823 1.780 0.520 0.147 -0.088 33 PRO BBB C 2262 O O . PRO B 27 ? 1.606 1.807 1.734 0.492 0.177 -0.105 33 PRO BBB O 2263 C CB . PRO B 27 ? 1.651 1.782 1.838 0.613 0.116 -0.072 33 PRO BBB CB 2264 C CG . PRO B 27 ? 1.732 1.760 1.855 0.612 0.081 -0.053 33 PRO BBB CG 2265 C CD . PRO B 27 ? 1.753 1.742 1.801 0.549 0.074 -0.050 33 PRO BBB CD 2266 N N . ALA B 28 ? 1.580 1.861 1.800 0.516 0.118 -0.067 34 ALA BBB N 2267 C CA . ALA B 28 ? 1.493 1.861 1.748 0.475 0.117 -0.063 34 ALA BBB CA 2268 C C . ALA B 28 ? 1.543 1.944 1.819 0.462 0.070 -0.039 34 ALA BBB C 2269 O O . ALA B 28 ? 1.555 2.047 1.893 0.448 0.062 -0.033 34 ALA BBB O 2270 C CB . ALA B 28 ? 1.409 1.874 1.746 0.492 0.148 -0.075 34 ALA BBB CB 2271 N N . MET B 29 ? 1.606 1.933 1.826 0.461 0.041 -0.024 35 MET BBB N 2272 C CA . MET B 29 ? 1.597 1.941 1.816 0.446 -0.004 -0.001 35 MET BBB CA 2273 C C . MET B 29 ? 1.578 1.871 1.721 0.399 -0.011 0.001 35 MET BBB C 2274 O O . MET B 29 ? 1.791 2.131 1.943 0.365 -0.020 0.002 35 MET BBB O 2275 C CB . MET B 29 ? 1.713 2.023 1.934 0.486 -0.034 0.019 35 MET BBB CB 2276 C CG . MET B 29 ? 1.862 2.083 2.049 0.521 -0.016 0.012 35 MET BBB CG 2277 S SD . MET B 29 ? 1.964 2.060 2.039 0.491 -0.027 0.021 35 MET BBB SD 2278 C CE . MET B 29 ? 1.950 1.953 2.010 0.547 -0.029 0.025 35 MET BBB CE 2279 N N . ARG B 30 ? 1.434 1.634 1.507 0.395 -0.005 0.000 36 ARG BBB N 2280 C CA . ARG B 30 ? 1.280 1.435 1.286 0.352 -0.001 -0.004 36 ARG BBB CA 2281 C C . ARG B 30 ? 1.177 1.369 1.178 0.320 -0.027 0.009 36 ARG BBB C 2282 O O . ARG B 30 ? 1.200 1.398 1.181 0.286 -0.018 0.000 36 ARG BBB O 2283 C CB . ARG B 30 ? 1.158 1.320 1.159 0.335 0.033 -0.026 36 ARG BBB CB 2284 C CG . ARG B 30 ? 1.212 1.353 1.222 0.367 0.064 -0.043 36 ARG BBB CG 2285 C CD . ARG B 30 ? 1.205 1.334 1.186 0.345 0.097 -0.063 36 ARG BBB CD 2286 N NE . ARG B 30 ? 1.180 1.378 1.214 0.353 0.125 -0.076 36 ARG BBB NE 2287 C CZ . ARG B 30 ? 1.186 1.374 1.217 0.373 0.161 -0.096 36 ARG BBB CZ 2288 N NH1 . ARG B 30 ? 1.138 1.401 1.221 0.375 0.187 -0.104 36 ARG BBB NH1 2289 N NH2 . ARG B 30 ? 1.217 1.321 1.194 0.389 0.171 -0.108 36 ARG BBB NH2 2290 N N . ARG B 31 ? 1.077 1.288 1.093 0.332 -0.057 0.027 37 ARG BBB N 2291 C CA . ARG B 31 ? 1.035 1.276 1.038 0.305 -0.083 0.038 37 ARG BBB CA 2292 C C . ARG B 31 ? 1.029 1.202 0.958 0.284 -0.089 0.048 37 ARG BBB C 2293 O O . ARG B 31 ? 1.129 1.248 1.031 0.301 -0.099 0.063 37 ARG BBB O 2294 C CB . ARG B 31 ? 1.097 1.383 1.138 0.326 -0.115 0.054 37 ARG BBB CB 2295 C CG . ARG B 31 ? 1.111 1.467 1.178 0.302 -0.132 0.051 37 ARG BBB CG 2296 C CD . ARG B 31 ? 1.137 1.533 1.231 0.319 -0.170 0.070 37 ARG BBB CD 2297 N NE . ARG B 31 ? 1.194 1.632 1.361 0.357 -0.170 0.072 37 ARG BBB NE 2298 C CZ . ARG B 31 ? 1.239 1.654 1.416 0.398 -0.183 0.089 37 ARG BBB CZ 2299 N NH1 . ARG B 31 ? 1.334 1.675 1.447 0.403 -0.198 0.108 37 ARG BBB NH1 2300 N NH2 . ARG B 31 ? 1.171 1.637 1.425 0.434 -0.180 0.088 37 ARG BBB NH2 2301 N N . LEU B 32 ? 0.943 1.120 0.844 0.249 -0.083 0.040 38 LEU BBB N 2302 C CA . LEU B 32 ? 0.941 1.066 0.780 0.226 -0.083 0.048 38 LEU BBB CA 2303 C C . LEU B 32 ? 0.950 1.094 0.765 0.211 -0.106 0.062 38 LEU BBB C 2304 O O . LEU B 32 ? 0.978 1.177 0.822 0.211 -0.119 0.059 38 LEU BBB O 2305 C CB . LEU B 32 ? 0.945 1.067 0.771 0.200 -0.061 0.031 38 LEU BBB CB 2306 C CG . LEU B 32 ? 0.959 1.024 0.761 0.201 -0.041 0.024 38 LEU BBB CG 2307 C CD1 . LEU B 32 ? 1.017 1.077 0.851 0.234 -0.030 0.016 38 LEU BBB CD1 2308 C CD2 . LEU B 32 ? 0.883 0.956 0.676 0.175 -0.025 0.009 38 LEU BBB CD2 2309 N N . THR B 33 ? 0.983 1.083 0.745 0.197 -0.111 0.077 39 THR BBB N 2310 C CA . THR B 33 ? 0.978 1.089 0.703 0.178 -0.126 0.091 39 THR BBB CA 2311 C C . THR B 33 ? 0.987 1.073 0.671 0.148 -0.110 0.090 39 THR BBB C 2312 O O . THR B 33 ? 1.026 1.081 0.709 0.143 -0.093 0.082 39 THR BBB O 2313 C CB . THR B 33 ? 1.040 1.126 0.741 0.192 -0.152 0.118 39 THR BBB CB 2314 O OG1 . THR B 33 ? 1.107 1.127 0.759 0.181 -0.147 0.135 39 THR BBB OG1 2315 C CG2 . THR B 33 ? 1.029 1.122 0.776 0.230 -0.165 0.122 39 THR BBB CG2 2316 N N . VAL B 34 ? 0.950 1.051 0.599 0.127 -0.115 0.098 40 VAL BBB N 2317 C CA . VAL B 34 ? 0.928 1.020 0.544 0.097 -0.099 0.100 40 VAL BBB CA 2318 C C . VAL B 34 ? 0.980 1.006 0.562 0.090 -0.099 0.120 40 VAL BBB C 2319 O O . VAL B 34 ? 1.028 1.041 0.597 0.066 -0.085 0.119 40 VAL BBB O 2320 C CB . VAL B 34 ? 0.943 1.071 0.530 0.081 -0.102 0.103 40 VAL BBB CB 2321 C CG1 . VAL B 34 ? 1.055 1.162 0.599 0.081 -0.121 0.131 40 VAL BBB CG1 2322 C CG2 . VAL B 34 ? 0.919 1.059 0.490 0.054 -0.082 0.099 40 VAL BBB CG2 2323 N N . ASP B 35 ? 1.011 0.997 0.583 0.109 -0.117 0.139 41 ASP BBB N 2324 C CA . ASP B 35 ? 1.122 1.031 0.657 0.104 -0.120 0.160 41 ASP BBB CA 2325 C C . ASP B 35 ? 1.132 1.003 0.683 0.109 -0.105 0.143 41 ASP BBB C 2326 O O . ASP B 35 ? 1.180 0.983 0.697 0.096 -0.104 0.154 41 ASP BBB O 2327 C CB . ASP B 35 ? 1.226 1.099 0.747 0.130 -0.145 0.185 41 ASP BBB CB 2328 C CG . ASP B 35 ? 1.319 1.216 0.806 0.119 -0.162 0.207 41 ASP BBB CG 2329 O OD1 . ASP B 35 ? 1.292 1.239 0.768 0.094 -0.152 0.199 41 ASP BBB OD1 2330 O OD2 . ASP B 35 ? 1.442 1.307 0.911 0.137 -0.186 0.232 41 ASP BBB OD2 2331 N N . ASP B 36 ? 1.084 0.993 0.680 0.125 -0.094 0.117 42 ASP BBB N 2332 C CA . ASP B 36 ? 1.061 0.940 0.670 0.130 -0.078 0.097 42 ASP BBB CA 2333 C C . ASP B 36 ? 1.012 0.905 0.612 0.097 -0.063 0.085 42 ASP BBB C 2334 O O . ASP B 36 ? 1.000 0.863 0.597 0.095 -0.052 0.071 42 ASP BBB O 2335 C CB . ASP B 36 ? 1.042 0.959 0.702 0.161 -0.072 0.078 42 ASP BBB CB 2336 C CG . ASP B 36 ? 1.106 1.006 0.784 0.200 -0.086 0.088 42 ASP BBB CG 2337 O OD1 . ASP B 36 ? 1.181 1.011 0.836 0.212 -0.087 0.095 42 ASP BBB OD1 2338 O OD2 . ASP B 36 ? 1.075 1.032 0.792 0.216 -0.096 0.088 42 ASP BBB OD2 2339 N N . PHE B 37 ? 1.010 0.948 0.604 0.073 -0.063 0.090 43 PHE BBB N 2340 C CA . PHE B 37 ? 0.977 0.942 0.572 0.045 -0.051 0.080 43 PHE BBB CA 2341 C C . PHE B 37 ? 1.007 0.958 0.567 0.011 -0.052 0.099 43 PHE BBB C 2342 O O . PHE B 37 ? 1.099 1.044 0.635 0.008 -0.061 0.119 43 PHE BBB O 2343 C CB . PHE B 37 ? 0.908 0.944 0.535 0.049 -0.047 0.066 43 PHE BBB CB 2344 C CG . PHE B 37 ? 0.856 0.910 0.520 0.073 -0.044 0.048 43 PHE BBB CG 2345 C CD1 . PHE B 37 ? 0.871 0.937 0.553 0.097 -0.054 0.049 43 PHE BBB CD1 2346 C CD2 . PHE B 37 ? 0.840 0.899 0.519 0.069 -0.034 0.032 43 PHE BBB CD2 2347 C CE1 . PHE B 37 ? 0.823 0.912 0.543 0.115 -0.050 0.034 43 PHE BBB CE1 2348 C CE2 . PHE B 37 ? 0.826 0.901 0.535 0.086 -0.029 0.018 43 PHE BBB CE2 2349 C CZ . PHE B 37 ? 0.814 0.906 0.546 0.108 -0.035 0.019 43 PHE BBB CZ 2350 N N . GLU B 38 ? 0.987 0.932 0.541 -0.016 -0.045 0.095 44 GLU BBB N 2351 C CA . GLU B 38 ? 1.021 0.983 0.559 -0.054 -0.042 0.109 44 GLU BBB CA 2352 C C . GLU B 38 ? 0.961 1.003 0.533 -0.058 -0.032 0.096 44 GLU BBB C 2353 O O . GLU B 38 ? 0.918 0.972 0.515 -0.050 -0.030 0.078 44 GLU BBB O 2354 C CB . GLU B 38 ? 1.091 0.999 0.605 -0.082 -0.044 0.113 44 GLU BBB CB 2355 C CG . GLU B 38 ? 1.231 1.046 0.707 -0.077 -0.054 0.124 44 GLU BBB CG 2356 C CD . GLU B 38 ? 1.354 1.105 0.802 -0.105 -0.057 0.122 44 GLU BBB CD 2357 O OE1 . GLU B 38 ? 1.446 1.191 0.874 -0.146 -0.059 0.139 44 GLU BBB OE1 2358 O OE2 . GLU B 38 ? 1.354 1.062 0.798 -0.087 -0.056 0.103 44 GLU BBB OE2 2359 N N . ILE B 39 ? 0.944 1.035 0.515 -0.070 -0.027 0.105 45 ILE BBB N 2360 C CA . ILE B 39 ? 0.856 1.023 0.460 -0.068 -0.016 0.090 45 ILE BBB CA 2361 C C . ILE B 39 ? 0.833 1.031 0.450 -0.100 -0.009 0.095 45 ILE BBB C 2362 O O . ILE B 39 ? 0.843 1.023 0.435 -0.131 -0.009 0.116 45 ILE BBB O 2363 C CB . ILE B 39 ? 0.851 1.058 0.447 -0.060 -0.011 0.093 45 ILE BBB CB 2364 C CG1 . ILE B 39 ? 0.925 1.101 0.506 -0.035 -0.023 0.094 45 ILE BBB CG1 2365 C CG2 . ILE B 39 ? 0.760 1.035 0.390 -0.050 0.001 0.072 45 ILE BBB CG2 2366 C CD1 . ILE B 39 ? 0.918 1.082 0.528 -0.008 -0.029 0.075 45 ILE BBB CD1 2367 N N . GLY B 40 ? 0.782 1.024 0.436 -0.094 -0.006 0.079 46 GLY BBB N 2368 C CA . GLY B 40 ? 0.794 1.070 0.471 -0.119 -0.005 0.081 46 GLY BBB CA 2369 C C . GLY B 40 ? 0.757 1.118 0.467 -0.120 0.009 0.079 46 GLY BBB C 2370 O O . GLY B 40 ? 0.799 1.190 0.507 -0.150 0.016 0.095 46 GLY BBB O 2371 N N . ARG B 41 ? 0.728 1.123 0.465 -0.089 0.013 0.060 47 ARG BBB N 2372 C CA . ARG B 41 ? 0.767 1.241 0.542 -0.081 0.027 0.052 47 ARG BBB CA 2373 C C . ARG B 41 ? 0.768 1.249 0.555 -0.043 0.029 0.029 47 ARG BBB C 2374 O O . ARG B 41 ? 0.754 1.192 0.538 -0.027 0.017 0.020 47 ARG BBB O 2375 C CB . ARG B 41 ? 0.794 1.309 0.609 -0.096 0.022 0.054 47 ARG BBB CB 2376 C CG . ARG B 41 ? 0.827 1.324 0.663 -0.076 0.007 0.042 47 ARG BBB CG 2377 C CD . ARG B 41 ? 0.913 1.470 0.797 -0.080 0.002 0.043 47 ARG BBB CD 2378 N NE . ARG B 41 ? 1.022 1.583 0.904 -0.120 -0.008 0.059 47 ARG BBB NE 2379 C CZ . ARG B 41 ? 1.040 1.655 0.963 -0.133 -0.018 0.065 47 ARG BBB CZ 2380 N NH1 . ARG B 41 ? 1.037 1.707 1.009 -0.105 -0.018 0.056 47 ARG BBB NH1 2381 N NH2 . ARG B 41 ? 1.091 1.703 1.008 -0.175 -0.030 0.080 47 ARG BBB NH2 2382 N N . PRO B 42 ? 0.813 1.346 0.612 -0.029 0.045 0.018 48 PRO BBB N 2383 C CA . PRO B 42 ? 0.814 1.351 0.626 0.005 0.046 -0.006 48 PRO BBB CA 2384 C C . PRO B 42 ? 0.791 1.335 0.646 0.021 0.037 -0.015 48 PRO BBB C 2385 O O . PRO B 42 ? 0.917 1.511 0.807 0.018 0.041 -0.012 48 PRO BBB O 2386 C CB . PRO B 42 ? 0.770 1.367 0.587 0.013 0.069 -0.015 48 PRO BBB CB 2387 C CG . PRO B 42 ? 0.788 1.399 0.576 -0.020 0.079 0.007 48 PRO BBB CG 2388 C CD . PRO B 42 ? 0.797 1.384 0.592 -0.047 0.065 0.028 48 PRO BBB CD 2389 N N . LEU B 43 ? 0.708 1.205 0.557 0.038 0.024 -0.025 49 LEU BBB N 2390 C CA . LEU B 43 ? 0.727 1.219 0.607 0.053 0.013 -0.031 49 LEU BBB CA 2391 C C . LEU B 43 ? 0.754 1.264 0.654 0.084 0.019 -0.052 49 LEU BBB C 2392 O O . LEU B 43 ? 0.829 1.342 0.758 0.099 0.010 -0.055 49 LEU BBB O 2393 C CB . LEU B 43 ? 0.724 1.155 0.586 0.051 -0.001 -0.029 49 LEU BBB CB 2394 C CG . LEU B 43 ? 0.680 1.087 0.529 0.026 -0.010 -0.013 49 LEU BBB CG 2395 C CD1 . LEU B 43 ? 0.702 1.053 0.529 0.029 -0.017 -0.015 49 LEU BBB CD1 2396 C CD2 . LEU B 43 ? 0.668 1.102 0.544 0.020 -0.019 -0.006 49 LEU BBB CD2 2397 N N . GLY B 44 ? 0.790 1.302 0.670 0.094 0.031 -0.066 50 GLY BBB N 2398 C CA . GLY B 44 ? 0.848 1.370 0.740 0.123 0.038 -0.091 50 GLY BBB CA 2399 C C . GLY B 44 ? 0.900 1.394 0.753 0.129 0.041 -0.107 50 GLY BBB C 2400 O O . GLY B 44 ? 0.839 1.311 0.661 0.111 0.035 -0.097 50 GLY BBB O 2401 N N . LYS B 45 ? 1.002 1.496 0.858 0.154 0.047 -0.133 51 LYS BBB N 2402 C CA . LYS B 45 ? 1.106 1.578 0.923 0.160 0.050 -0.154 51 LYS BBB CA 2403 C C . LYS B 45 ? 1.194 1.611 1.013 0.173 0.034 -0.170 51 LYS BBB C 2404 O O . LYS B 45 ? 1.183 1.595 1.029 0.195 0.034 -0.181 51 LYS BBB O 2405 C CB . LYS B 45 ? 1.171 1.687 0.980 0.175 0.075 -0.174 51 LYS BBB CB 2406 C CG . LYS B 45 ? 1.276 1.862 1.119 0.175 0.094 -0.162 51 LYS BBB CG 2407 C CD . LYS B 45 ? 1.365 1.988 1.178 0.149 0.110 -0.146 51 LYS BBB CD 2408 C CE . LYS B 45 ? 1.402 2.023 1.223 0.118 0.098 -0.112 51 LYS BBB CE 2409 N NZ . LYS B 45 ? 1.476 2.120 1.261 0.090 0.110 -0.095 51 LYS BBB NZ 2410 N N . GLY B 46 ? 1.356 1.734 1.149 0.159 0.019 -0.170 52 GLY BBB N 2411 C CA . GLY B 46 ? 1.381 1.710 1.170 0.165 0.004 -0.186 52 GLY BBB CA 2412 C C . GLY B 46 ? 1.371 1.690 1.124 0.173 0.008 -0.216 52 GLY BBB C 2413 O O . GLY B 46 ? 1.231 1.585 0.961 0.174 0.023 -0.221 52 GLY BBB O 2414 N N . LYS B 47 ? 1.431 1.701 1.175 0.175 -0.006 -0.235 53 LYS BBB N 2415 C CA . LYS B 47 ? 1.597 1.846 1.300 0.179 -0.007 -0.267 53 LYS BBB CA 2416 C C . LYS B 47 ? 1.558 1.826 1.225 0.158 -0.013 -0.259 53 LYS BBB C 2417 O O . LYS B 47 ? 1.393 1.678 1.019 0.161 -0.002 -0.276 53 LYS BBB O 2418 C CB . LYS B 47 ? 1.751 1.937 1.452 0.177 -0.026 -0.284 53 LYS BBB CB 2419 C CG . LYS B 47 ? 1.834 1.987 1.566 0.198 -0.025 -0.288 53 LYS BBB CG 2420 C CD . LYS B 47 ? 1.893 1.980 1.624 0.187 -0.047 -0.295 53 LYS BBB CD 2421 C CE . LYS B 47 ? 1.987 2.018 1.690 0.203 -0.048 -0.333 53 LYS BBB CE 2422 N NZ . LYS B 47 ? 2.014 2.023 1.741 0.237 -0.041 -0.339 53 LYS BBB NZ 2423 N N . PHE B 48 ? 1.610 1.878 1.291 0.138 -0.029 -0.235 54 PHE BBB N 2424 C CA . PHE B 48 ? 1.702 1.980 1.356 0.119 -0.044 -0.226 54 PHE BBB CA 2425 C C . PHE B 48 ? 1.633 1.950 1.280 0.114 -0.033 -0.200 54 PHE BBB C 2426 O O . PHE B 48 ? 1.567 1.896 1.173 0.106 -0.038 -0.197 54 PHE BBB O 2427 C CB . PHE B 48 ? 1.589 1.847 1.269 0.104 -0.066 -0.215 54 PHE BBB CB 2428 C CG . PHE B 48 ? 1.475 1.691 1.154 0.101 -0.079 -0.240 54 PHE BBB CG 2429 C CD1 . PHE B 48 ? 1.282 1.468 0.988 0.109 -0.074 -0.243 54 PHE BBB CD1 2430 C CD2 . PHE B 48 ? 1.471 1.674 1.118 0.088 -0.097 -0.259 54 PHE BBB CD2 2431 C CE1 . PHE B 48 ? 1.283 1.421 0.984 0.105 -0.087 -0.265 54 PHE BBB CE1 2432 C CE2 . PHE B 48 ? 1.428 1.586 1.072 0.082 -0.110 -0.283 54 PHE BBB CE2 2433 C CZ . PHE B 48 ? 1.358 1.481 1.028 0.090 -0.104 -0.285 54 PHE BBB CZ 2434 N N . GLY B 49 ? 1.506 1.837 1.185 0.118 -0.021 -0.180 55 GLY BBB N 2435 C CA . GLY B 49 ? 1.340 1.702 1.012 0.110 -0.010 -0.156 55 GLY BBB CA 2436 C C . GLY B 49 ? 1.128 1.501 0.838 0.111 -0.000 -0.139 55 GLY BBB C 2437 O O . GLY B 49 ? 1.040 1.394 0.781 0.118 -0.005 -0.143 55 GLY BBB O 2438 N N . ASN B 50 ? 1.019 1.418 0.721 0.101 0.010 -0.120 56 ASN BBB N 2439 C CA . ASN B 50 ? 0.980 1.397 0.711 0.097 0.020 -0.103 56 ASN BBB CA 2440 C C . ASN B 50 ? 0.822 1.210 0.571 0.088 0.006 -0.085 56 ASN BBB C 2441 O O . ASN B 50 ? 0.759 1.123 0.495 0.084 -0.007 -0.080 56 ASN BBB O 2442 C CB . ASN B 50 ? 1.021 1.471 0.732 0.082 0.034 -0.086 56 ASN BBB CB 2443 C CG . ASN B 50 ? 1.084 1.567 0.768 0.088 0.052 -0.103 56 ASN BBB CG 2444 O OD1 . ASN B 50 ? 1.255 1.743 0.897 0.077 0.055 -0.096 56 ASN BBB OD1 2445 N ND2 . ASN B 50 ? 1.094 1.597 0.803 0.108 0.064 -0.125 56 ASN BBB ND2 2446 N N . VAL B 51 ? 0.784 1.178 0.561 0.086 0.009 -0.076 57 VAL BBB N 2447 C CA . VAL B 51 ? 0.774 1.143 0.561 0.076 0.000 -0.060 57 VAL BBB CA 2448 C C . VAL B 51 ? 0.735 1.119 0.519 0.058 0.006 -0.041 57 VAL BBB C 2449 O O . VAL B 51 ? 0.732 1.152 0.534 0.057 0.015 -0.041 57 VAL BBB O 2450 C CB . VAL B 51 ? 0.776 1.130 0.590 0.084 -0.006 -0.066 57 VAL BBB CB 2451 C CG1 . VAL B 51 ? 0.851 1.180 0.666 0.072 -0.012 -0.051 57 VAL BBB CG1 2452 C CG2 . VAL B 51 ? 0.787 1.119 0.602 0.096 -0.012 -0.083 57 VAL BBB CG2 2453 N N . TYR B 52 ? 0.718 1.075 0.482 0.045 0.001 -0.025 58 TYR BBB N 2454 C CA . TYR B 52 ? 0.754 1.111 0.507 0.023 0.004 -0.006 58 TYR BBB CA 2455 C C . TYR B 52 ? 0.770 1.090 0.527 0.015 -0.005 0.000 58 TYR BBB C 2456 O O . TYR B 52 ? 0.865 1.149 0.616 0.025 -0.011 -0.003 58 TYR BBB O 2457 C CB . TYR B 52 ? 0.826 1.171 0.544 0.013 0.004 0.008 58 TYR BBB CB 2458 C CG . TYR B 52 ? 0.888 1.267 0.590 0.015 0.013 0.004 58 TYR BBB CG 2459 C CD1 . TYR B 52 ? 0.909 1.288 0.603 0.033 0.009 -0.012 58 TYR BBB CD1 2460 C CD2 . TYR B 52 ? 0.867 1.280 0.558 -0.003 0.027 0.015 58 TYR BBB CD2 2461 C CE1 . TYR B 52 ? 0.959 1.365 0.628 0.034 0.018 -0.019 58 TYR BBB CE1 2462 C CE2 . TYR B 52 ? 0.929 1.375 0.599 -0.001 0.039 0.010 58 TYR BBB CE2 2463 C CZ . TYR B 52 ? 0.993 1.433 0.648 0.018 0.035 -0.008 58 TYR BBB CZ 2464 O OH . TYR B 52 ? 1.045 1.512 0.670 0.020 0.047 -0.016 58 TYR BBB OH 2465 N N . LEU B 53 ? 0.682 1.013 0.447 -0.001 -0.005 0.008 59 LEU BBB N 2466 C CA . LEU B 53 ? 0.667 0.957 0.420 -0.016 -0.013 0.016 59 LEU BBB CA 2467 C C . LEU B 53 ? 0.691 0.938 0.409 -0.025 -0.014 0.028 59 LEU BBB C 2468 O O . LEU B 53 ? 0.683 0.947 0.390 -0.040 -0.009 0.039 59 LEU BBB O 2469 C CB . LEU B 53 ? 0.684 0.999 0.450 -0.038 -0.016 0.023 59 LEU BBB CB 2470 C CG . LEU B 53 ? 0.730 1.000 0.476 -0.056 -0.026 0.028 59 LEU BBB CG 2471 C CD1 . LEU B 53 ? 0.758 1.008 0.508 -0.040 -0.031 0.016 59 LEU BBB CD1 2472 C CD2 . LEU B 53 ? 0.755 1.056 0.513 -0.084 -0.032 0.038 59 LEU BBB CD2 2473 N N . ALA B 54 ? 0.709 0.907 0.413 -0.017 -0.018 0.025 60 ALA BBB N 2474 C CA . ALA B 54 ? 0.764 0.912 0.437 -0.019 -0.021 0.036 60 ALA BBB CA 2475 C C . ALA B 54 ? 0.822 0.917 0.482 -0.018 -0.023 0.031 60 ALA BBB C 2476 O O . ALA B 54 ? 0.888 0.990 0.562 -0.013 -0.022 0.019 60 ALA BBB O 2477 C CB . ALA B 54 ? 0.774 0.925 0.447 0.003 -0.022 0.036 60 ALA BBB CB 2478 N N . ARG B 55 ? 0.846 0.886 0.477 -0.021 -0.026 0.040 61 ARG BBB N 2479 C CA . ARG B 55 ? 0.846 0.826 0.458 -0.014 -0.025 0.031 61 ARG BBB CA 2480 C C . ARG B 55 ? 0.870 0.806 0.468 0.007 -0.027 0.037 61 ARG BBB C 2481 O O . ARG B 55 ? 0.905 0.833 0.489 0.001 -0.034 0.054 61 ARG BBB O 2482 C CB . ARG B 55 ? 0.912 0.859 0.496 -0.045 -0.029 0.033 61 ARG BBB CB 2483 C CG . ARG B 55 ? 0.983 0.895 0.538 -0.070 -0.036 0.051 61 ARG BBB CG 2484 C CD . ARG B 55 ? 1.037 0.911 0.564 -0.104 -0.042 0.050 61 ARG BBB CD 2485 N NE . ARG B 55 ? 1.137 0.965 0.632 -0.131 -0.049 0.068 61 ARG BBB NE 2486 C CZ . ARG B 55 ? 1.171 0.943 0.631 -0.163 -0.057 0.069 61 ARG BBB CZ 2487 N NH1 . ARG B 55 ? 1.171 0.929 0.621 -0.172 -0.061 0.052 61 ARG BBB NH1 2488 N NH2 . ARG B 55 ? 1.210 0.936 0.639 -0.189 -0.064 0.088 61 ARG BBB NH2 2489 N N . LEU B 56 ? 0.865 0.774 0.467 0.031 -0.022 0.025 62 LEU BBB N 2490 C CA . LEU B 56 ? 0.901 0.764 0.495 0.057 -0.023 0.029 62 LEU BBB CA 2491 C C . LEU B 56 ? 1.014 0.802 0.562 0.041 -0.030 0.039 62 LEU BBB C 2492 O O . LEU B 56 ? 1.105 0.862 0.628 0.017 -0.027 0.031 62 LEU BBB O 2493 C CB . LEU B 56 ? 0.871 0.729 0.482 0.084 -0.011 0.010 62 LEU BBB CB 2494 C CG . LEU B 56 ? 0.809 0.733 0.466 0.102 -0.007 0.003 62 LEU BBB CG 2495 C CD1 . LEU B 56 ? 0.830 0.759 0.499 0.111 0.010 -0.016 62 LEU BBB CD1 2496 C CD2 . LEU B 56 ? 0.826 0.764 0.507 0.129 -0.015 0.013 62 LEU BBB CD2 2497 N N . LYS B 57 ? 1.078 0.835 0.613 0.050 -0.040 0.057 63 LYS BBB N 2498 C CA . LYS B 57 ? 1.216 0.892 0.704 0.032 -0.048 0.072 63 LYS BBB CA 2499 C C . LYS B 57 ? 1.302 0.903 0.766 0.044 -0.041 0.053 63 LYS BBB C 2500 O O . LYS B 57 ? 1.353 0.900 0.778 0.013 -0.044 0.051 63 LYS BBB O 2501 C CB . LYS B 57 ? 1.317 0.967 0.794 0.048 -0.061 0.096 63 LYS BBB CB 2502 C CG . LYS B 57 ? 1.366 1.066 0.841 0.026 -0.069 0.118 63 LYS BBB CG 2503 C CD . LYS B 57 ? 1.485 1.159 0.944 0.042 -0.084 0.144 63 LYS BBB CD 2504 C CE . LYS B 57 ? 1.479 1.199 0.924 0.017 -0.089 0.166 63 LYS BBB CE 2505 N NZ . LYS B 57 ? 1.524 1.215 0.946 0.033 -0.107 0.193 63 LYS BBB NZ 2506 N N . GLU B 58 ? 1.340 0.942 0.828 0.086 -0.033 0.038 64 GLU BBB N 2507 C CA . GLU B 58 ? 1.432 0.959 0.898 0.109 -0.023 0.019 64 GLU BBB CA 2508 C C . GLU B 58 ? 1.366 0.891 0.815 0.089 -0.009 -0.006 64 GLU BBB C 2509 O O . GLU B 58 ? 1.441 0.887 0.840 0.071 -0.010 -0.014 64 GLU BBB O 2510 C CB . GLU B 58 ? 1.484 1.034 0.993 0.162 -0.014 0.011 64 GLU BBB CB 2511 C CG . GLU B 58 ? 1.579 1.079 1.085 0.193 -0.028 0.029 64 GLU BBB CG 2512 C CD . GLU B 58 ? 1.684 1.175 1.221 0.248 -0.017 0.014 64 GLU BBB CD 2513 O OE1 . GLU B 58 ? 1.688 1.194 1.236 0.258 0.006 -0.014 64 GLU BBB OE1 2514 O OE2 . GLU B 58 ? 1.834 1.304 1.384 0.280 -0.031 0.030 64 GLU BBB OE2 2515 N N . SER B 59 ? 1.224 0.827 0.708 0.089 0.001 -0.016 65 SER BBB N 2516 C CA . SER B 59 ? 1.164 0.771 0.633 0.076 0.014 -0.038 65 SER BBB CA 2517 C C . SER B 59 ? 1.134 0.763 0.587 0.029 0.002 -0.031 65 SER BBB C 2518 O O . SER B 59 ? 1.168 0.778 0.592 0.011 0.005 -0.046 65 SER BBB O 2519 C CB . SER B 59 ? 1.091 0.765 0.604 0.099 0.029 -0.048 65 SER BBB CB 2520 O OG . SER B 59 ? 1.018 0.767 0.561 0.081 0.022 -0.039 65 SER BBB OG 2521 N N . HIS B 60 ? 1.104 0.775 0.577 0.012 -0.011 -0.010 66 HIS BBB N 2522 C CA . HIS B 60 ? 1.056 0.768 0.530 -0.027 -0.021 -0.001 66 HIS BBB CA 2523 C C . HIS B 60 ? 0.950 0.728 0.454 -0.025 -0.015 -0.011 66 HIS BBB C 2524 O O . HIS B 60 ? 0.919 0.720 0.419 -0.054 -0.023 -0.009 66 HIS BBB O 2525 C CB . HIS B 60 ? 1.125 0.775 0.551 -0.064 -0.030 -0.003 66 HIS BBB CB 2526 C CG . HIS B 60 ? 1.168 0.768 0.568 -0.083 -0.041 0.015 66 HIS BBB CG 2527 N ND1 . HIS B 60 ? 1.274 0.794 0.623 -0.113 -0.050 0.013 66 HIS BBB ND1 2528 C CD2 . HIS B 60 ? 1.147 0.762 0.560 -0.081 -0.046 0.038 66 HIS BBB CD2 2529 C CE1 . HIS B 60 ? 1.306 0.792 0.640 -0.128 -0.059 0.034 66 HIS BBB CE1 2530 N NE2 . HIS B 60 ? 1.249 0.793 0.620 -0.109 -0.056 0.051 66 HIS BBB NE2 2531 N N . PHE B 61 ? 0.889 0.700 0.425 0.006 -0.004 -0.018 67 PHE BBB N 2532 C CA . PHE B 61 ? 0.866 0.732 0.428 0.009 0.002 -0.025 67 PHE BBB CA 2533 C C . PHE B 61 ? 0.805 0.736 0.403 0.003 -0.007 -0.013 67 PHE BBB C 2534 O O . PHE B 61 ? 0.876 0.831 0.499 0.021 -0.006 -0.008 67 PHE BBB O 2535 C CB . PHE B 61 ? 0.880 0.754 0.462 0.041 0.018 -0.037 67 PHE BBB CB 2536 C CG . PHE B 61 ? 0.852 0.771 0.454 0.040 0.024 -0.042 67 PHE BBB CG 2537 C CD1 . PHE B 61 ? 0.877 0.777 0.449 0.028 0.030 -0.052 67 PHE BBB CD1 2538 C CD2 . PHE B 61 ? 0.792 0.767 0.439 0.050 0.023 -0.037 67 PHE BBB CD2 2539 C CE1 . PHE B 61 ? 0.837 0.772 0.423 0.026 0.035 -0.054 67 PHE BBB CE1 2540 C CE2 . PHE B 61 ? 0.768 0.775 0.430 0.048 0.027 -0.041 67 PHE BBB CE2 2541 C CZ . PHE B 61 ? 0.802 0.788 0.435 0.036 0.033 -0.047 67 PHE BBB CZ 2542 N N . ILE B 62 ? 0.776 0.736 0.377 -0.019 -0.015 -0.010 68 ILE BBB N 2543 C CA . ILE B 62 ? 0.718 0.741 0.353 -0.023 -0.020 -0.002 68 ILE BBB CA 2544 C C . ILE B 62 ? 0.698 0.756 0.365 0.000 -0.014 -0.009 68 ILE BBB C 2545 O O . ILE B 62 ? 0.767 0.818 0.432 0.005 -0.009 -0.017 68 ILE BBB O 2546 C CB . ILE B 62 ? 0.713 0.758 0.348 -0.048 -0.031 0.002 68 ILE BBB CB 2547 C CG1 . ILE B 62 ? 0.739 0.769 0.356 -0.077 -0.039 0.012 68 ILE BBB CG1 2548 C CG2 . ILE B 62 ? 0.655 0.765 0.332 -0.040 -0.033 0.004 68 ILE BBB CG2 2549 C CD1 . ILE B 62 ? 0.793 0.765 0.366 -0.099 -0.045 0.007 68 ILE BBB CD1 2550 N N . VAL B 63 ? 0.677 0.769 0.368 0.011 -0.015 -0.005 69 VAL BBB N 2551 C CA . VAL B 63 ? 0.647 0.774 0.369 0.028 -0.012 -0.012 69 VAL BBB CA 2552 C C . VAL B 63 ? 0.636 0.806 0.376 0.026 -0.017 -0.010 69 VAL BBB C 2553 O O . VAL B 63 ? 0.617 0.797 0.349 0.012 -0.019 -0.001 69 VAL BBB O 2554 C CB . VAL B 63 ? 0.651 0.773 0.382 0.047 -0.009 -0.014 69 VAL BBB CB 2555 C CG1 . VAL B 63 ? 0.625 0.709 0.344 0.055 -0.001 -0.019 69 VAL BBB CG1 2556 C CG2 . VAL B 63 ? 0.674 0.797 0.397 0.048 -0.015 -0.004 69 VAL BBB CG2 2557 N N . ALA B 64 ? 0.661 0.856 0.424 0.037 -0.017 -0.018 70 ALA BBB N 2558 C CA . ALA B 64 ? 0.698 0.930 0.476 0.043 -0.018 -0.021 70 ALA BBB CA 2559 C C . ALA B 64 ? 0.627 0.864 0.407 0.054 -0.019 -0.025 70 ALA BBB C 2560 O O . ALA B 64 ? 0.620 0.852 0.413 0.063 -0.020 -0.033 70 ALA BBB O 2561 C CB . ALA B 64 ? 0.721 0.967 0.519 0.049 -0.021 -0.029 70 ALA BBB CB 2562 N N . LEU B 65 ? 0.622 0.868 0.388 0.052 -0.019 -0.019 71 LEU BBB N 2563 C CA . LEU B 65 ? 0.638 0.888 0.398 0.061 -0.024 -0.020 71 LEU BBB CA 2564 C C . LEU B 65 ? 0.587 0.867 0.352 0.066 -0.024 -0.033 71 LEU BBB C 2565 O O . LEU B 65 ? 0.565 0.867 0.322 0.061 -0.017 -0.032 71 LEU BBB O 2566 C CB . LEU B 65 ? 0.695 0.934 0.429 0.053 -0.026 -0.003 71 LEU BBB CB 2567 C CG . LEU B 65 ? 0.785 1.013 0.509 0.064 -0.036 0.003 71 LEU BBB CG 2568 C CD1 . LEU B 65 ? 0.785 1.005 0.535 0.078 -0.039 -0.005 71 LEU BBB CD1 2569 C CD2 . LEU B 65 ? 0.859 1.056 0.555 0.057 -0.039 0.023 71 LEU BBB CD2 2570 N N . LYS B 66 ? 0.570 0.852 0.346 0.075 -0.031 -0.045 72 LYS BBB N 2571 C CA . LYS B 66 ? 0.620 0.919 0.394 0.080 -0.032 -0.062 72 LYS BBB CA 2572 C C . LYS B 66 ? 0.624 0.930 0.379 0.081 -0.042 -0.061 72 LYS BBB C 2573 O O . LYS B 66 ? 0.597 0.896 0.363 0.083 -0.054 -0.059 72 LYS BBB O 2574 C CB . LYS B 66 ? 0.680 0.971 0.477 0.085 -0.036 -0.076 72 LYS BBB CB 2575 C CG . LYS B 66 ? 0.735 1.032 0.525 0.091 -0.036 -0.096 72 LYS BBB CG 2576 C CD . LYS B 66 ? 0.776 1.052 0.584 0.093 -0.042 -0.109 72 LYS BBB CD 2577 C CE . LYS B 66 ? 0.836 1.107 0.640 0.104 -0.039 -0.129 72 LYS BBB CE 2578 N NZ . LYS B 66 ? 0.848 1.087 0.664 0.103 -0.048 -0.140 72 LYS BBB NZ 2579 N N . VAL B 67 ? 0.653 0.975 0.380 0.079 -0.038 -0.063 73 VAL BBB N 2580 C CA . VAL B 67 ? 0.731 1.060 0.425 0.078 -0.049 -0.061 73 VAL BBB CA 2581 C C . VAL B 67 ? 0.710 1.046 0.396 0.082 -0.053 -0.087 73 VAL BBB C 2582 O O . VAL B 67 ? 0.721 1.069 0.394 0.085 -0.039 -0.101 73 VAL BBB O 2583 C CB . VAL B 67 ? 0.803 1.143 0.463 0.069 -0.039 -0.046 73 VAL BBB CB 2584 C CG1 . VAL B 67 ? 0.853 1.196 0.472 0.066 -0.051 -0.040 73 VAL BBB CG1 2585 C CG2 . VAL B 67 ? 0.815 1.140 0.482 0.061 -0.034 -0.023 73 VAL BBB CG2 2586 N N . LEU B 68 ? 0.728 1.058 0.422 0.082 -0.071 -0.093 74 LEU BBB N 2587 C CA . LEU B 68 ? 0.823 1.152 0.502 0.081 -0.082 -0.118 74 LEU BBB CA 2588 C C . LEU B 68 ? 0.901 1.240 0.533 0.076 -0.094 -0.117 74 LEU BBB C 2589 O O . LEU B 68 ? 0.947 1.292 0.578 0.074 -0.108 -0.094 74 LEU BBB O 2590 C CB . LEU B 68 ? 0.798 1.118 0.512 0.077 -0.098 -0.123 74 LEU BBB CB 2591 C CG . LEU B 68 ? 0.777 1.084 0.531 0.079 -0.087 -0.122 74 LEU BBB CG 2592 C CD1 . LEU B 68 ? 0.834 1.142 0.623 0.071 -0.101 -0.120 74 LEU BBB CD1 2593 C CD2 . LEU B 68 ? 0.777 1.068 0.527 0.084 -0.077 -0.143 74 LEU BBB CD2 2594 N N . PHE B 69 ? 0.921 1.262 0.515 0.076 -0.090 -0.140 75 PHE BBB N 2595 C CA . PHE B 69 ? 0.990 1.337 0.530 0.069 -0.106 -0.144 75 PHE BBB CA 2596 C C . PHE B 69 ? 0.960 1.300 0.511 0.062 -0.136 -0.156 75 PHE BBB C 2597 O O . PHE B 69 ? 0.926 1.249 0.491 0.061 -0.136 -0.181 75 PHE BBB O 2598 C CB . PHE B 69 ? 1.113 1.463 0.603 0.071 -0.088 -0.169 75 PHE BBB CB 2599 C CG . PHE B 69 ? 1.204 1.572 0.691 0.077 -0.055 -0.161 75 PHE BBB CG 2600 C CD1 . PHE B 69 ? 1.216 1.596 0.705 0.070 -0.051 -0.127 75 PHE BBB CD1 2601 C CD2 . PHE B 69 ? 1.291 1.665 0.775 0.089 -0.031 -0.187 75 PHE BBB CD2 2602 C CE1 . PHE B 69 ? 1.240 1.641 0.728 0.070 -0.022 -0.119 75 PHE BBB CE1 2603 C CE2 . PHE B 69 ? 1.290 1.692 0.779 0.093 -0.001 -0.179 75 PHE BBB CE2 2604 C CZ . PHE B 69 ? 1.257 1.674 0.748 0.081 0.002 -0.144 75 PHE BBB CZ 2605 N N . LYS B 70 ? 0.975 1.328 0.521 0.056 -0.162 -0.137 76 LYS BBB N 2606 C CA . LYS B 70 ? 0.992 1.351 0.558 0.046 -0.194 -0.144 76 LYS BBB CA 2607 C C . LYS B 70 ? 1.077 1.421 0.599 0.036 -0.202 -0.179 76 LYS BBB C 2608 O O . LYS B 70 ? 1.125 1.458 0.675 0.026 -0.215 -0.197 76 LYS BBB O 2609 C CB . LYS B 70 ? 1.005 1.386 0.565 0.045 -0.222 -0.116 76 LYS BBB CB 2610 C CG . LYS B 70 ? 0.974 1.366 0.592 0.057 -0.222 -0.087 76 LYS BBB CG 2611 C CD . LYS B 70 ? 1.012 1.424 0.633 0.061 -0.254 -0.061 76 LYS BBB CD 2612 C CE . LYS B 70 ? 0.947 1.375 0.641 0.074 -0.256 -0.043 76 LYS BBB CE 2613 N NZ . LYS B 70 ? 0.948 1.395 0.649 0.085 -0.287 -0.015 76 LYS BBB NZ 2614 N N . SER B 71 ? 1.090 1.430 0.544 0.036 -0.194 -0.190 77 SER BBB N 2615 C CA . SER B 71 ? 1.168 1.489 0.562 0.028 -0.198 -0.227 77 SER BBB CA 2616 C C . SER B 71 ? 1.144 1.433 0.558 0.034 -0.180 -0.260 77 SER BBB C 2617 O O . SER B 71 ? 1.145 1.408 0.530 0.025 -0.194 -0.292 77 SER BBB O 2618 C CB . SER B 71 ? 1.242 1.569 0.561 0.031 -0.182 -0.229 77 SER BBB CB 2619 O OG . SER B 71 ? 1.199 1.528 0.527 0.046 -0.141 -0.231 77 SER BBB OG 2620 N N . GLN B 72 ? 1.132 1.420 0.591 0.049 -0.153 -0.251 78 GLN BBB N 2621 C CA . GLN B 72 ? 1.134 1.390 0.613 0.060 -0.135 -0.277 78 GLN BBB CA 2622 C C . GLN B 72 ? 1.083 1.319 0.611 0.048 -0.155 -0.278 78 GLN BBB C 2623 O O . GLN B 72 ? 1.090 1.286 0.611 0.046 -0.157 -0.308 78 GLN BBB O 2624 C CB . GLN B 72 ? 1.124 1.392 0.632 0.079 -0.102 -0.264 78 GLN BBB CB 2625 C CG . GLN B 72 ? 1.236 1.520 0.699 0.091 -0.075 -0.274 78 GLN BBB CG 2626 C CD . GLN B 72 ? 1.387 1.644 0.807 0.100 -0.068 -0.318 78 GLN BBB CD 2627 O OE1 . GLN B 72 ? 1.475 1.743 0.835 0.101 -0.057 -0.333 78 GLN BBB OE1 2628 N NE2 . GLN B 72 ? 1.423 1.640 0.868 0.106 -0.073 -0.339 78 GLN BBB NE2 2629 N N . ILE B 73 ? 1.041 1.302 0.616 0.039 -0.168 -0.248 79 ILE BBB N 2630 C CA . ILE B 73 ? 1.091 1.344 0.719 0.025 -0.184 -0.245 79 ILE BBB CA 2631 C C . ILE B 73 ? 1.143 1.389 0.750 0.002 -0.217 -0.263 79 ILE BBB C 2632 O O . ILE B 73 ? 1.163 1.381 0.789 -0.014 -0.227 -0.278 79 ILE BBB O 2633 C CB . ILE B 73 ? 1.064 1.352 0.746 0.026 -0.184 -0.209 79 ILE BBB CB 2634 C CG1 . ILE B 73 ? 1.078 1.360 0.786 0.042 -0.155 -0.195 79 ILE BBB CG1 2635 C CG2 . ILE B 73 ? 1.034 1.334 0.763 0.007 -0.206 -0.204 79 ILE BBB CG2 2636 C CD1 . ILE B 73 ? 1.138 1.433 0.820 0.057 -0.137 -0.184 79 ILE BBB CD1 2637 N N . GLU B 74 ? 1.165 1.435 0.732 -0.003 -0.235 -0.261 80 GLU BBB N 2638 C CA . GLU B 74 ? 1.236 1.506 0.773 -0.026 -0.271 -0.278 80 GLU BBB CA 2639 C C . GLU B 74 ? 1.229 1.444 0.711 -0.031 -0.268 -0.321 80 GLU BBB C 2640 O O . GLU B 74 ? 1.244 1.435 0.732 -0.054 -0.290 -0.341 80 GLU BBB O 2641 C CB . GLU B 74 ? 1.338 1.642 0.833 -0.026 -0.288 -0.262 80 GLU BBB CB 2642 C CG . GLU B 74 ? 1.377 1.731 0.928 -0.025 -0.306 -0.224 80 GLU BBB CG 2643 C CD . GLU B 74 ? 1.446 1.827 0.958 -0.018 -0.321 -0.200 80 GLU BBB CD 2644 O OE1 . GLU B 74 ? 1.541 1.908 0.995 -0.008 -0.300 -0.201 80 GLU BBB OE1 2645 O OE2 . GLU B 74 ? 1.455 1.873 0.997 -0.024 -0.353 -0.179 80 GLU BBB OE2 2646 N N . LYS B 75 ? 1.210 1.407 0.642 -0.010 -0.239 -0.337 81 LYS BBB N 2647 C CA . LYS B 75 ? 1.270 1.414 0.646 -0.005 -0.229 -0.381 81 LYS BBB CA 2648 C C . LYS B 75 ? 1.240 1.334 0.654 -0.010 -0.230 -0.397 81 LYS BBB C 2649 O O . LYS B 75 ? 1.275 1.323 0.657 -0.027 -0.248 -0.430 81 LYS BBB O 2650 C CB . LYS B 75 ? 1.309 1.457 0.654 0.024 -0.189 -0.387 81 LYS BBB CB 2651 C CG . LYS B 75 ? 1.449 1.552 0.728 0.036 -0.175 -0.434 81 LYS BBB CG 2652 C CD . LYS B 75 ? 1.508 1.639 0.729 0.052 -0.147 -0.440 81 LYS BBB CD 2653 C CE . LYS B 75 ? 1.622 1.711 0.764 0.060 -0.136 -0.491 81 LYS BBB CE 2654 N NZ . LYS B 75 ? 1.659 1.712 0.824 0.090 -0.105 -0.517 81 LYS BBB NZ 2655 N N . GLU B 76 ? 1.204 1.305 0.681 0.002 -0.212 -0.374 82 GLU BBB N 2656 C CA . GLU B 76 ? 1.221 1.271 0.731 0.002 -0.207 -0.383 82 GLU BBB CA 2657 C C . GLU B 76 ? 1.206 1.255 0.759 -0.033 -0.236 -0.371 82 GLU BBB C 2658 O O . GLU B 76 ? 1.199 1.200 0.772 -0.040 -0.236 -0.378 82 GLU BBB O 2659 C CB . GLU B 76 ? 1.178 1.241 0.732 0.028 -0.176 -0.360 82 GLU BBB CB 2660 C CG . GLU B 76 ? 1.213 1.279 0.735 0.061 -0.147 -0.373 82 GLU BBB CG 2661 C CD . GLU B 76 ? 1.345 1.350 0.824 0.074 -0.141 -0.417 82 GLU BBB CD 2662 O OE1 . GLU B 76 ? 1.387 1.341 0.888 0.078 -0.142 -0.425 82 GLU BBB OE1 2663 O OE2 . GLU B 76 ? 1.448 1.453 0.868 0.081 -0.135 -0.443 82 GLU BBB OE2 2664 N N . GLY B 77 ? 1.192 1.295 0.760 -0.052 -0.259 -0.353 83 GLY BBB N 2665 C CA . GLY B 77 ? 1.190 1.311 0.806 -0.086 -0.286 -0.340 83 GLY BBB CA 2666 C C . GLY B 77 ? 1.125 1.260 0.811 -0.085 -0.270 -0.311 83 GLY BBB C 2667 O O . GLY B 77 ? 1.113 1.229 0.831 -0.112 -0.281 -0.311 83 GLY BBB O 2668 N N . LEU B 78 ? 1.071 1.236 0.778 -0.058 -0.244 -0.287 84 LEU BBB N 2669 C CA . LEU B 78 ? 1.011 1.186 0.773 -0.053 -0.225 -0.260 84 LEU BBB CA 2670 C C . LEU B 78 ? 0.948 1.192 0.757 -0.055 -0.229 -0.230 84 LEU BBB C 2671 O O . LEU B 78 ? 0.914 1.173 0.751 -0.039 -0.207 -0.208 84 LEU BBB O 2672 C CB . LEU B 78 ? 1.009 1.163 0.758 -0.022 -0.195 -0.258 84 LEU BBB CB 2673 C CG . LEU B 78 ? 1.089 1.178 0.800 -0.011 -0.187 -0.287 84 LEU BBB CG 2674 C CD1 . LEU B 78 ? 1.011 1.093 0.726 0.020 -0.159 -0.279 84 LEU BBB CD1 2675 C CD2 . LEU B 78 ? 1.157 1.193 0.877 -0.035 -0.201 -0.298 84 LEU BBB CD2 2676 N N . GLU B 79 ? 0.949 1.232 0.767 -0.072 -0.257 -0.229 85 GLU BBB N 2677 C CA . GLU B 79 ? 0.920 1.271 0.788 -0.069 -0.264 -0.200 85 GLU BBB CA 2678 C C . GLU B 79 ? 0.862 1.232 0.796 -0.082 -0.253 -0.185 85 GLU BBB C 2679 O O . GLU B 79 ? 0.805 1.202 0.771 -0.064 -0.232 -0.163 85 GLU BBB O 2680 C CB . GLU B 79 ? 1.027 1.417 0.890 -0.084 -0.301 -0.203 85 GLU BBB CB 2681 C CG . GLU B 79 ? 1.135 1.516 0.929 -0.071 -0.311 -0.212 85 GLU BBB CG 2682 C CD . GLU B 79 ? 1.254 1.580 0.980 -0.083 -0.319 -0.248 85 GLU BBB CD 2683 O OE1 . GLU B 79 ? 1.327 1.600 1.038 -0.078 -0.296 -0.265 85 GLU BBB OE1 2684 O OE2 . GLU B 79 ? 1.262 1.595 0.947 -0.096 -0.348 -0.261 85 GLU BBB OE2 2685 N N . HIS B 80 ? 0.884 1.236 0.833 -0.114 -0.264 -0.196 86 HIS BBB N 2686 C CA . HIS B 80 ? 0.855 1.223 0.862 -0.135 -0.254 -0.182 86 HIS BBB CA 2687 C C . HIS B 80 ? 0.822 1.152 0.823 -0.118 -0.219 -0.173 86 HIS BBB C 2688 O O . HIS B 80 ? 0.800 1.165 0.842 -0.111 -0.199 -0.151 86 HIS BBB O 2689 C CB . HIS B 80 ? 0.911 1.252 0.920 -0.178 -0.275 -0.198 86 HIS BBB CB 2690 C CG . HIS B 80 ? 0.926 1.319 0.958 -0.205 -0.311 -0.202 86 HIS BBB CG 2691 N ND1 . HIS B 80 ? 0.990 1.374 1.038 -0.251 -0.333 -0.212 86 HIS BBB ND1 2692 C CD2 . HIS B 80 ? 0.891 1.343 0.932 -0.194 -0.332 -0.196 86 HIS BBB CD2 2693 C CE1 . HIS B 80 ? 0.987 1.429 1.056 -0.268 -0.367 -0.213 86 HIS BBB CE1 2694 N NE2 . HIS B 80 ? 0.944 1.429 1.009 -0.232 -0.368 -0.203 86 HIS BBB NE2 2695 N N . GLN B 81 ? 0.844 1.105 0.795 -0.109 -0.213 -0.189 87 GLN BBB N 2696 C CA . GLN B 81 ? 0.856 1.076 0.796 -0.092 -0.185 -0.182 87 GLN BBB CA 2697 C C . GLN B 81 ? 0.803 1.063 0.759 -0.065 -0.165 -0.161 87 GLN BBB C 2698 O O . GLN B 81 ? 0.758 1.020 0.737 -0.065 -0.145 -0.144 87 GLN BBB O 2699 C CB . GLN B 81 ? 0.904 1.060 0.789 -0.076 -0.185 -0.205 87 GLN BBB CB 2700 C CG . GLN B 81 ? 1.001 1.093 0.867 -0.099 -0.200 -0.225 87 GLN BBB CG 2701 C CD . GLN B 81 ? 1.078 1.169 0.922 -0.119 -0.228 -0.249 87 GLN BBB CD 2702 O OE1 . GLN B 81 ? 1.104 1.250 0.953 -0.117 -0.239 -0.247 87 GLN BBB OE1 2703 N NE2 . GLN B 81 ? 1.136 1.160 0.953 -0.137 -0.241 -0.271 87 GLN BBB NE2 2704 N N . LEU B 82 ? 0.811 1.096 0.749 -0.044 -0.169 -0.162 88 LEU BBB N 2705 C CA . LEU B 82 ? 0.779 1.092 0.724 -0.019 -0.152 -0.144 88 LEU BBB CA 2706 C C . LEU B 82 ? 0.744 1.107 0.742 -0.025 -0.148 -0.125 88 LEU BBB C 2707 O O . LEU B 82 ? 0.705 1.071 0.716 -0.013 -0.126 -0.111 88 LEU BBB O 2708 C CB . LEU B 82 ? 0.784 1.110 0.695 -0.003 -0.163 -0.148 88 LEU BBB CB 2709 C CG . LEU B 82 ? 0.763 1.087 0.656 0.022 -0.144 -0.136 88 LEU BBB CG 2710 C CD1 . LEU B 82 ? 0.770 1.114 0.634 0.032 -0.156 -0.133 88 LEU BBB CD1 2711 C CD2 . LEU B 82 ? 0.754 1.094 0.681 0.029 -0.127 -0.115 88 LEU BBB CD2 2712 N N . ARG B 83 ? 0.782 1.186 0.813 -0.042 -0.169 -0.126 89 ARG BBB N 2713 C CA . ARG B 83 ? 0.788 1.251 0.881 -0.046 -0.166 -0.109 89 ARG BBB CA 2714 C C . ARG B 83 ? 0.765 1.215 0.879 -0.059 -0.139 -0.102 89 ARG BBB C 2715 O O . ARG B 83 ? 0.681 1.157 0.821 -0.045 -0.117 -0.088 89 ARG BBB O 2716 C CB . ARG B 83 ? 0.838 1.347 0.967 -0.071 -0.195 -0.113 89 ARG BBB CB 2717 C CG . ARG B 83 ? 0.843 1.430 1.044 -0.067 -0.193 -0.096 89 ARG BBB CG 2718 C CD . ARG B 83 ? 0.862 1.494 1.121 -0.103 -0.200 -0.094 89 ARG BBB CD 2719 N NE . ARG B 83 ? 0.953 1.555 1.188 -0.139 -0.227 -0.112 89 ARG BBB NE 2720 C CZ . ARG B 83 ? 0.965 1.601 1.211 -0.156 -0.264 -0.119 89 ARG BBB CZ 2721 N NH1 . ARG B 83 ? 0.921 1.625 1.204 -0.138 -0.282 -0.108 89 ARG BBB NH1 2722 N NH2 . ARG B 83 ? 0.992 1.587 1.208 -0.190 -0.287 -0.138 89 ARG BBB NH2 2723 N N . ARG B 84 ? 0.787 1.192 0.883 -0.084 -0.142 -0.111 90 ARG BBB N 2724 C CA . ARG B 84 ? 0.784 1.167 0.890 -0.102 -0.122 -0.103 90 ARG BBB CA 2725 C C . ARG B 84 ? 0.766 1.120 0.845 -0.078 -0.096 -0.094 90 ARG BBB C 2726 O O . ARG B 84 ? 0.725 1.095 0.824 -0.081 -0.073 -0.080 90 ARG BBB O 2727 C CB . ARG B 84 ? 0.820 1.147 0.902 -0.131 -0.137 -0.115 90 ARG BBB CB 2728 C CG . ARG B 84 ? 0.844 1.138 0.929 -0.155 -0.120 -0.103 90 ARG BBB CG 2729 C CD . ARG B 84 ? 0.846 1.204 0.986 -0.173 -0.103 -0.085 90 ARG BBB CD 2730 N NE . ARG B 84 ? 0.894 1.219 1.029 -0.200 -0.087 -0.072 90 ARG BBB NE 2731 C CZ . ARG B 84 ? 0.890 1.257 1.058 -0.215 -0.062 -0.054 90 ARG BBB CZ 2732 N NH1 . ARG B 84 ? 0.846 1.293 1.061 -0.200 -0.049 -0.050 90 ARG BBB NH1 2733 N NH2 . ARG B 84 ? 0.960 1.289 1.113 -0.242 -0.049 -0.041 90 ARG BBB NH2 2734 N N . GLU B 85 ? 0.764 1.081 0.799 -0.055 -0.099 -0.102 91 GLU BBB N 2735 C CA . GLU B 85 ? 0.732 1.025 0.742 -0.033 -0.080 -0.095 91 GLU BBB CA 2736 C C . GLU B 85 ? 0.733 1.068 0.766 -0.019 -0.063 -0.081 91 GLU BBB C 2737 O O . GLU B 85 ? 0.808 1.133 0.837 -0.017 -0.043 -0.072 91 GLU BBB O 2738 C CB . GLU B 85 ? 0.764 1.035 0.736 -0.011 -0.087 -0.106 91 GLU BBB CB 2739 C CG . GLU B 85 ? 0.735 0.986 0.684 0.008 -0.071 -0.098 91 GLU BBB CG 2740 C CD . GLU B 85 ? 0.768 0.974 0.701 0.002 -0.065 -0.096 91 GLU BBB CD 2741 O OE1 . GLU B 85 ? 0.812 0.989 0.743 -0.012 -0.076 -0.104 91 GLU BBB OE1 2742 O OE2 . GLU B 85 ? 0.720 0.916 0.641 0.012 -0.053 -0.086 91 GLU BBB OE2 2743 N N . ILE B 86 ? 0.729 1.106 0.783 -0.008 -0.073 -0.081 92 ILE BBB N 2744 C CA . ILE B 86 ? 0.716 1.129 0.793 0.012 -0.060 -0.070 92 ILE BBB CA 2745 C C . ILE B 86 ? 0.704 1.151 0.825 -0.001 -0.042 -0.063 92 ILE BBB C 2746 O O . ILE B 86 ? 0.689 1.134 0.808 0.010 -0.018 -0.057 92 ILE BBB O 2747 C CB . ILE B 86 ? 0.707 1.155 0.797 0.027 -0.080 -0.070 92 ILE BBB CB 2748 C CG1 . ILE B 86 ? 0.720 1.137 0.762 0.036 -0.095 -0.077 92 ILE BBB CG1 2749 C CG2 . ILE B 86 ? 0.693 1.169 0.809 0.051 -0.068 -0.059 92 ILE BBB CG2 2750 C CD1 . ILE B 86 ? 0.720 1.102 0.726 0.053 -0.079 -0.072 92 ILE BBB CD1 2751 N N . GLU B 87 ? 0.711 1.188 0.867 -0.026 -0.053 -0.065 93 GLU BBB N 2752 C CA . GLU B 87 ? 0.727 1.249 0.932 -0.045 -0.035 -0.057 93 GLU BBB CA 2753 C C . GLU B 87 ? 0.704 1.184 0.880 -0.057 -0.009 -0.051 93 GLU BBB C 2754 O O . GLU B 87 ? 0.683 1.191 0.878 -0.054 0.019 -0.044 93 GLU BBB O 2755 C CB . GLU B 87 ? 0.795 1.349 1.037 -0.078 -0.056 -0.060 93 GLU BBB CB 2756 C CG . GLU B 87 ? 0.830 1.441 1.129 -0.102 -0.038 -0.051 93 GLU BBB CG 2757 C CD . GLU B 87 ? 0.921 1.573 1.264 -0.137 -0.063 -0.053 93 GLU BBB CD 2758 O OE1 . GLU B 87 ? 0.957 1.567 1.269 -0.152 -0.092 -0.064 93 GLU BBB OE1 2759 O OE2 . GLU B 87 ? 0.963 1.690 1.372 -0.151 -0.053 -0.044 93 GLU BBB OE2 2760 N N . ILE B 88 ? 0.689 1.106 0.820 -0.069 -0.017 -0.054 94 ILE BBB N 2761 C CA . ILE B 88 ? 0.717 1.087 0.812 -0.080 0.001 -0.046 94 ILE BBB CA 2762 C C . ILE B 88 ? 0.718 1.078 0.787 -0.053 0.021 -0.042 94 ILE BBB C 2763 O O . ILE B 88 ? 0.742 1.105 0.806 -0.060 0.046 -0.034 94 ILE BBB O 2764 C CB . ILE B 88 ? 0.759 1.063 0.814 -0.089 -0.017 -0.051 94 ILE BBB CB 2765 C CG1 . ILE B 88 ? 0.811 1.108 0.883 -0.124 -0.033 -0.053 94 ILE BBB CG1 2766 C CG2 . ILE B 88 ? 0.765 1.019 0.778 -0.088 -0.004 -0.040 94 ILE BBB CG2 2767 C CD1 . ILE B 88 ? 0.883 1.208 0.984 -0.155 -0.014 -0.038 94 ILE BBB CD1 2768 N N . GLN B 89 ? 0.669 1.018 0.719 -0.027 0.010 -0.049 95 GLN BBB N 2769 C CA . GLN B 89 ? 0.671 0.998 0.688 -0.005 0.023 -0.047 95 GLN BBB CA 2770 C C . GLN B 89 ? 0.658 1.022 0.698 0.010 0.044 -0.045 95 GLN BBB C 2771 O O . GLN B 89 ? 0.657 0.997 0.667 0.022 0.059 -0.044 95 GLN BBB O 2772 C CB . GLN B 89 ? 0.685 0.992 0.678 0.014 0.005 -0.053 95 GLN BBB CB 2773 C CG . GLN B 89 ? 0.707 0.973 0.671 0.007 -0.008 -0.056 95 GLN BBB CG 2774 C CD . GLN B 89 ? 0.761 0.992 0.688 0.014 -0.001 -0.051 95 GLN BBB CD 2775 O OE1 . GLN B 89 ? 0.775 1.008 0.692 0.020 0.014 -0.046 95 GLN BBB OE1 2776 N NE2 . GLN B 89 ? 0.862 1.063 0.769 0.014 -0.012 -0.053 95 GLN BBB NE2 2777 N N . ALA B 90 ? 0.650 1.069 0.743 0.011 0.042 -0.046 96 ALA BBB N 2778 C CA . ALA B 90 ? 0.711 1.174 0.839 0.030 0.062 -0.045 96 ALA BBB CA 2779 C C . ALA B 90 ? 0.733 1.218 0.876 0.012 0.093 -0.041 96 ALA BBB C 2780 O O . ALA B 90 ? 0.688 1.199 0.846 0.031 0.118 -0.043 96 ALA BBB O 2781 C CB . ALA B 90 ? 0.728 1.247 0.910 0.039 0.043 -0.046 96 ALA BBB CB 2782 N N . HIS B 91 ? 0.815 1.290 0.952 -0.021 0.092 -0.036 97 HIS BBB N 2783 C CA . HIS B 91 ? 0.837 1.334 0.986 -0.047 0.120 -0.028 97 HIS BBB CA 2784 C C . HIS B 91 ? 0.824 1.256 0.905 -0.062 0.131 -0.021 97 HIS BBB C 2785 O O . HIS B 91 ? 0.876 1.318 0.946 -0.071 0.162 -0.016 97 HIS BBB O 2786 C CB . HIS B 91 ? 0.839 1.375 1.036 -0.080 0.108 -0.023 97 HIS BBB CB 2787 C CG . HIS B 91 ? 0.868 1.488 1.141 -0.072 0.106 -0.026 97 HIS BBB CG 2788 N ND1 . HIS B 91 ? 0.842 1.488 1.136 -0.033 0.099 -0.033 97 HIS BBB ND1 2789 C CD2 . HIS B 91 ? 0.897 1.584 1.233 -0.099 0.107 -0.021 97 HIS BBB CD2 2790 C CE1 . HIS B 91 ? 0.845 1.570 1.213 -0.032 0.095 -0.032 97 HIS BBB CE1 2791 N NE2 . HIS B 91 ? 0.869 1.625 1.266 -0.073 0.100 -0.025 97 HIS BBB NE2 2792 N N . LEU B 92 ? 0.767 1.140 0.805 -0.063 0.106 -0.021 98 LEU BBB N 2793 C CA . LEU B 92 ? 0.803 1.115 0.782 -0.077 0.108 -0.011 98 LEU BBB CA 2794 C C . LEU B 92 ? 0.785 1.057 0.718 -0.053 0.102 -0.016 98 LEU BBB C 2795 O O . LEU B 92 ? 0.751 1.025 0.693 -0.031 0.085 -0.025 98 LEU BBB O 2796 C CB . LEU B 92 ? 0.828 1.106 0.803 -0.099 0.082 -0.006 98 LEU BBB CB 2797 C CG . LEU B 92 ? 0.904 1.191 0.896 -0.137 0.090 0.006 98 LEU BBB CG 2798 C CD1 . LEU B 92 ? 0.910 1.276 0.965 -0.144 0.107 0.003 98 LEU BBB CD1 2799 C CD2 . LEU B 92 ? 0.957 1.201 0.945 -0.154 0.061 0.006 98 LEU BBB CD2 2800 N N . GLN B 93 ? 0.785 1.022 0.668 -0.060 0.114 -0.008 99 GLN BBB N 2801 C CA . GLN B 93 ? 0.783 0.980 0.618 -0.045 0.107 -0.010 99 GLN BBB CA 2802 C C . GLN B 93 ? 0.779 0.929 0.563 -0.064 0.101 0.004 99 GLN BBB C 2803 O O . GLN B 93 ? 0.793 0.943 0.568 -0.087 0.116 0.016 99 GLN BBB O 2804 C CB . GLN B 93 ? 0.860 1.068 0.681 -0.029 0.131 -0.020 99 GLN BBB CB 2805 C CG . GLN B 93 ? 0.910 1.148 0.770 -0.003 0.129 -0.032 99 GLN BBB CG 2806 C CD . GLN B 93 ? 0.908 1.203 0.829 -0.001 0.140 -0.035 99 GLN BBB CD 2807 O OE1 . GLN B 93 ? 0.870 1.193 0.802 -0.011 0.167 -0.033 99 GLN BBB OE1 2808 N NE2 . GLN B 93 ? 0.824 1.143 0.785 0.009 0.119 -0.038 99 GLN BBB NE2 2809 N N . HIS B 94 ? 0.766 0.882 0.521 -0.055 0.079 0.006 100 HIS BBB N 2810 C CA . HIS B 94 ? 0.826 0.899 0.534 -0.068 0.067 0.022 100 HIS BBB CA 2811 C C . HIS B 94 ? 0.812 0.866 0.497 -0.052 0.047 0.020 100 HIS BBB C 2812 O O . HIS B 94 ? 0.848 0.915 0.561 -0.035 0.034 0.010 100 HIS BBB O 2813 C CB . HIS B 94 ? 0.866 0.916 0.585 -0.081 0.050 0.034 100 HIS BBB CB 2814 C CG . HIS B 94 ? 0.935 0.940 0.606 -0.095 0.039 0.055 100 HIS BBB CG 2815 N ND1 . HIS B 94 ? 1.033 1.024 0.671 -0.121 0.056 0.071 100 HIS BBB ND1 2816 C CD2 . HIS B 94 ? 0.997 0.968 0.648 -0.086 0.012 0.064 100 HIS BBB CD2 2817 C CE1 . HIS B 94 ? 1.109 1.054 0.702 -0.128 0.038 0.090 100 HIS BBB CE1 2818 N NE2 . HIS B 94 ? 1.055 0.989 0.659 -0.105 0.010 0.086 100 HIS BBB NE2 2819 N N . PRO B 95 ? 0.861 0.889 0.495 -0.061 0.045 0.029 101 PRO BBB N 2820 C CA . PRO B 95 ? 0.855 0.873 0.471 -0.050 0.025 0.027 101 PRO BBB CA 2821 C C . PRO B 95 ? 0.804 0.818 0.443 -0.039 -0.005 0.034 101 PRO BBB C 2822 O O . PRO B 95 ? 0.806 0.828 0.448 -0.029 -0.019 0.030 101 PRO BBB O 2823 C CB . PRO B 95 ? 0.927 0.916 0.480 -0.067 0.026 0.038 101 PRO BBB CB 2824 C CG . PRO B 95 ? 0.982 0.971 0.516 -0.083 0.056 0.041 101 PRO BBB CG 2825 C CD . PRO B 95 ? 0.933 0.941 0.520 -0.083 0.061 0.042 101 PRO BBB CD 2826 N N . ASN B 96 ? 0.792 0.792 0.446 -0.042 -0.013 0.043 102 ASN BBB N 2827 C CA . ASN B 96 ? 0.813 0.802 0.488 -0.027 -0.039 0.047 102 ASN BBB CA 2828 C C . ASN B 96 ? 0.808 0.812 0.528 -0.017 -0.038 0.032 102 ASN BBB C 2829 O O . ASN B 96 ? 0.827 0.812 0.561 -0.006 -0.055 0.034 102 ASN BBB O 2830 C CB . ASN B 96 ? 0.857 0.804 0.505 -0.037 -0.055 0.069 102 ASN BBB CB 2831 C CG . ASN B 96 ? 0.916 0.848 0.512 -0.050 -0.060 0.085 102 ASN BBB CG 2832 O OD1 . ASN B 96 ? 1.012 0.918 0.569 -0.071 -0.052 0.100 102 ASN BBB OD1 2833 N ND2 . ASN B 96 ? 0.897 0.846 0.490 -0.040 -0.073 0.082 102 ASN BBB ND2 2834 N N . ILE B 97 ? 0.773 0.805 0.512 -0.019 -0.019 0.019 103 ILE BBB N 2835 C CA . ILE B 97 ? 0.726 0.779 0.505 -0.009 -0.020 0.003 103 ILE BBB CA 2836 C C . ILE B 97 ? 0.681 0.768 0.469 0.004 -0.013 -0.009 103 ILE BBB C 2837 O O . ILE B 97 ? 0.630 0.728 0.410 -0.002 0.004 -0.010 103 ILE BBB O 2838 C CB . ILE B 97 ? 0.742 0.801 0.538 -0.025 -0.009 0.001 103 ILE BBB CB 2839 C CG1 . ILE B 97 ? 0.826 0.843 0.610 -0.043 -0.017 0.015 103 ILE BBB CG1 2840 C CG2 . ILE B 97 ? 0.725 0.809 0.556 -0.015 -0.014 -0.016 103 ILE BBB CG2 2841 C CD1 . ILE B 97 ? 0.832 0.860 0.634 -0.068 -0.004 0.016 103 ILE BBB CD1 2842 N N . LEU B 98 ? 0.639 0.739 0.442 0.020 -0.024 -0.018 104 LEU BBB N 2843 C CA . LEU B 98 ? 0.581 0.707 0.389 0.030 -0.020 -0.026 104 LEU BBB CA 2844 C C . LEU B 98 ? 0.584 0.729 0.407 0.029 -0.008 -0.032 104 LEU BBB C 2845 O O . LEU B 98 ? 0.617 0.767 0.460 0.025 -0.009 -0.037 104 LEU BBB O 2846 C CB . LEU B 98 ? 0.568 0.708 0.390 0.045 -0.031 -0.034 104 LEU BBB CB 2847 C CG . LEU B 98 ? 0.572 0.735 0.391 0.051 -0.029 -0.035 104 LEU BBB CG 2848 C CD1 . LEU B 98 ? 0.596 0.753 0.398 0.046 -0.035 -0.025 104 LEU BBB CD1 2849 C CD2 . LEU B 98 ? 0.577 0.761 0.412 0.064 -0.034 -0.045 104 LEU BBB CD2 2850 N N . ARG B 99 ? 0.594 0.747 0.408 0.031 0.003 -0.033 105 ARG BBB N 2851 C CA . ARG B 99 ? 0.600 0.770 0.430 0.034 0.016 -0.037 105 ARG BBB CA 2852 C C . ARG B 99 ? 0.576 0.769 0.425 0.046 0.008 -0.043 105 ARG BBB C 2853 O O . ARG B 99 ? 0.583 0.772 0.419 0.052 0.001 -0.043 105 ARG BBB O 2854 C CB . ARG B 99 ? 0.645 0.803 0.451 0.034 0.031 -0.036 105 ARG BBB CB 2855 C CG . ARG B 99 ? 0.692 0.869 0.518 0.042 0.048 -0.041 105 ARG BBB CG 2856 C CD . ARG B 99 ? 0.790 0.968 0.611 0.030 0.067 -0.038 105 ARG BBB CD 2857 N NE . ARG B 99 ? 0.826 1.032 0.675 0.040 0.086 -0.044 105 ARG BBB NE 2858 C CZ . ARG B 99 ? 0.827 1.025 0.659 0.048 0.107 -0.049 105 ARG BBB CZ 2859 N NH1 . ARG B 99 ? 0.896 1.053 0.676 0.043 0.111 -0.051 105 ARG BBB NH1 2860 N NH2 . ARG B 99 ? 0.837 1.068 0.705 0.062 0.124 -0.055 105 ARG BBB NH2 2861 N N . LEU B 100 ? 0.583 0.799 0.460 0.049 0.009 -0.047 106 LEU BBB N 2862 C CA . LEU B 100 ? 0.588 0.825 0.480 0.062 0.004 -0.050 106 LEU BBB CA 2863 C C . LEU B 100 ? 0.580 0.822 0.477 0.071 0.018 -0.047 106 LEU BBB C 2864 O O . LEU B 100 ? 0.615 0.875 0.535 0.069 0.030 -0.048 106 LEU BBB O 2865 C CB . LEU B 100 ? 0.619 0.883 0.541 0.058 -0.008 -0.055 106 LEU BBB CB 2866 C CG . LEU B 100 ? 0.643 0.930 0.575 0.070 -0.020 -0.056 106 LEU BBB CG 2867 C CD1 . LEU B 100 ? 0.670 0.946 0.575 0.074 -0.031 -0.058 106 LEU BBB CD1 2868 C CD2 . LEU B 100 ? 0.655 0.974 0.621 0.063 -0.031 -0.060 106 LEU BBB CD2 2869 N N . TYR B 101 ? 0.596 0.818 0.471 0.082 0.019 -0.045 107 TYR BBB N 2870 C CA . TYR B 101 ? 0.644 0.858 0.518 0.096 0.032 -0.045 107 TYR BBB CA 2871 C C . TYR B 101 ? 0.638 0.886 0.551 0.112 0.026 -0.044 107 TYR BBB C 2872 O O . TYR B 101 ? 0.619 0.886 0.559 0.122 0.040 -0.046 107 TYR BBB O 2873 C CB . TYR B 101 ? 0.700 0.875 0.536 0.099 0.030 -0.042 107 TYR BBB CB 2874 C CG . TYR B 101 ? 0.708 0.854 0.508 0.082 0.032 -0.042 107 TYR BBB CG 2875 C CD1 . TYR B 101 ? 0.743 0.877 0.528 0.073 0.046 -0.046 107 TYR BBB CD1 2876 C CD2 . TYR B 101 ? 0.720 0.857 0.501 0.073 0.019 -0.037 107 TYR BBB CD2 2877 C CE1 . TYR B 101 ? 0.773 0.882 0.523 0.057 0.042 -0.044 107 TYR BBB CE1 2878 C CE2 . TYR B 101 ? 0.765 0.885 0.521 0.058 0.017 -0.036 107 TYR BBB CE2 2879 C CZ . TYR B 101 ? 0.779 0.883 0.518 0.050 0.026 -0.039 107 TYR BBB CZ 2880 O OH . TYR B 101 ? 0.734 0.823 0.446 0.035 0.020 -0.036 107 TYR BBB OH 2881 N N . ASN B 102 ? 0.691 0.949 0.607 0.114 0.006 -0.040 108 ASN BBB N 2882 C CA . ASN B 102 ? 0.679 0.972 0.628 0.127 -0.009 -0.037 108 ASN BBB CA 2883 C C . ASN B 102 ? 0.708 1.002 0.638 0.122 -0.030 -0.034 108 ASN BBB C 2884 O O . ASN B 102 ? 0.713 0.984 0.610 0.111 -0.030 -0.035 108 ASN BBB O 2885 C CB . ASN B 102 ? 0.672 0.958 0.629 0.152 -0.005 -0.031 108 ASN BBB CB 2886 C CG . ASN B 102 ? 0.697 1.034 0.709 0.167 -0.010 -0.030 108 ASN BBB CG 2887 O OD1 . ASN B 102 ? 0.715 1.090 0.751 0.156 -0.027 -0.030 108 ASN BBB OD1 2888 N ND2 . ASN B 102 ? 0.762 1.101 0.795 0.191 0.002 -0.029 108 ASN BBB ND2 2889 N N . TYR B 103 ? 0.716 1.038 0.666 0.130 -0.048 -0.030 109 TYR BBB N 2890 C CA . TYR B 103 ? 0.704 1.031 0.632 0.125 -0.069 -0.028 109 TYR BBB CA 2891 C C . TYR B 103 ? 0.704 1.040 0.635 0.143 -0.087 -0.014 109 TYR BBB C 2892 O O . TYR B 103 ? 0.735 1.091 0.705 0.159 -0.087 -0.010 109 TYR BBB O 2893 C CB . TYR B 103 ? 0.660 1.015 0.603 0.110 -0.080 -0.040 109 TYR BBB CB 2894 C CG . TYR B 103 ? 0.609 1.007 0.600 0.113 -0.092 -0.039 109 TYR BBB CG 2895 C CD1 . TYR B 103 ? 0.596 1.015 0.629 0.111 -0.077 -0.041 109 TYR BBB CD1 2896 C CD2 . TYR B 103 ? 0.626 1.050 0.621 0.116 -0.118 -0.035 109 TYR BBB CD2 2897 C CE1 . TYR B 103 ? 0.604 1.074 0.690 0.112 -0.087 -0.040 109 TYR BBB CE1 2898 C CE2 . TYR B 103 ? 0.622 1.095 0.668 0.117 -0.133 -0.033 109 TYR BBB CE2 2899 C CZ . TYR B 103 ? 0.604 1.103 0.700 0.115 -0.116 -0.036 109 TYR BBB CZ 2900 O OH . TYR B 103 ? 0.590 1.147 0.744 0.115 -0.129 -0.033 109 TYR BBB OH 2901 N N . PHE B 104 ? 0.681 1.006 0.574 0.140 -0.101 -0.007 110 PHE BBB N 2902 C CA . PHE B 104 ? 0.685 1.019 0.572 0.153 -0.125 0.008 110 PHE BBB CA 2903 C C . PHE B 104 ? 0.681 1.027 0.534 0.137 -0.141 0.004 110 PHE BBB C 2904 O O . PHE B 104 ? 0.641 0.986 0.482 0.121 -0.131 -0.012 110 PHE BBB O 2905 C CB . PHE B 104 ? 0.702 0.992 0.560 0.166 -0.121 0.026 110 PHE BBB CB 2906 C CG . PHE B 104 ? 0.715 0.966 0.526 0.150 -0.107 0.027 110 PHE BBB CG 2907 C CD1 . PHE B 104 ? 0.725 0.961 0.539 0.141 -0.084 0.016 110 PHE BBB CD1 2908 C CD2 . PHE B 104 ? 0.719 0.956 0.483 0.141 -0.116 0.041 110 PHE BBB CD2 2909 C CE1 . PHE B 104 ? 0.733 0.942 0.510 0.125 -0.074 0.019 110 PHE BBB CE1 2910 C CE2 . PHE B 104 ? 0.746 0.958 0.474 0.124 -0.102 0.043 110 PHE BBB CE2 2911 C CZ . PHE B 104 ? 0.756 0.956 0.494 0.116 -0.082 0.032 110 PHE BBB CZ 2912 N N . HIS B 105 ? 0.733 1.088 0.570 0.144 -0.166 0.018 111 HIS BBB N 2913 C CA . HIS B 105 ? 0.741 1.108 0.538 0.129 -0.183 0.013 111 HIS BBB CA 2914 C C . HIS B 105 ? 0.785 1.139 0.539 0.135 -0.204 0.037 111 HIS BBB C 2915 O O . HIS B 105 ? 0.756 1.106 0.531 0.155 -0.216 0.057 111 HIS BBB O 2916 C CB . HIS B 105 ? 0.728 1.134 0.556 0.120 -0.201 -0.003 111 HIS BBB CB 2917 C CG . HIS B 105 ? 0.743 1.185 0.613 0.134 -0.228 0.010 111 HIS BBB CG 2918 N ND1 . HIS B 105 ? 0.804 1.260 0.649 0.135 -0.261 0.022 111 HIS BBB ND1 2919 C CD2 . HIS B 105 ? 0.762 1.233 0.698 0.147 -0.227 0.013 111 HIS BBB CD2 2920 C CE1 . HIS B 105 ? 0.834 1.328 0.733 0.150 -0.282 0.033 111 HIS BBB CE1 2921 N NE2 . HIS B 105 ? 0.824 1.331 0.783 0.158 -0.260 0.027 111 HIS BBB NE2 2922 N N . ASP B 106 ? 0.844 1.193 0.541 0.120 -0.206 0.035 112 ASP BBB N 2923 C CA . ASP B 106 ? 0.874 1.210 0.512 0.118 -0.224 0.057 112 ASP BBB CA 2924 C C . ASP B 106 ? 0.895 1.261 0.511 0.109 -0.252 0.048 112 ASP BBB C 2925 O O . ASP B 106 ? 0.848 1.241 0.500 0.104 -0.256 0.024 112 ASP BBB O 2926 C CB . ASP B 106 ? 0.921 1.232 0.503 0.102 -0.200 0.059 112 ASP BBB CB 2927 C CG . ASP B 106 ? 1.008 1.279 0.572 0.105 -0.192 0.087 112 ASP BBB CG 2928 O OD1 . ASP B 106 ? 1.056 1.310 0.618 0.120 -0.215 0.113 112 ASP BBB OD1 2929 O OD2 . ASP B 106 ? 1.058 1.314 0.609 0.093 -0.165 0.084 112 ASP BBB OD2 2930 N N . ALA B 107 ? 0.943 1.302 0.498 0.103 -0.271 0.066 113 ALA BBB N 2931 C CA . ALA B 107 ? 0.978 1.358 0.487 0.090 -0.296 0.056 113 ALA BBB CA 2932 C C . ALA B 107 ? 0.952 1.335 0.437 0.072 -0.272 0.020 113 ALA BBB C 2933 O O . ALA B 107 ? 0.954 1.357 0.438 0.063 -0.289 -0.004 113 ALA BBB O 2934 C CB . ALA B 107 ? 1.078 1.439 0.513 0.085 -0.311 0.086 113 ALA BBB CB 2935 N N . ARG B 108 ? 0.930 1.295 0.398 0.068 -0.235 0.015 114 ARG BBB N 2936 C CA . ARG B 108 ? 0.920 1.286 0.361 0.057 -0.209 -0.017 114 ARG BBB CA 2937 C C . ARG B 108 ? 0.848 1.213 0.351 0.063 -0.185 -0.036 114 ARG BBB C 2938 O O . ARG B 108 ? 0.829 1.196 0.331 0.059 -0.175 -0.067 114 ARG BBB O 2939 C CB . ARG B 108 ? 0.942 1.299 0.322 0.048 -0.186 -0.005 114 ARG BBB CB 2940 C CG . ARG B 108 ? 0.999 1.351 0.312 0.041 -0.208 0.023 114 ARG BBB CG 2941 C CD . ARG B 108 ? 1.036 1.382 0.290 0.027 -0.180 0.036 114 ARG BBB CD 2942 N NE . ARG B 108 ? 1.112 1.444 0.301 0.018 -0.199 0.072 114 ARG BBB NE 2943 C CZ . ARG B 108 ? 1.168 1.507 0.277 0.004 -0.206 0.072 114 ARG BBB CZ 2944 N NH1 . ARG B 108 ? 1.184 1.542 0.263 -0.001 -0.195 0.034 114 ARG BBB NH1 2945 N NH2 . ARG B 108 ? 1.232 1.552 0.283 -0.004 -0.225 0.111 114 ARG BBB NH2 2946 N N . ARG B 109 ? 0.821 1.177 0.373 0.073 -0.178 -0.019 115 ARG BBB N 2947 C CA . ARG B 109 ? 0.788 1.138 0.383 0.076 -0.152 -0.032 115 ARG BBB CA 2948 C C . ARG B 109 ? 0.738 1.093 0.397 0.084 -0.161 -0.034 115 ARG BBB C 2949 O O . ARG B 109 ? 0.740 1.103 0.418 0.091 -0.182 -0.018 115 ARG BBB O 2950 C CB . ARG B 109 ? 0.783 1.115 0.372 0.076 -0.131 -0.011 115 ARG BBB CB 2951 C CG . ARG B 109 ? 0.826 1.160 0.362 0.065 -0.114 -0.009 115 ARG BBB CG 2952 C CD . ARG B 109 ? 0.841 1.192 0.367 0.062 -0.099 -0.040 115 ARG BBB CD 2953 N NE . ARG B 109 ? 0.879 1.241 0.371 0.054 -0.073 -0.039 115 ARG BBB NE 2954 C CZ . ARG B 109 ? 0.971 1.346 0.406 0.046 -0.069 -0.042 115 ARG BBB CZ 2955 N NH1 . ARG B 109 ? 1.017 1.389 0.413 0.044 -0.092 -0.045 115 ARG BBB NH1 2956 N NH2 . ARG B 109 ? 1.026 1.419 0.439 0.038 -0.041 -0.040 115 ARG BBB NH2 2957 N N . VAL B 110 ? 0.709 1.061 0.400 0.082 -0.144 -0.053 116 VAL BBB N 2958 C CA . VAL B 110 ? 0.702 1.054 0.450 0.088 -0.140 -0.052 116 VAL BBB CA 2959 C C . VAL B 110 ? 0.694 1.026 0.446 0.089 -0.113 -0.049 116 VAL BBB C 2960 O O . VAL B 110 ? 0.732 1.059 0.467 0.084 -0.100 -0.062 116 VAL BBB O 2961 C CB . VAL B 110 ? 0.664 1.026 0.440 0.079 -0.147 -0.073 116 VAL BBB CB 2962 C CG1 . VAL B 110 ? 0.583 0.946 0.411 0.081 -0.136 -0.071 116 VAL BBB CG1 2963 C CG2 . VAL B 110 ? 0.688 1.074 0.463 0.073 -0.177 -0.076 116 VAL BBB CG2 2964 N N . TYR B 111 ? 0.670 0.992 0.445 0.097 -0.107 -0.034 117 TYR BBB N 2965 C CA . TYR B 111 ? 0.649 0.949 0.424 0.096 -0.086 -0.030 117 TYR BBB CA 2966 C C . TYR B 111 ? 0.599 0.898 0.414 0.097 -0.078 -0.037 117 TYR BBB C 2967 O O . TYR B 111 ? 0.563 0.870 0.407 0.105 -0.083 -0.033 117 TYR BBB O 2968 C CB . TYR B 111 ? 0.706 0.985 0.463 0.100 -0.085 -0.008 117 TYR BBB CB 2969 C CG . TYR B 111 ? 0.779 1.058 0.493 0.096 -0.094 0.004 117 TYR BBB CG 2970 C CD1 . TYR B 111 ? 0.830 1.116 0.535 0.103 -0.115 0.014 117 TYR BBB CD1 2971 C CD2 . TYR B 111 ? 0.801 1.077 0.484 0.083 -0.080 0.006 117 TYR BBB CD2 2972 C CE1 . TYR B 111 ? 0.865 1.147 0.521 0.096 -0.124 0.028 117 TYR BBB CE1 2973 C CE2 . TYR B 111 ? 0.827 1.105 0.466 0.076 -0.085 0.018 117 TYR BBB CE2 2974 C CZ . TYR B 111 ? 0.883 1.161 0.504 0.082 -0.107 0.030 117 TYR BBB CZ 2975 O OH . TYR B 111 ? 0.925 1.201 0.495 0.072 -0.112 0.045 117 TYR BBB OH 2976 N N . LEU B 112 ? 0.589 0.880 0.405 0.091 -0.065 -0.047 118 LEU BBB N 2977 C CA . LEU B 112 ? 0.578 0.860 0.419 0.089 -0.054 -0.050 118 LEU BBB CA 2978 C C . LEU B 112 ? 0.559 0.818 0.385 0.088 -0.041 -0.041 118 LEU BBB C 2979 O O . LEU B 112 ? 0.560 0.817 0.368 0.083 -0.038 -0.041 118 LEU BBB O 2980 C CB . LEU B 112 ? 0.573 0.855 0.421 0.082 -0.054 -0.065 118 LEU BBB CB 2981 C CG . LEU B 112 ? 0.597 0.894 0.453 0.078 -0.069 -0.077 118 LEU BBB CG 2982 C CD1 . LEU B 112 ? 0.635 0.918 0.498 0.070 -0.068 -0.091 118 LEU BBB CD1 2983 C CD2 . LEU B 112 ? 0.556 0.874 0.441 0.079 -0.077 -0.070 118 LEU BBB CD2 2984 N N . ILE B 113 ? 0.533 0.779 0.368 0.093 -0.035 -0.035 119 ILE BBB N 2985 C CA . ILE B 113 ? 0.535 0.752 0.353 0.089 -0.024 -0.029 119 ILE BBB CA 2986 C C . ILE B 113 ? 0.510 0.725 0.337 0.082 -0.016 -0.037 119 ILE BBB C 2987 O O . ILE B 113 ? 0.503 0.721 0.348 0.084 -0.009 -0.040 119 ILE BBB O 2988 C CB . ILE B 113 ? 0.556 0.753 0.374 0.101 -0.020 -0.023 119 ILE BBB CB 2989 C CG1 . ILE B 113 ? 0.568 0.769 0.385 0.113 -0.032 -0.014 119 ILE BBB CG1 2990 C CG2 . ILE B 113 ? 0.603 0.762 0.392 0.093 -0.011 -0.020 119 ILE BBB CG2 2991 C CD1 . ILE B 113 ? 0.593 0.784 0.426 0.132 -0.030 -0.010 119 ILE BBB CD1 2992 N N . LEU B 114 ? 0.509 0.721 0.325 0.073 -0.016 -0.038 120 LEU BBB N 2993 C CA . LEU B 114 ? 0.541 0.747 0.361 0.066 -0.013 -0.041 120 LEU BBB CA 2994 C C . LEU B 114 ? 0.567 0.752 0.366 0.058 -0.009 -0.036 120 LEU BBB C 2995 O O . LEU B 114 ? 0.539 0.717 0.321 0.054 -0.010 -0.030 120 LEU BBB O 2996 C CB . LEU B 114 ? 0.537 0.758 0.364 0.067 -0.020 -0.048 120 LEU BBB CB 2997 C CG . LEU B 114 ? 0.528 0.763 0.369 0.072 -0.027 -0.057 120 LEU BBB CG 2998 C CD1 . LEU B 114 ? 0.522 0.762 0.363 0.075 -0.032 -0.067 120 LEU BBB CD1 2999 C CD2 . LEU B 114 ? 0.497 0.727 0.356 0.067 -0.025 -0.059 120 LEU BBB CD2 3000 N N . GLU B 115 ? 0.592 0.765 0.388 0.052 -0.005 -0.036 121 GLU BBB N 3001 C CA . GLU B 115 ? 0.679 0.833 0.451 0.041 -0.006 -0.031 121 GLU BBB CA 3002 C C . GLU B 115 ? 0.678 0.850 0.455 0.039 -0.017 -0.027 121 GLU BBB C 3003 O O . GLU B 115 ? 0.667 0.857 0.463 0.046 -0.022 -0.031 121 GLU BBB O 3004 C CB . GLU B 115 ? 0.700 0.842 0.467 0.035 -0.003 -0.029 121 GLU BBB CB 3005 C CG . GLU B 115 ? 0.725 0.845 0.460 0.022 -0.006 -0.023 121 GLU BBB CG 3006 C CD . GLU B 115 ? 0.779 0.886 0.503 0.015 -0.008 -0.017 121 GLU BBB CD 3007 O OE1 . GLU B 115 ? 0.732 0.839 0.468 0.015 0.001 -0.018 121 GLU BBB OE1 3008 O OE2 . GLU B 115 ? 0.854 0.952 0.558 0.006 -0.020 -0.009 121 GLU BBB OE2 3009 N N . TYR B 116 ? 0.669 0.834 0.428 0.028 -0.021 -0.022 122 TYR BBB N 3010 C CA . TYR B 116 ? 0.584 0.774 0.351 0.022 -0.030 -0.016 122 TYR BBB CA 3011 C C . TYR B 116 ? 0.552 0.740 0.317 0.017 -0.041 -0.012 122 TYR BBB C 3012 O O . TYR B 116 ? 0.635 0.794 0.371 0.005 -0.042 -0.009 122 TYR BBB O 3013 C CB . TYR B 116 ? 0.610 0.795 0.360 0.007 -0.031 -0.011 122 TYR BBB CB 3014 C CG . TYR B 116 ? 0.627 0.846 0.390 -0.004 -0.040 -0.004 122 TYR BBB CG 3015 C CD1 . TYR B 116 ? 0.620 0.884 0.414 0.006 -0.039 -0.005 122 TYR BBB CD1 3016 C CD2 . TYR B 116 ? 0.643 0.852 0.388 -0.027 -0.048 0.003 122 TYR BBB CD2 3017 C CE1 . TYR B 116 ? 0.617 0.923 0.431 -0.002 -0.044 0.001 122 TYR BBB CE1 3018 C CE2 . TYR B 116 ? 0.633 0.884 0.398 -0.040 -0.057 0.011 122 TYR BBB CE2 3019 C CZ . TYR B 116 ? 0.611 0.915 0.414 -0.026 -0.054 0.011 122 TYR BBB CZ 3020 O OH . TYR B 116 ? 0.622 0.978 0.454 -0.037 -0.060 0.018 122 TYR BBB OH 3021 N N . ALA B 117 ? 0.486 0.701 0.278 0.028 -0.048 -0.011 123 ALA BBB N 3022 C CA . ALA B 117 ? 0.490 0.709 0.288 0.028 -0.063 -0.003 123 ALA BBB CA 3023 C C . ALA B 117 ? 0.524 0.779 0.336 0.020 -0.074 0.004 123 ALA BBB C 3024 O O . ALA B 117 ? 0.492 0.789 0.339 0.032 -0.075 0.002 123 ALA BBB O 3025 C CB . ALA B 117 ? 0.461 0.685 0.284 0.049 -0.066 -0.007 123 ALA BBB CB 3026 N N . PRO B 118 ? 0.754 0.887 0.367 -0.046 -0.019 0.034 124 PRO BBB N 3027 C CA . PRO B 118 ? 0.784 0.917 0.394 -0.066 -0.014 0.036 124 PRO BBB CA 3028 C C . PRO B 118 ? 0.769 0.940 0.403 -0.074 -0.002 0.033 124 PRO BBB C 3029 O O . PRO B 118 ? 0.790 0.964 0.422 -0.091 0.007 0.036 124 PRO BBB O 3030 C CB . PRO B 118 ? 0.806 0.927 0.418 -0.065 -0.022 0.032 124 PRO BBB CB 3031 C CG . PRO B 118 ? 0.802 0.904 0.406 -0.046 -0.031 0.030 124 PRO BBB CG 3032 C CD . PRO B 118 ? 0.752 0.877 0.370 -0.033 -0.027 0.029 124 PRO BBB CD 3033 N N . ARG B 119 ? 0.788 0.987 0.443 -0.061 -0.001 0.028 125 ARG BBB N 3034 C CA . ARG B 119 ? 0.802 1.038 0.483 -0.063 0.007 0.023 125 ARG BBB CA 3035 C C . ARG B 119 ? 0.787 1.036 0.467 -0.058 0.016 0.023 125 ARG BBB C 3036 O O . ARG B 119 ? 0.787 1.065 0.487 -0.054 0.022 0.018 125 ARG BBB O 3037 C CB . ARG B 119 ? 0.848 1.097 0.545 -0.051 -0.000 0.017 125 ARG BBB CB 3038 C CG . ARG B 119 ? 0.941 1.184 0.640 -0.058 -0.009 0.013 125 ARG BBB CG 3039 C CD . ARG B 119 ? 1.021 1.275 0.730 -0.047 -0.017 0.007 125 ARG BBB CD 3040 N NE . ARG B 119 ? 1.133 1.396 0.854 -0.057 -0.025 0.001 125 ARG BBB NE 3041 C CZ . ARG B 119 ? 1.135 1.431 0.884 -0.062 -0.026 -0.004 125 ARG BBB CZ 3042 N NH1 . ARG B 119 ? 1.100 1.422 0.865 -0.056 -0.016 -0.004 125 ARG BBB NH1 3043 N NH2 . ARG B 119 ? 1.133 1.437 0.896 -0.072 -0.037 -0.010 125 ARG BBB NH2 3044 N N . GLY B 120 ? 0.801 1.027 0.457 -0.057 0.016 0.029 126 GLY BBB N 3045 C CA . GLY B 120 ? 0.789 1.017 0.433 -0.055 0.024 0.029 126 GLY BBB CA 3046 C C . GLY B 120 ? 0.768 1.012 0.426 -0.040 0.023 0.023 126 GLY BBB C 3047 O O . GLY B 120 ? 0.798 1.042 0.466 -0.030 0.014 0.022 126 GLY BBB O 3048 N N . GLU B 121 ? 0.814 1.072 0.471 -0.039 0.033 0.021 127 GLU BBB N 3049 C CA . GLU B 121 ? 0.844 1.109 0.506 -0.025 0.032 0.015 127 GLU BBB CA 3050 C C . GLU B 121 ? 0.734 1.025 0.424 -0.018 0.033 0.010 127 GLU BBB C 3051 O O . GLU B 121 ? 0.734 1.046 0.441 -0.024 0.039 0.008 127 GLU BBB O 3052 C CB . GLU B 121 ? 0.961 1.222 0.602 -0.027 0.043 0.014 127 GLU BBB CB 3053 C CG . GLU B 121 ? 1.081 1.340 0.719 -0.014 0.040 0.008 127 GLU BBB CG 3054 C CD . GLU B 121 ? 1.230 1.476 0.837 -0.014 0.048 0.006 127 GLU BBB CD 3055 O OE1 . GLU B 121 ? 1.422 1.642 0.999 -0.020 0.043 0.012 127 GLU BBB OE1 3056 O OE2 . GLU B 121 ? 1.184 1.444 0.795 -0.008 0.057 -0.001 127 GLU BBB OE2 3057 N N . LEU B 122 ? 0.671 0.959 0.366 -0.007 0.027 0.007 128 LEU BBB N 3058 C CA . LEU B 122 ? 0.640 0.942 0.352 0.002 0.025 0.003 128 LEU BBB CA 3059 C C . LEU B 122 ? 0.657 0.980 0.379 0.008 0.033 -0.004 128 LEU BBB C 3060 O O . LEU B 122 ? 0.633 0.977 0.374 0.010 0.033 -0.008 128 LEU BBB O 3061 C CB . LEU B 122 ? 0.623 0.910 0.332 0.011 0.020 0.003 128 LEU BBB CB 3062 C CG . LEU B 122 ? 0.627 0.917 0.343 0.021 0.017 0.000 128 LEU BBB CG 3063 C CD1 . LEU B 122 ? 0.620 0.919 0.343 0.020 0.013 0.000 128 LEU BBB CD1 3064 C CD2 . LEU B 122 ? 0.625 0.895 0.333 0.025 0.015 0.002 128 LEU BBB CD2 3065 N N . TYR B 123 ? 0.708 1.023 0.415 0.010 0.039 -0.006 129 TYR BBB N 3066 C CA . TYR B 123 ? 0.715 1.047 0.427 0.018 0.049 -0.014 129 TYR BBB CA 3067 C C . TYR B 123 ? 0.689 1.051 0.420 0.010 0.060 -0.016 129 TYR BBB C 3068 O O . TYR B 123 ? 0.635 1.025 0.391 0.018 0.064 -0.024 129 TYR BBB O 3069 C CB . TYR B 123 ? 0.763 1.078 0.449 0.020 0.054 -0.016 129 TYR BBB CB 3070 C CG . TYR B 123 ? 0.785 1.115 0.474 0.030 0.066 -0.025 129 TYR BBB CG 3071 C CD1 . TYR B 123 ? 0.789 1.121 0.486 0.047 0.061 -0.033 129 TYR BBB CD1 3072 C CD2 . TYR B 123 ? 0.830 1.172 0.512 0.023 0.083 -0.027 129 TYR BBB CD2 3073 C CE1 . TYR B 123 ? 0.839 1.185 0.540 0.059 0.072 -0.043 129 TYR BBB CE1 3074 C CE2 . TYR B 123 ? 0.854 1.214 0.541 0.034 0.097 -0.038 129 TYR BBB CE2 3075 C CZ . TYR B 123 ? 0.836 1.199 0.535 0.053 0.091 -0.046 129 TYR BBB CZ 3076 O OH . TYR B 123 ? 0.794 1.175 0.499 0.067 0.104 -0.058 129 TYR BBB OH 3077 N N . LYS B 124 ? 0.712 1.068 0.434 -0.007 0.064 -0.009 130 LYS BBB N 3078 C CA . LYS B 124 ? 0.745 1.126 0.484 -0.021 0.077 -0.010 130 LYS BBB CA 3079 C C . LYS B 124 ? 0.704 1.109 0.477 -0.021 0.067 -0.013 130 LYS BBB C 3080 O O . LYS B 124 ? 0.690 1.131 0.495 -0.022 0.075 -0.020 130 LYS BBB O 3081 C CB . LYS B 124 ? 0.779 1.136 0.491 -0.039 0.082 -0.000 130 LYS BBB CB 3082 C CG . LYS B 124 ? 0.851 1.227 0.574 -0.058 0.100 0.000 130 LYS BBB CG 3083 C CD . LYS B 124 ? 0.952 1.296 0.647 -0.076 0.099 0.011 130 LYS BBB CD 3084 C CE . LYS B 124 ? 1.027 1.383 0.726 -0.099 0.119 0.013 130 LYS BBB CE 3085 N NZ . LYS B 124 ? 1.020 1.406 0.763 -0.110 0.115 0.009 130 LYS BBB NZ 3086 N N . GLU B 125 ? 0.704 1.090 0.472 -0.019 0.051 -0.009 131 GLU BBB N 3087 C CA . GLU B 125 ? 0.721 1.122 0.513 -0.017 0.039 -0.012 131 GLU BBB CA 3088 C C . GLU B 125 ? 0.701 1.123 0.513 0.002 0.034 -0.021 131 GLU BBB C 3089 O O . GLU B 125 ? 0.711 1.161 0.553 0.003 0.028 -0.028 131 GLU BBB O 3090 C CB . GLU B 125 ? 0.749 1.119 0.522 -0.015 0.026 -0.006 131 GLU BBB CB 3091 C CG . GLU B 125 ? 0.767 1.142 0.551 -0.012 0.012 -0.009 131 GLU BBB CG 3092 C CD . GLU B 125 ? 0.842 1.243 0.653 -0.025 0.010 -0.014 131 GLU BBB CD 3093 O OE1 . GLU B 125 ? 0.922 1.320 0.730 -0.043 0.019 -0.010 131 GLU BBB OE1 3094 O OE2 . GLU B 125 ? 0.882 1.302 0.714 -0.018 -0.001 -0.021 131 GLU BBB OE2 3095 N N . LEU B 126 ? 0.685 1.092 0.481 0.017 0.034 -0.022 132 LEU BBB N 3096 C CA . LEU B 126 ? 0.704 1.121 0.511 0.037 0.028 -0.030 132 LEU BBB CA 3097 C C . LEU B 126 ? 0.724 1.183 0.564 0.040 0.039 -0.040 132 LEU BBB C 3098 O O . LEU B 126 ? 0.737 1.221 0.605 0.052 0.029 -0.048 132 LEU BBB O 3099 C CB . LEU B 126 ? 0.705 1.092 0.485 0.048 0.028 -0.028 132 LEU BBB CB 3100 C CG . LEU B 126 ? 0.732 1.117 0.514 0.070 0.022 -0.035 132 LEU BBB CG 3101 C CD1 . LEU B 126 ? 0.770 1.148 0.554 0.078 0.005 -0.034 132 LEU BBB CD1 3102 C CD2 . LEU B 126 ? 0.773 1.126 0.527 0.076 0.024 -0.034 132 LEU BBB CD2 3103 N N . GLN B 127 ? 0.740 1.207 0.576 0.032 0.058 -0.041 133 GLN BBB N 3104 C CA . GLN B 127 ? 0.799 1.308 0.666 0.034 0.074 -0.052 133 GLN BBB CA 3105 C C . GLN B 127 ? 0.789 1.338 0.700 0.022 0.071 -0.055 133 GLN BBB C 3106 O O . GLN B 127 ? 0.854 1.444 0.806 0.034 0.071 -0.068 133 GLN BBB O 3107 C CB . GLN B 127 ? 0.845 1.349 0.691 0.022 0.097 -0.049 133 GLN BBB CB 3108 C CG . GLN B 127 ? 0.872 1.342 0.678 0.035 0.100 -0.049 133 GLN BBB CG 3109 C CD . GLN B 127 ? 0.928 1.396 0.740 0.061 0.089 -0.058 133 GLN BBB CD 3110 O OE1 . GLN B 127 ? 0.866 1.304 0.662 0.068 0.071 -0.053 133 GLN BBB OE1 3111 N NE2 . GLN B 127 ? 0.948 1.444 0.781 0.075 0.100 -0.071 133 GLN BBB NE2 3112 N N . LYS B 128 ? 0.744 1.279 0.646 0.001 0.068 -0.046 134 LYS BBB N 3113 C CA . LYS B 128 ? 0.763 1.328 0.702 -0.015 0.064 -0.050 134 LYS BBB CA 3114 C C . LYS B 128 ? 0.752 1.328 0.713 0.001 0.037 -0.056 134 LYS BBB C 3115 O O . LYS B 128 ? 0.752 1.370 0.759 -0.002 0.032 -0.066 134 LYS BBB O 3116 C CB . LYS B 128 ? 0.820 1.355 0.734 -0.039 0.065 -0.038 134 LYS BBB CB 3117 C CG . LYS B 128 ? 0.892 1.444 0.834 -0.055 0.054 -0.040 134 LYS BBB CG 3118 C CD . LYS B 128 ? 0.982 1.495 0.893 -0.077 0.054 -0.028 134 LYS BBB CD 3119 C CE . LYS B 128 ? 0.997 1.498 0.911 -0.080 0.030 -0.029 134 LYS BBB CE 3120 N NZ . LYS B 128 ? 0.988 1.438 0.857 -0.086 0.025 -0.018 134 LYS BBB NZ 3121 N N . SER B 129 ? 0.751 1.288 0.678 0.016 0.021 -0.051 135 SER BBB N 3122 C CA . SER B 129 ? 0.707 1.240 0.639 0.032 -0.004 -0.055 135 SER BBB CA 3123 C C . SER B 129 ? 0.709 1.260 0.658 0.059 -0.011 -0.066 135 SER BBB C 3124 O O . SER B 129 ? 0.674 1.227 0.632 0.074 -0.034 -0.071 135 SER BBB O 3125 C CB . SER B 129 ? 0.691 1.172 0.576 0.035 -0.014 -0.045 135 SER BBB CB 3126 O OG . SER B 129 ? 0.666 1.131 0.539 0.014 -0.013 -0.038 135 SER BBB OG 3127 N N . GLU B 130 ? 0.722 1.280 0.671 0.066 0.006 -0.069 136 GLU BBB N 3128 C CA . GLU B 130 ? 0.743 1.304 0.695 0.095 0.002 -0.078 136 GLU BBB CA 3129 C C . GLU B 130 ? 0.751 1.256 0.655 0.108 -0.013 -0.069 136 GLU BBB C 3130 O O . GLU B 130 ? 0.785 1.266 0.663 0.116 -0.004 -0.068 136 GLU BBB O 3131 C CB . GLU B 130 ? 0.781 1.387 0.783 0.111 -0.013 -0.093 136 GLU BBB CB 3132 C CG . GLU B 130 ? 0.834 1.503 0.893 0.099 0.005 -0.103 136 GLU BBB CG 3133 C CD . GLU B 130 ? 0.907 1.629 1.026 0.115 -0.012 -0.120 136 GLU BBB CD 3134 O OE1 . GLU B 130 ? 0.880 1.653 1.051 0.096 -0.005 -0.127 136 GLU BBB OE1 3135 O OE2 . GLU B 130 ? 1.011 1.724 1.127 0.145 -0.033 -0.127 136 GLU BBB OE2 3136 N N . LYS B 131 ? 0.748 1.233 0.639 0.109 -0.032 -0.065 137 LYS BBB N 3137 C CA . LYS B 131 ? 0.754 1.184 0.597 0.118 -0.043 -0.056 137 LYS BBB CA 3138 C C . LYS B 131 ? 0.739 1.149 0.563 0.104 -0.051 -0.047 137 LYS BBB C 3139 O O . LYS B 131 ? 0.813 1.251 0.664 0.093 -0.056 -0.051 137 LYS BBB O 3140 C CB . LYS B 131 ? 0.782 1.201 0.619 0.146 -0.062 -0.062 137 LYS BBB CB 3141 C CG . LYS B 131 ? 0.788 1.247 0.666 0.158 -0.081 -0.075 137 LYS BBB CG 3142 C CD . LYS B 131 ? 0.812 1.265 0.690 0.190 -0.100 -0.084 137 LYS BBB CD 3143 C CE . LYS B 131 ? 0.874 1.375 0.798 0.203 -0.090 -0.098 137 LYS BBB CE 3144 N NZ . LYS B 131 ? 0.971 1.444 0.875 0.233 -0.098 -0.103 137 LYS BBB NZ 3145 N N . LEU B 132 ? 0.708 1.073 0.491 0.102 -0.049 -0.037 138 LEU BBB N 3146 C CA . LEU B 132 ? 0.746 1.088 0.507 0.091 -0.054 -0.030 138 LEU BBB CA 3147 C C . LEU B 132 ? 0.835 1.146 0.567 0.108 -0.074 -0.030 138 LEU BBB C 3148 O O . LEU B 132 ? 0.863 1.150 0.574 0.124 -0.077 -0.029 138 LEU BBB O 3149 C CB . LEU B 132 ? 0.751 1.065 0.486 0.079 -0.039 -0.020 138 LEU BBB CB 3150 C CG . LEU B 132 ? 0.737 1.068 0.487 0.059 -0.027 -0.018 138 LEU BBB CG 3151 C CD1 . LEU B 132 ? 0.714 1.082 0.495 0.055 -0.018 -0.024 138 LEU BBB CD1 3152 C CD2 . LEU B 132 ? 0.714 1.020 0.443 0.051 -0.016 -0.010 138 LEU BBB CD2 3153 N N . ASP B 133 ? 0.894 1.202 0.621 0.104 -0.087 -0.031 139 ASP BBB N 3154 C CA . ASP B 133 ? 0.961 1.234 0.652 0.119 -0.107 -0.030 139 ASP BBB CA 3155 C C . ASP B 133 ? 0.980 1.202 0.620 0.118 -0.094 -0.019 139 ASP BBB C 3156 O O . ASP B 133 ? 1.051 1.273 0.694 0.105 -0.073 -0.013 139 ASP BBB O 3157 C CB . ASP B 133 ? 1.007 1.284 0.699 0.113 -0.123 -0.035 139 ASP BBB CB 3158 C CG . ASP B 133 ? 1.050 1.325 0.740 0.091 -0.109 -0.030 139 ASP BBB CG 3159 O OD1 . ASP B 133 ? 1.106 1.355 0.770 0.086 -0.091 -0.021 139 ASP BBB OD1 3160 O OD2 . ASP B 133 ? 1.062 1.362 0.778 0.079 -0.116 -0.036 139 ASP BBB OD2 3161 N N . GLU B 134 ? 0.987 1.165 0.582 0.132 -0.106 -0.016 140 GLU BBB N 3162 C CA . GLU B 134 ? 0.980 1.108 0.526 0.130 -0.092 -0.004 140 GLU BBB CA 3163 C C . GLU B 134 ? 0.938 1.061 0.476 0.112 -0.074 0.001 140 GLU BBB C 3164 O O . GLU B 134 ? 0.973 1.075 0.496 0.104 -0.054 0.008 140 GLU BBB O 3165 C CB . GLU B 134 ? 1.063 1.142 0.556 0.148 -0.109 -0.002 140 GLU BBB CB 3166 C CG . GLU B 134 ? 1.105 1.187 0.605 0.170 -0.131 -0.008 140 GLU BBB CG 3167 C CD . GLU B 134 ? 1.210 1.232 0.647 0.189 -0.149 -0.004 140 GLU BBB CD 3168 O OE1 . GLU B 134 ? 1.243 1.213 0.627 0.184 -0.134 0.008 140 GLU BBB OE1 3169 O OE2 . GLU B 134 ? 1.292 1.319 0.733 0.209 -0.179 -0.013 140 GLU BBB OE2 3170 N N . GLN B 135 ? 0.889 1.029 0.440 0.106 -0.083 -0.005 141 GLN BBB N 3171 C CA A GLN B 135 ? 0.850 0.982 0.391 0.093 -0.071 -0.002 141 GLN BBB CA 3172 C CA B GLN B 135 ? 0.891 1.024 0.432 0.093 -0.071 -0.002 141 GLN BBB CA 3173 C C . GLN B 135 ? 0.800 0.957 0.373 0.078 -0.050 0.001 141 GLN BBB C 3174 O O . GLN B 135 ? 0.738 0.877 0.297 0.073 -0.032 0.007 141 GLN BBB O 3175 C CB A GLN B 135 ? 0.839 0.983 0.387 0.091 -0.089 -0.010 141 GLN BBB CB 3176 C CB B GLN B 135 ? 0.949 1.094 0.499 0.090 -0.088 -0.010 141 GLN BBB CB 3177 C CG A GLN B 135 ? 0.852 0.963 0.362 0.087 -0.084 -0.009 141 GLN BBB CG 3178 C CG B GLN B 135 ? 1.085 1.190 0.585 0.101 -0.104 -0.012 141 GLN BBB CG 3179 C CD A GLN B 135 ? 0.860 0.967 0.361 0.089 -0.109 -0.017 141 GLN BBB CD 3180 C CD B GLN B 135 ? 1.119 1.214 0.605 0.119 -0.128 -0.015 141 GLN BBB CD 3181 O OE1 A GLN B 135 ? 0.877 0.954 0.339 0.102 -0.126 -0.019 141 GLN BBB OE1 3182 O OE1 B GLN B 135 ? 1.118 1.164 0.548 0.131 -0.134 -0.011 141 GLN BBB OE1 3183 N NE2 A GLN B 135 ? 0.832 0.967 0.367 0.076 -0.112 -0.023 141 GLN BBB NE2 3184 N NE2 B GLN B 135 ? 1.081 1.218 0.615 0.123 -0.141 -0.022 141 GLN BBB NE2 3185 N N . ARG B 136 ? 0.754 0.950 0.369 0.073 -0.053 -0.004 142 ARG BBB N 3186 C CA . ARG B 136 ? 0.724 0.942 0.366 0.059 -0.038 -0.002 142 ARG BBB CA 3187 C C . ARG B 136 ? 0.679 0.887 0.317 0.061 -0.024 0.003 142 ARG BBB C 3188 O O . ARG B 136 ? 0.629 0.835 0.270 0.052 -0.011 0.007 142 ARG BBB O 3189 C CB . ARG B 136 ? 0.731 0.988 0.411 0.054 -0.043 -0.008 142 ARG BBB CB 3190 C CG . ARG B 136 ? 0.767 1.035 0.457 0.047 -0.056 -0.013 142 ARG BBB CG 3191 C CD . ARG B 136 ? 0.786 1.096 0.517 0.042 -0.061 -0.020 142 ARG BBB CD 3192 N NE . ARG B 136 ? 0.843 1.167 0.590 0.027 -0.045 -0.017 142 ARG BBB NE 3193 C CZ . ARG B 136 ? 0.901 1.259 0.680 0.020 -0.039 -0.021 142 ARG BBB CZ 3194 N NH1 . ARG B 136 ? 0.897 1.285 0.705 0.026 -0.048 -0.029 142 ARG BBB NH1 3195 N NH2 . ARG B 136 ? 0.824 1.185 0.606 0.008 -0.024 -0.016 142 ARG BBB NH2 3196 N N . THR B 137 ? 0.692 0.893 0.323 0.072 -0.029 0.002 143 THR BBB N 3197 C CA . THR B 137 ? 0.731 0.917 0.355 0.074 -0.019 0.006 143 THR BBB CA 3198 C C . THR B 137 ? 0.793 0.945 0.388 0.069 -0.006 0.013 143 THR BBB C 3199 O O . THR B 137 ? 0.804 0.958 0.410 0.059 0.007 0.016 143 THR BBB O 3200 C CB . THR B 137 ? 0.737 0.915 0.354 0.090 -0.030 0.003 143 THR BBB CB 3201 O OG1 . THR B 137 ? 0.718 0.936 0.369 0.093 -0.038 -0.005 143 THR BBB OG1 3202 C CG2 . THR B 137 ? 0.756 0.912 0.361 0.092 -0.022 0.006 143 THR BBB CG2 3203 N N . ALA B 138 ? 0.811 0.933 0.371 0.075 -0.010 0.016 144 ALA BBB N 3204 C CA . ALA B 138 ? 0.850 0.937 0.378 0.070 0.006 0.023 144 ALA BBB CA 3205 C C . ALA B 138 ? 0.813 0.913 0.355 0.059 0.020 0.023 144 ALA BBB C 3206 O O . ALA B 138 ? 0.869 0.957 0.407 0.051 0.038 0.027 144 ALA BBB O 3207 C CB . ALA B 138 ? 0.912 0.961 0.392 0.082 -0.003 0.026 144 ALA BBB CB 3208 N N . THR B 139 ? 0.744 0.867 0.304 0.058 0.011 0.018 145 THR BBB N 3209 C CA . THR B 139 ? 0.731 0.867 0.307 0.049 0.021 0.017 145 THR BBB CA 3210 C C . THR B 139 ? 0.711 0.868 0.320 0.041 0.029 0.017 145 THR BBB C 3211 O O . THR B 139 ? 0.748 0.905 0.364 0.035 0.043 0.018 145 THR BBB O 3212 C CB . THR B 139 ? 0.733 0.883 0.317 0.049 0.007 0.011 145 THR BBB CB 3213 O OG1 . THR B 139 ? 0.720 0.850 0.274 0.057 -0.006 0.009 145 THR BBB OG1 3214 C CG2 . THR B 139 ? 0.726 0.879 0.318 0.044 0.015 0.010 145 THR BBB CG2 3215 N N . ILE B 140 ? 0.678 0.854 0.306 0.040 0.022 0.016 146 ILE BBB N 3216 C CA . ILE B 140 ? 0.662 0.854 0.316 0.033 0.026 0.015 146 ILE BBB CA 3217 C C . ILE B 140 ? 0.677 0.853 0.326 0.030 0.038 0.018 146 ILE BBB C 3218 O O . ILE B 140 ? 0.695 0.878 0.362 0.023 0.046 0.018 146 ILE BBB O 3219 C CB . ILE B 140 ? 0.622 0.832 0.289 0.035 0.017 0.012 146 ILE BBB CB 3220 C CG1 . ILE B 140 ? 0.587 0.816 0.265 0.032 0.010 0.010 146 ILE BBB CG1 3221 C CG2 . ILE B 140 ? 0.623 0.839 0.304 0.030 0.021 0.012 146 ILE BBB CG2 3222 C CD1 . ILE B 140 ? 0.574 0.821 0.262 0.035 0.003 0.006 146 ILE BBB CD1 3223 N N . ILE B 141 ? 0.697 0.849 0.322 0.035 0.038 0.021 147 ILE BBB N 3224 C CA . ILE B 141 ? 0.761 0.891 0.377 0.030 0.049 0.025 147 ILE BBB CA 3225 C C . ILE B 141 ? 0.779 0.903 0.396 0.021 0.067 0.027 147 ILE BBB C 3226 O O . ILE B 141 ? 0.732 0.859 0.367 0.010 0.077 0.027 147 ILE BBB O 3227 C CB . ILE B 141 ? 0.819 0.916 0.400 0.039 0.044 0.028 147 ILE BBB CB 3228 C CG1 . ILE B 141 ? 0.835 0.944 0.424 0.050 0.027 0.023 147 ILE BBB CG1 3229 C CG2 . ILE B 141 ? 0.852 0.918 0.417 0.031 0.057 0.033 147 ILE BBB CG2 3230 C CD1 . ILE B 141 ? 0.836 0.956 0.446 0.045 0.028 0.020 147 ILE BBB CD1 3231 N N . GLU B 142 ? 0.842 0.959 0.441 0.025 0.071 0.028 148 GLU BBB N 3232 C CA . GLU B 142 ? 0.866 0.980 0.466 0.018 0.091 0.028 148 GLU BBB CA 3233 C C . GLU B 142 ? 0.822 0.972 0.467 0.013 0.092 0.023 148 GLU BBB C 3234 O O . GLU B 142 ? 0.843 1.004 0.514 0.004 0.105 0.021 148 GLU BBB O 3235 C CB . GLU B 142 ? 0.882 0.975 0.445 0.026 0.094 0.029 148 GLU BBB CB 3236 C CG . GLU B 142 ? 0.874 0.964 0.436 0.021 0.118 0.029 148 GLU BBB CG 3237 C CD . GLU B 142 ? 0.897 0.959 0.413 0.030 0.122 0.029 148 GLU BBB CD 3238 O OE1 . GLU B 142 ? 0.868 0.912 0.353 0.040 0.102 0.029 148 GLU BBB OE1 3239 O OE2 . GLU B 142 ? 0.924 0.983 0.436 0.028 0.143 0.027 148 GLU BBB OE2 3240 N N . GLU B 143 ? 0.788 0.954 0.442 0.019 0.077 0.019 149 GLU BBB N 3241 C CA . GLU B 143 ? 0.789 0.982 0.478 0.018 0.072 0.014 149 GLU BBB CA 3242 C C . GLU B 143 ? 0.759 0.967 0.478 0.010 0.072 0.013 149 GLU BBB C 3243 O O . GLU B 143 ? 0.754 0.977 0.501 0.006 0.079 0.009 149 GLU BBB O 3244 C CB . GLU B 143 ? 0.810 1.010 0.496 0.022 0.055 0.013 149 GLU BBB CB 3245 C CG . GLU B 143 ? 0.885 1.076 0.553 0.028 0.053 0.011 149 GLU BBB CG 3246 C CD . GLU B 143 ? 1.004 1.201 0.672 0.028 0.036 0.010 149 GLU BBB CD 3247 O OE1 . GLU B 143 ? 1.073 1.268 0.741 0.030 0.034 0.007 149 GLU BBB OE1 3248 O OE2 . GLU B 143 ? 1.067 1.271 0.736 0.027 0.027 0.011 149 GLU BBB OE2 3249 N N . LEU B 144 ? 0.711 0.913 0.423 0.008 0.064 0.015 150 LEU BBB N 3250 C CA . LEU B 144 ? 0.687 0.896 0.420 0.001 0.060 0.012 150 LEU BBB CA 3251 C C . LEU B 144 ? 0.683 0.887 0.428 -0.009 0.076 0.013 150 LEU BBB C 3252 O O . LEU B 144 ? 0.697 0.919 0.475 -0.016 0.077 0.008 150 LEU BBB O 3253 C CB . LEU B 144 ? 0.692 0.891 0.409 0.004 0.050 0.013 150 LEU BBB CB 3254 C CG . LEU B 144 ? 0.646 0.859 0.364 0.010 0.037 0.011 150 LEU BBB CG 3255 C CD1 . LEU B 144 ? 0.648 0.852 0.350 0.015 0.031 0.011 150 LEU BBB CD1 3256 C CD2 . LEU B 144 ? 0.619 0.847 0.359 0.006 0.030 0.007 150 LEU BBB CD2 3257 N N . ALA B 145 ? 0.690 0.867 0.405 -0.010 0.088 0.018 151 ALA BBB N 3258 C CA . ALA B 145 ? 0.712 0.877 0.430 -0.023 0.108 0.021 151 ALA BBB CA 3259 C C . ALA B 145 ? 0.686 0.878 0.440 -0.028 0.121 0.016 151 ALA BBB C 3260 O O . ALA B 145 ? 0.676 0.880 0.461 -0.041 0.132 0.013 151 ALA BBB O 3261 C CB . ALA B 145 ? 0.756 0.882 0.427 -0.021 0.119 0.028 151 ALA BBB CB 3262 N N . ASP B 146 ? 0.675 0.878 0.426 -0.017 0.120 0.014 152 ASP BBB N 3263 C CA . ASP B 146 ? 0.719 0.946 0.501 -0.017 0.134 0.008 152 ASP BBB CA 3264 C C . ASP B 146 ? 0.681 0.942 0.513 -0.018 0.119 -0.000 152 ASP BBB C 3265 O O . ASP B 146 ? 0.676 0.959 0.549 -0.027 0.130 -0.006 152 ASP BBB O 3266 C CB . ASP B 146 ? 0.768 0.989 0.527 -0.003 0.134 0.007 152 ASP BBB CB 3267 C CG . ASP B 146 ? 0.826 1.065 0.609 -0.000 0.152 0.000 152 ASP BBB CG 3268 O OD1 . ASP B 146 ? 0.840 1.092 0.650 -0.011 0.172 -0.002 152 ASP BBB OD1 3269 O OD2 . ASP B 146 ? 0.857 1.097 0.631 0.012 0.146 -0.003 152 ASP BBB OD2 3270 N N . ALA B 147 ? 0.659 0.923 0.487 -0.009 0.096 -0.001 153 ALA BBB N 3271 C CA . ALA B 147 ? 0.655 0.942 0.516 -0.008 0.077 -0.008 153 ALA BBB CA 3272 C C . ALA B 147 ? 0.628 0.925 0.519 -0.021 0.076 -0.011 153 ALA BBB C 3273 O O . ALA B 147 ? 0.596 0.919 0.530 -0.022 0.069 -0.019 153 ALA BBB O 3274 C CB . ALA B 147 ? 0.681 0.958 0.518 -0.001 0.057 -0.005 153 ALA BBB CB 3275 N N . LEU B 148 ? 0.654 0.929 0.523 -0.030 0.082 -0.006 154 LEU BBB N 3276 C CA . LEU B 148 ? 0.713 0.988 0.603 -0.044 0.079 -0.009 154 LEU BBB CA 3277 C C . LEU B 148 ? 0.789 1.080 0.715 -0.058 0.102 -0.012 154 LEU BBB C 3278 O O . LEU B 148 ? 0.833 1.146 0.804 -0.069 0.096 -0.020 154 LEU BBB O 3279 C CB . LEU B 148 ? 0.743 0.984 0.592 -0.047 0.077 -0.003 154 LEU BBB CB 3280 C CG . LEU B 148 ? 0.741 0.975 0.569 -0.036 0.056 -0.003 154 LEU BBB CG 3281 C CD1 . LEU B 148 ? 0.739 0.941 0.524 -0.032 0.056 0.003 154 LEU BBB CD1 3282 C CD2 . LEU B 148 ? 0.733 0.978 0.584 -0.040 0.037 -0.011 154 LEU BBB CD2 3283 N N . THR B 149 ? 0.806 1.086 0.714 -0.059 0.127 -0.007 155 THR BBB N 3284 C CA . THR B 149 ? 0.793 1.089 0.732 -0.072 0.156 -0.009 155 THR BBB CA 3285 C C . THR B 149 ? 0.762 1.106 0.763 -0.068 0.151 -0.021 155 THR BBB C 3286 O O . THR B 149 ? 0.765 1.136 0.818 -0.082 0.158 -0.029 155 THR BBB O 3287 C CB . THR B 149 ? 0.821 1.092 0.718 -0.069 0.182 -0.002 155 THR BBB CB 3288 O OG1 . THR B 149 ? 0.852 1.077 0.692 -0.071 0.182 0.009 155 THR BBB OG1 3289 C CG2 . THR B 149 ? 0.813 1.099 0.739 -0.083 0.216 -0.004 155 THR BBB CG2 3290 N N . TYR B 150 ? 0.729 1.082 0.724 -0.048 0.138 -0.024 156 TYR BBB N 3291 C CA . TYR B 150 ? 0.711 1.102 0.756 -0.037 0.126 -0.036 156 TYR BBB CA 3292 C C . TYR B 150 ? 0.691 1.102 0.776 -0.043 0.100 -0.043 156 TYR BBB C 3293 O O . TYR B 150 ? 0.692 1.142 0.838 -0.047 0.101 -0.054 156 TYR BBB O 3294 C CB . TYR B 150 ? 0.720 1.101 0.735 -0.016 0.111 -0.034 156 TYR BBB CB 3295 C CG . TYR B 150 ? 0.747 1.158 0.802 -0.001 0.097 -0.045 156 TYR BBB CG 3296 C CD1 . TYR B 150 ? 0.777 1.220 0.879 0.003 0.115 -0.055 156 TYR BBB CD1 3297 C CD2 . TYR B 150 ? 0.748 1.152 0.793 0.011 0.066 -0.046 156 TYR BBB CD2 3298 C CE1 . TYR B 150 ? 0.772 1.242 0.913 0.020 0.100 -0.066 156 TYR BBB CE1 3299 C CE2 . TYR B 150 ? 0.743 1.168 0.819 0.027 0.050 -0.055 156 TYR BBB CE2 3300 C CZ . TYR B 150 ? 0.757 1.215 0.883 0.032 0.065 -0.066 156 TYR BBB CZ 3301 O OH . TYR B 150 ? 0.753 1.230 0.910 0.051 0.047 -0.076 156 TYR BBB OH 3302 N N . CYS B 151 ? 0.666 1.052 0.718 -0.043 0.079 -0.038 157 CYS BBB N 3303 C CA . CYS B 151 ? 0.686 1.081 0.760 -0.046 0.050 -0.045 157 CYS BBB CA 3304 C C . CYS B 151 ? 0.709 1.119 0.827 -0.068 0.057 -0.051 157 CYS BBB C 3305 O O . CYS B 151 ? 0.693 1.131 0.858 -0.070 0.037 -0.063 157 CYS BBB O 3306 C CB . CYS B 151 ? 0.706 1.066 0.728 -0.042 0.031 -0.038 157 CYS BBB CB 3307 S SG . CYS B 151 ? 0.687 1.040 0.678 -0.020 0.011 -0.036 157 CYS BBB SG 3308 N N . HIS B 152 ? 0.774 1.166 0.876 -0.084 0.083 -0.044 158 HIS BBB N 3309 C CA . HIS B 152 ? 0.820 1.218 0.957 -0.109 0.094 -0.048 158 HIS BBB CA 3310 C C . HIS B 152 ? 0.762 1.205 0.964 -0.118 0.117 -0.057 158 HIS BBB C 3311 O O . HIS B 152 ? 0.730 1.203 0.991 -0.134 0.113 -0.067 158 HIS BBB O 3312 C CB . HIS B 152 ? 0.917 1.267 1.002 -0.122 0.110 -0.036 158 HIS BBB CB 3313 C CG . HIS B 152 ? 1.058 1.370 1.087 -0.111 0.088 -0.031 158 HIS BBB CG 3314 N ND1 . HIS B 152 ? 1.138 1.408 1.106 -0.107 0.098 -0.019 158 HIS BBB ND1 3315 C CD2 . HIS B 152 ? 1.214 1.526 1.238 -0.102 0.057 -0.036 158 HIS BBB CD2 3316 C CE1 . HIS B 152 ? 1.204 1.455 1.140 -0.096 0.076 -0.018 158 HIS BBB CE1 3317 N NE2 . HIS B 152 ? 1.230 1.504 1.196 -0.093 0.052 -0.028 158 HIS BBB NE2 3318 N N . ASP B 153 ? 0.766 1.217 0.960 -0.107 0.140 -0.054 159 ASP BBB N 3319 C CA . ASP B 153 ? 0.788 1.285 1.042 -0.110 0.165 -0.063 159 ASP BBB CA 3320 C C . ASP B 153 ? 0.731 1.278 1.055 -0.099 0.137 -0.080 159 ASP BBB C 3321 O O . ASP B 153 ? 0.714 1.305 1.110 -0.114 0.145 -0.092 159 ASP BBB O 3322 C CB . ASP B 153 ? 0.812 1.301 1.034 -0.094 0.190 -0.058 159 ASP BBB CB 3323 C CG . ASP B 153 ? 0.880 1.335 1.058 -0.109 0.229 -0.047 159 ASP BBB CG 3324 O OD1 . ASP B 153 ? 0.908 1.337 1.069 -0.130 0.233 -0.040 159 ASP BBB OD1 3325 O OD2 . ASP B 153 ? 0.950 1.402 1.108 -0.099 0.253 -0.045 159 ASP BBB OD2 3326 N N . LYS B 154 ? 0.710 1.249 1.011 -0.076 0.105 -0.081 160 LYS BBB N 3327 C CA . LYS B 154 ? 0.692 1.269 1.046 -0.060 0.073 -0.095 160 LYS BBB CA 3328 C C . LYS B 154 ? 0.664 1.241 1.036 -0.070 0.039 -0.101 160 LYS BBB C 3329 O O . LYS B 154 ? 0.629 1.234 1.042 -0.057 0.008 -0.114 160 LYS BBB O 3330 C CB . LYS B 154 ? 0.691 1.249 1.002 -0.031 0.056 -0.091 160 LYS BBB CB 3331 C CG . LYS B 154 ? 0.703 1.255 0.991 -0.020 0.085 -0.087 160 LYS BBB CG 3332 C CD . LYS B 154 ? 0.705 1.306 1.059 -0.015 0.107 -0.100 160 LYS BBB CD 3333 C CE . LYS B 154 ? 0.704 1.292 1.025 -0.001 0.135 -0.096 160 LYS BBB CE 3334 N NZ . LYS B 154 ? 0.694 1.323 1.070 -0.005 0.171 -0.107 160 LYS BBB NZ 3335 N N . LYS B 155 ? 0.679 1.224 1.019 -0.090 0.044 -0.093 161 LYS BBB N 3336 C CA . LYS B 155 ? 0.716 1.257 1.072 -0.105 0.017 -0.100 161 LYS BBB CA 3337 C C . LYS B 155 ? 0.718 1.244 1.046 -0.085 -0.026 -0.103 161 LYS BBB C 3338 O O . LYS B 155 ? 0.750 1.301 1.124 -0.083 -0.056 -0.117 161 LYS BBB O 3339 C CB . LYS B 155 ? 0.722 1.315 1.168 -0.124 0.020 -0.116 161 LYS BBB CB 3340 C CG . LYS B 155 ? 0.747 1.343 1.213 -0.153 0.061 -0.112 161 LYS BBB CG 3341 C CD . LYS B 155 ? 0.761 1.410 1.321 -0.176 0.063 -0.128 161 LYS BBB CD 3342 C CE . LYS B 155 ? 0.779 1.415 1.349 -0.194 0.031 -0.135 161 LYS BBB CE 3343 N NZ . LYS B 155 ? 0.784 1.472 1.450 -0.221 0.036 -0.151 161 LYS BBB NZ 3344 N N . VAL B 156 ? 0.708 1.193 0.964 -0.071 -0.029 -0.090 162 VAL BBB N 3345 C CA . VAL B 156 ? 0.678 1.140 0.893 -0.052 -0.063 -0.090 162 VAL BBB CA 3346 C C . VAL B 156 ? 0.690 1.103 0.834 -0.056 -0.064 -0.079 162 VAL BBB C 3347 O O . VAL B 156 ? 0.676 1.070 0.792 -0.064 -0.037 -0.069 162 VAL BBB O 3348 C CB . VAL B 156 ? 0.637 1.103 0.839 -0.028 -0.065 -0.087 162 VAL BBB CB 3349 C CG1 . VAL B 156 ? 0.616 1.132 0.891 -0.021 -0.065 -0.100 162 VAL BBB CG1 3350 C CG2 . VAL B 156 ? 0.609 1.053 0.764 -0.025 -0.036 -0.073 162 VAL BBB CG2 3351 N N . ILE B 157 ? 0.757 1.149 0.872 -0.049 -0.095 -0.082 163 ILE BBB N 3352 C CA . ILE B 157 ? 0.830 1.178 0.878 -0.048 -0.098 -0.074 163 ILE BBB CA 3353 C C . ILE B 157 ? 0.830 1.164 0.834 -0.033 -0.086 -0.062 163 ILE BBB C 3354 O O . ILE B 157 ? 0.927 1.279 0.947 -0.021 -0.089 -0.063 163 ILE BBB O 3355 C CB . ILE B 157 ? 0.907 1.237 0.936 -0.044 -0.133 -0.082 163 ILE BBB CB 3356 C CG1 . ILE B 157 ? 0.989 1.330 1.061 -0.061 -0.147 -0.095 163 ILE BBB CG1 3357 C CG2 . ILE B 157 ? 0.996 1.283 0.953 -0.038 -0.134 -0.074 163 ILE BBB CG2 3358 C CD1 . ILE B 157 ? 1.088 1.418 1.153 -0.055 -0.187 -0.106 163 ILE BBB CD1 3359 N N . HIS B 158 ? 0.787 1.091 0.740 -0.033 -0.074 -0.053 164 HIS BBB N 3360 C CA . HIS B 158 ? 0.803 1.094 0.716 -0.022 -0.064 -0.043 164 HIS BBB CA 3361 C C . HIS B 158 ? 0.854 1.114 0.715 -0.019 -0.070 -0.040 164 HIS BBB C 3362 O O . HIS B 158 ? 0.885 1.131 0.740 -0.027 -0.073 -0.044 164 HIS BBB O 3363 C CB . HIS B 158 ? 0.771 1.067 0.686 -0.025 -0.035 -0.035 164 HIS BBB CB 3364 C CG . HIS B 158 ? 0.763 1.042 0.665 -0.036 -0.022 -0.032 164 HIS BBB CG 3365 N ND1 . HIS B 158 ? 0.751 1.004 0.609 -0.032 -0.019 -0.027 164 HIS BBB ND1 3366 C CD2 . HIS B 158 ? 0.811 1.092 0.737 -0.051 -0.009 -0.034 164 HIS BBB CD2 3367 C CE1 . HIS B 158 ? 0.806 1.043 0.659 -0.041 -0.009 -0.026 164 HIS BBB CE1 3368 N NE2 . HIS B 158 ? 0.803 1.054 0.694 -0.055 -0.002 -0.029 164 HIS BBB NE2 3369 N N . ARG B 159 ? 0.840 1.089 0.665 -0.009 -0.070 -0.033 165 ARG BBB N 3370 C CA . ARG B 159 ? 0.887 1.111 0.665 -0.006 -0.069 -0.030 165 ARG BBB CA 3371 C C . ARG B 159 ? 0.960 1.179 0.731 -0.010 -0.050 -0.027 165 ARG BBB C 3372 O O . ARG B 159 ? 0.979 1.206 0.756 -0.009 -0.034 -0.021 165 ARG BBB O 3373 C CB . ARG B 159 ? 0.882 1.102 0.633 0.002 -0.068 -0.023 165 ARG BBB CB 3374 C CG . ARG B 159 ? 0.928 1.127 0.633 0.005 -0.067 -0.021 165 ARG BBB CG 3375 C CD . ARG B 159 ? 1.011 1.197 0.690 0.010 -0.079 -0.019 165 ARG BBB CD 3376 N NE . ARG B 159 ? 1.163 1.334 0.801 0.010 -0.068 -0.014 165 ARG BBB NE 3377 C CZ . ARG B 159 ? 1.287 1.439 0.889 0.012 -0.073 -0.010 165 ARG BBB CZ 3378 N NH1 . ARG B 159 ? 1.283 1.424 0.881 0.016 -0.093 -0.010 165 ARG BBB NH1 3379 N NH2 . ARG B 159 ? 1.351 1.495 0.922 0.010 -0.058 -0.006 165 ARG BBB NH2 3380 N N . ASP B 160 ? 1.078 1.278 0.832 -0.013 -0.054 -0.031 166 ASP BBB N 3381 C CA . ASP B 160 ? 1.151 1.338 0.893 -0.014 -0.040 -0.029 166 ASP BBB CA 3382 C C . ASP B 160 ? 1.068 1.260 0.792 -0.005 -0.026 -0.022 166 ASP BBB C 3383 O O . ASP B 160 ? 1.022 1.218 0.731 0.001 -0.029 -0.020 166 ASP BBB O 3384 C CB . ASP B 160 ? 1.275 1.437 0.992 -0.013 -0.048 -0.036 166 ASP BBB CB 3385 C CG . ASP B 160 ? 1.449 1.601 1.129 -0.003 -0.052 -0.038 166 ASP BBB CG 3386 O OD1 . ASP B 160 ? 1.547 1.707 1.223 -0.000 -0.058 -0.036 166 ASP BBB OD1 3387 O OD2 . ASP B 160 ? 1.562 1.695 1.216 0.003 -0.048 -0.041 166 ASP BBB OD2 3388 N N . ILE B 161 ? 0.948 1.137 0.674 -0.005 -0.013 -0.017 167 ILE BBB N 3389 C CA . ILE B 161 ? 0.921 1.119 0.638 0.002 -0.002 -0.011 167 ILE BBB CA 3390 C C . ILE B 161 ? 0.922 1.110 0.614 0.012 -0.001 -0.013 167 ILE BBB C 3391 O O . ILE B 161 ? 0.950 1.119 0.632 0.013 -0.002 -0.017 167 ILE BBB O 3392 C CB . ILE B 161 ? 0.861 1.058 0.588 -0.001 0.009 -0.006 167 ILE BBB CB 3393 C CG1 . ILE B 161 ? 0.877 1.050 0.591 -0.002 0.014 -0.005 167 ILE BBB CG1 3394 C CG2 . ILE B 161 ? 0.834 1.045 0.590 -0.009 0.009 -0.007 167 ILE BBB CG2 3395 C CD1 . ILE B 161 ? 0.899 1.065 0.592 0.010 0.018 -0.002 167 ILE BBB CD1 3396 N N . LYS B 162 ? 0.885 1.086 0.570 0.017 0.002 -0.012 168 LYS BBB N 3397 C CA . LYS B 162 ? 0.876 1.079 0.546 0.027 0.006 -0.015 168 LYS BBB CA 3398 C C . LYS B 162 ? 0.832 1.056 0.505 0.026 0.011 -0.011 168 LYS BBB C 3399 O O . LYS B 162 ? 0.927 1.154 0.602 0.020 0.008 -0.008 168 LYS BBB O 3400 C CB . LYS B 162 ? 0.936 1.127 0.586 0.029 0.002 -0.022 168 LYS BBB CB 3401 C CG . LYS B 162 ? 1.022 1.188 0.664 0.028 -0.005 -0.027 168 LYS BBB CG 3402 C CD . LYS B 162 ? 1.014 1.165 0.630 0.035 -0.007 -0.036 168 LYS BBB CD 3403 C CE . LYS B 162 ? 1.003 1.150 0.604 0.031 -0.014 -0.038 168 LYS BBB CE 3404 N NZ . LYS B 162 ? 1.073 1.197 0.666 0.026 -0.030 -0.045 168 LYS BBB NZ 3405 N N . PRO B 163 ? 0.790 1.028 0.465 0.033 0.017 -0.013 169 PRO BBB N 3406 C CA . PRO B 163 ? 0.793 1.050 0.475 0.030 0.021 -0.009 169 PRO BBB CA 3407 C C . PRO B 163 ? 0.784 1.040 0.455 0.021 0.023 -0.008 169 PRO BBB C 3408 O O . PRO B 163 ? 0.712 0.974 0.387 0.014 0.022 -0.002 169 PRO BBB O 3409 C CB . PRO B 163 ? 0.824 1.099 0.512 0.039 0.027 -0.015 169 PRO BBB CB 3410 C CG . PRO B 163 ? 0.844 1.102 0.527 0.051 0.023 -0.019 169 PRO BBB CG 3411 C CD . PRO B 163 ? 0.816 1.050 0.486 0.045 0.019 -0.018 169 PRO BBB CD 3412 N N . GLU B 164 ? 0.861 1.106 0.513 0.022 0.023 -0.012 170 GLU BBB N 3413 C CA . GLU B 164 ? 0.907 1.142 0.536 0.016 0.023 -0.010 170 GLU BBB CA 3414 C C . GLU B 164 ? 0.898 1.120 0.527 0.010 0.010 -0.005 170 GLU BBB C 3415 O O . GLU B 164 ? 0.870 1.085 0.486 0.004 0.009 0.000 170 GLU BBB O 3416 C CB . GLU B 164 ? 0.924 1.141 0.527 0.021 0.022 -0.016 170 GLU BBB CB 3417 C CG . GLU B 164 ? 0.961 1.189 0.562 0.030 0.036 -0.024 170 GLU BBB CG 3418 C CD . GLU B 164 ? 0.954 1.175 0.564 0.041 0.031 -0.030 170 GLU BBB CD 3419 O OE1 . GLU B 164 ? 0.945 1.153 0.536 0.049 0.033 -0.038 170 GLU BBB OE1 3420 O OE2 . GLU B 164 ? 0.957 1.183 0.588 0.041 0.026 -0.027 170 GLU BBB OE2 3421 N N . ASN B 165 ? 0.835 1.053 0.480 0.012 0.001 -0.006 171 ASN BBB N 3422 C CA . ASN B 165 ? 0.817 1.028 0.471 0.009 -0.012 -0.005 171 ASN BBB CA 3423 C C . ASN B 165 ? 0.773 0.995 0.447 0.007 -0.010 0.000 171 ASN BBB C 3424 O O . ASN B 165 ? 0.766 0.987 0.454 0.007 -0.019 0.000 171 ASN BBB O 3425 C CB . ASN B 165 ? 0.865 1.069 0.529 0.010 -0.020 -0.010 171 ASN BBB CB 3426 C CG . ASN B 165 ? 0.877 1.063 0.517 0.011 -0.028 -0.017 171 ASN BBB CG 3427 O OD1 . ASN B 165 ? 0.802 0.977 0.419 0.011 -0.035 -0.016 171 ASN BBB OD1 3428 N ND2 . ASN B 165 ? 0.890 1.068 0.531 0.013 -0.029 -0.023 171 ASN BBB ND2 3429 N N . LEU B 166 ? 0.741 0.975 0.420 0.007 -0.000 0.003 172 LEU BBB N 3430 C CA . LEU B 166 ? 0.686 0.927 0.380 0.007 0.002 0.006 172 LEU BBB CA 3431 C C . LEU B 166 ? 0.669 0.913 0.354 0.002 0.004 0.010 172 LEU BBB C 3432 O O . LEU B 166 ? 0.678 0.929 0.357 -0.000 0.011 0.009 172 LEU BBB O 3433 C CB . LEU B 166 ? 0.673 0.921 0.376 0.011 0.008 0.005 172 LEU BBB CB 3434 C CG . LEU B 166 ? 0.707 0.947 0.415 0.012 0.008 0.003 172 LEU BBB CG 3435 C CD1 . LEU B 166 ? 0.708 0.945 0.414 0.017 0.013 0.003 172 LEU BBB CD1 3436 C CD2 . LEU B 166 ? 0.741 0.980 0.464 0.009 0.005 0.003 172 LEU BBB CD2 3437 N N . LEU B 167 ? 0.629 0.866 0.316 0.000 -0.001 0.013 173 LEU BBB N 3438 C CA . LEU B 167 ? 0.619 0.852 0.297 -0.006 0.000 0.017 173 LEU BBB CA 3439 C C . LEU B 167 ? 0.605 0.844 0.295 -0.005 0.001 0.016 173 LEU BBB C 3440 O O . LEU B 167 ? 0.580 0.823 0.281 0.002 0.002 0.014 173 LEU BBB O 3441 C CB . LEU B 167 ? 0.636 0.848 0.299 -0.007 -0.009 0.020 173 LEU BBB CB 3442 C CG . LEU B 167 ? 0.675 0.873 0.314 -0.009 -0.012 0.021 173 LEU BBB CG 3443 C CD1 . LEU B 167 ? 0.687 0.865 0.316 -0.004 -0.028 0.022 173 LEU BBB CD1 3444 C CD2 . LEU B 167 ? 0.695 0.888 0.313 -0.020 -0.003 0.026 173 LEU BBB CD2 3445 N N . LEU B 168 ? 0.601 0.836 0.286 -0.011 0.001 0.018 174 LEU BBB N 3446 C CA . LEU B 168 ? 0.599 0.837 0.290 -0.011 0.000 0.016 174 LEU BBB CA 3447 C C . LEU B 168 ? 0.615 0.833 0.295 -0.014 -0.006 0.018 174 LEU BBB C 3448 O O . LEU B 168 ? 0.600 0.807 0.268 -0.024 -0.007 0.022 174 LEU BBB O 3449 C CB . LEU B 168 ? 0.615 0.870 0.313 -0.017 0.003 0.015 174 LEU BBB CB 3450 C CG . LEU B 168 ? 0.600 0.873 0.309 -0.010 0.008 0.011 174 LEU BBB CG 3451 C CD1 . LEU B 168 ? 0.597 0.894 0.320 -0.015 0.010 0.008 174 LEU BBB CD1 3452 C CD2 . LEU B 168 ? 0.574 0.843 0.284 0.001 0.005 0.010 174 LEU BBB CD2 3453 N N . GLY B 169 ? 0.655 0.865 0.336 -0.007 -0.008 0.016 175 GLY BBB N 3454 C CA . GLY B 169 ? 0.727 0.915 0.396 -0.007 -0.015 0.015 175 GLY BBB CA 3455 C C . GLY B 169 ? 0.729 0.913 0.392 -0.017 -0.018 0.014 175 GLY BBB C 3456 O O . GLY B 169 ? 0.680 0.883 0.352 -0.024 -0.015 0.014 175 GLY BBB O 3457 N N . PHE B 170 ? 0.767 0.926 0.416 -0.017 -0.024 0.013 176 PHE BBB N 3458 C CA . PHE B 170 ? 0.822 0.971 0.464 -0.030 -0.031 0.011 176 PHE BBB CA 3459 C C . PHE B 170 ? 0.816 0.981 0.465 -0.027 -0.032 0.006 176 PHE BBB C 3460 O O . PHE B 170 ? 0.852 1.026 0.509 -0.040 -0.037 0.004 176 PHE BBB O 3461 C CB . PHE B 170 ? 0.839 0.951 0.460 -0.027 -0.039 0.009 176 PHE BBB CB 3462 C CG . PHE B 170 ? 0.848 0.947 0.460 -0.040 -0.047 0.006 176 PHE BBB CG 3463 C CD1 . PHE B 170 ? 0.846 0.945 0.462 -0.062 -0.048 0.010 176 PHE BBB CD1 3464 C CD2 . PHE B 170 ? 0.903 0.988 0.504 -0.032 -0.054 -0.002 176 PHE BBB CD2 3465 C CE1 . PHE B 170 ? 0.865 0.954 0.478 -0.076 -0.057 0.005 176 PHE BBB CE1 3466 C CE2 . PHE B 170 ? 0.893 0.964 0.487 -0.045 -0.065 -0.006 176 PHE BBB CE2 3467 C CZ . PHE B 170 ? 0.887 0.962 0.490 -0.068 -0.067 -0.003 176 PHE BBB CZ 3468 N N . ARG B 171 ? 0.807 0.975 0.455 -0.012 -0.029 0.003 177 ARG BBB N 3469 C CA . ARG B 171 ? 0.843 1.020 0.491 -0.007 -0.031 -0.001 177 ARG BBB CA 3470 C C . ARG B 171 ? 0.771 0.970 0.431 -0.001 -0.023 0.001 177 ARG BBB C 3471 O O . ARG B 171 ? 0.790 0.985 0.441 0.008 -0.022 -0.001 177 ARG BBB O 3472 C CB . ARG B 171 ? 0.908 1.060 0.532 0.004 -0.032 -0.006 177 ARG BBB CB 3473 C CG . ARG B 171 ? 0.984 1.110 0.590 -0.001 -0.043 -0.010 177 ARG BBB CG 3474 C CD . ARG B 171 ? 1.076 1.174 0.659 0.013 -0.039 -0.014 177 ARG BBB CD 3475 N NE . ARG B 171 ? 1.283 1.371 0.844 0.023 -0.038 -0.019 177 ARG BBB NE 3476 C CZ . ARG B 171 ? 1.413 1.486 0.956 0.037 -0.025 -0.022 177 ARG BBB CZ 3477 N NH1 . ARG B 171 ? 1.446 1.520 0.999 0.044 -0.014 -0.021 177 ARG BBB NH1 3478 N NH2 . ARG B 171 ? 1.499 1.557 1.014 0.044 -0.025 -0.025 177 ARG BBB NH2 3479 N N . GLY B 172 ? 0.733 0.948 0.408 -0.007 -0.018 0.005 178 GLY BBB N 3480 C CA . GLY B 172 ? 0.713 0.948 0.401 -0.003 -0.013 0.006 178 GLY BBB CA 3481 C C . GLY B 172 ? 0.684 0.912 0.367 0.008 -0.005 0.007 178 GLY BBB C 3482 O O . GLY B 172 ? 0.711 0.945 0.395 0.013 -0.003 0.007 178 GLY BBB O 3483 N N . GLU B 173 ? 0.675 0.889 0.352 0.010 -0.003 0.008 179 GLU BBB N 3484 C CA . GLU B 173 ? 0.687 0.900 0.369 0.017 0.006 0.008 179 GLU BBB CA 3485 C C . GLU B 173 ? 0.698 0.923 0.394 0.014 0.007 0.010 179 GLU BBB C 3486 O O . GLU B 173 ? 0.675 0.901 0.372 0.009 0.002 0.012 179 GLU BBB O 3487 C CB . GLU B 173 ? 0.712 0.914 0.394 0.021 0.008 0.006 179 GLU BBB CB 3488 C CG . GLU B 173 ? 0.772 0.957 0.435 0.025 0.007 0.003 179 GLU BBB CG 3489 C CD . GLU B 173 ? 0.799 0.969 0.452 0.021 -0.004 0.001 179 GLU BBB CD 3490 O OE1 . GLU B 173 ? 0.787 0.963 0.446 0.012 -0.010 0.005 179 GLU BBB OE1 3491 O OE2 . GLU B 173 ? 0.816 0.967 0.453 0.027 -0.005 -0.003 179 GLU BBB OE2 3492 N N . VAL B 174 ? 0.688 0.919 0.389 0.016 0.013 0.011 180 VAL BBB N 3493 C CA . VAL B 174 ? 0.657 0.896 0.368 0.014 0.013 0.011 180 VAL BBB CA 3494 C C . VAL B 174 ? 0.681 0.919 0.403 0.014 0.010 0.010 180 VAL BBB C 3495 O O . VAL B 174 ? 0.665 0.902 0.394 0.017 0.015 0.008 180 VAL BBB O 3496 C CB . VAL B 174 ? 0.646 0.885 0.357 0.016 0.018 0.011 180 VAL BBB CB 3497 C CG1 . VAL B 174 ? 0.668 0.900 0.385 0.016 0.027 0.011 180 VAL BBB CG1 3498 C CG2 . VAL B 174 ? 0.621 0.864 0.335 0.014 0.016 0.010 180 VAL BBB CG2 3499 N N . LYS B 175 ? 0.685 0.925 0.407 0.011 0.004 0.010 181 LYS BBB N 3500 C CA . LYS B 175 ? 0.708 0.946 0.439 0.013 -0.004 0.009 181 LYS BBB CA 3501 C C . LYS B 175 ? 0.714 0.954 0.447 0.011 -0.008 0.007 181 LYS BBB C 3502 O O . LYS B 175 ? 0.742 0.978 0.458 0.008 -0.010 0.009 181 LYS BBB O 3503 C CB . LYS B 175 ? 0.752 0.977 0.469 0.013 -0.013 0.011 181 LYS BBB CB 3504 C CG . LYS B 175 ? 0.786 1.002 0.493 0.013 -0.011 0.012 181 LYS BBB CG 3505 C CD . LYS B 175 ? 0.791 1.002 0.508 0.021 -0.013 0.009 181 LYS BBB CD 3506 C CE . LYS B 175 ? 0.733 0.937 0.441 0.023 -0.008 0.008 181 LYS BBB CE 3507 N NZ . LYS B 175 ? 0.714 0.910 0.427 0.033 -0.009 0.003 181 LYS BBB NZ 3508 N N . ILE B 176 ? 0.686 0.933 0.440 0.012 -0.008 0.003 182 ILE BBB N 3509 C CA . ILE B 176 ? 0.662 0.909 0.419 0.010 -0.017 -0.000 182 ILE BBB CA 3510 C C . ILE B 176 ? 0.698 0.936 0.446 0.013 -0.033 -0.001 182 ILE BBB C 3511 O O . ILE B 176 ? 0.755 0.996 0.516 0.018 -0.038 -0.002 182 ILE BBB O 3512 C CB . ILE B 176 ? 0.644 0.901 0.430 0.007 -0.013 -0.005 182 ILE BBB CB 3513 C CG1 . ILE B 176 ? 0.625 0.880 0.409 0.003 0.003 -0.003 182 ILE BBB CG1 3514 C CG2 . ILE B 176 ? 0.669 0.924 0.462 0.004 -0.027 -0.011 182 ILE BBB CG2 3515 C CD1 . ILE B 176 ? 0.606 0.869 0.417 -0.002 0.012 -0.006 182 ILE BBB CD1 3516 N N . ALA B 177 ? 0.665 0.890 0.388 0.011 -0.039 -0.000 183 ALA BBB N 3517 C CA . ALA B 177 ? 0.690 0.897 0.388 0.014 -0.052 0.003 183 ALA BBB CA 3518 C C . ALA B 177 ? 0.724 0.930 0.437 0.020 -0.071 -0.002 183 ALA BBB C 3519 O O . ALA B 177 ? 0.775 0.964 0.472 0.026 -0.083 0.000 183 ALA BBB O 3520 C CB . ALA B 177 ? 0.722 0.914 0.385 0.010 -0.051 0.004 183 ALA BBB CB 3521 N N . ASP B 178 ? 0.707 0.928 0.451 0.020 -0.076 -0.010 184 ASP BBB N 3522 C CA . ASP B 178 ? 0.713 0.942 0.485 0.027 -0.096 -0.018 184 ASP BBB CA 3523 C C . ASP B 178 ? 0.701 0.951 0.511 0.021 -0.095 -0.025 184 ASP BBB C 3524 O O . ASP B 178 ? 0.697 0.949 0.504 0.012 -0.078 -0.024 184 ASP BBB O 3525 C CB . ASP B 178 ? 0.766 0.969 0.504 0.032 -0.120 -0.018 184 ASP BBB CB 3526 C CG . ASP B 178 ? 0.808 0.992 0.510 0.026 -0.120 -0.017 184 ASP BBB CG 3527 O OD1 . ASP B 178 ? 0.786 0.982 0.506 0.021 -0.117 -0.023 184 ASP BBB OD1 3528 O OD2 . ASP B 178 ? 0.864 1.020 0.518 0.027 -0.121 -0.011 184 ASP BBB OD2 3529 N N . PHE B 179 ? 0.719 0.982 0.562 0.024 -0.113 -0.035 185 PHE BBB N 3530 C CA . PHE B 179 ? 0.742 1.026 0.627 0.015 -0.115 -0.044 185 PHE BBB CA 3531 C C . PHE B 179 ? 0.799 1.062 0.660 0.011 -0.132 -0.048 185 PHE BBB C 3532 O O . PHE B 179 ? 0.782 1.059 0.677 0.005 -0.146 -0.058 185 PHE BBB O 3533 C CB . PHE B 179 ? 0.727 1.042 0.669 0.021 -0.125 -0.053 185 PHE BBB CB 3534 C CG . PHE B 179 ? 0.716 1.050 0.682 0.025 -0.104 -0.051 185 PHE BBB CG 3535 C CD1 . PHE B 179 ? 0.674 1.029 0.670 0.014 -0.077 -0.051 185 PHE BBB CD1 3536 C CD2 . PHE B 179 ? 0.734 1.061 0.687 0.039 -0.109 -0.049 185 PHE BBB CD2 3537 C CE1 . PHE B 179 ? 0.651 1.020 0.663 0.018 -0.057 -0.050 185 PHE BBB CE1 3538 C CE2 . PHE B 179 ? 0.697 1.038 0.669 0.044 -0.090 -0.048 185 PHE BBB CE2 3539 C CZ . PHE B 179 ? 0.658 1.021 0.658 0.034 -0.064 -0.049 185 PHE BBB CZ 3540 N N . GLY B 180 ? 0.851 1.085 0.656 0.013 -0.131 -0.041 186 GLY BBB N 3541 C CA . GLY B 180 ? 0.931 1.141 0.702 0.009 -0.139 -0.044 186 GLY BBB CA 3542 C C . GLY B 180 ? 0.990 1.191 0.762 0.011 -0.171 -0.055 186 GLY BBB C 3543 O O . GLY B 180 ? 1.087 1.290 0.876 0.003 -0.177 -0.063 186 GLY BBB O 3544 N N . TRP B 181 ? 1.023 1.210 0.774 0.023 -0.192 -0.054 187 TRP BBB N 3545 C CA . TRP B 181 ? 1.037 1.208 0.778 0.029 -0.228 -0.064 187 TRP BBB CA 3546 C C . TRP B 181 ? 1.046 1.172 0.715 0.030 -0.234 -0.063 187 TRP BBB C 3547 O O . TRP B 181 ? 1.033 1.146 0.695 0.029 -0.258 -0.073 187 TRP BBB O 3548 C CB . TRP B 181 ? 1.032 1.202 0.779 0.043 -0.250 -0.064 187 TRP BBB CB 3549 C CG . TRP B 181 ? 1.017 1.155 0.706 0.051 -0.243 -0.051 187 TRP BBB CG 3550 C CD1 . TRP B 181 ? 0.964 1.109 0.653 0.050 -0.217 -0.040 187 TRP BBB CD1 3551 C CD2 . TRP B 181 ? 1.048 1.137 0.666 0.059 -0.262 -0.047 187 TRP BBB CD2 3552 N NE1 . TRP B 181 ? 0.991 1.097 0.619 0.055 -0.218 -0.030 187 TRP BBB NE1 3553 C CE2 . TRP B 181 ? 1.028 1.100 0.611 0.060 -0.244 -0.033 187 TRP BBB CE2 3554 C CE3 . TRP B 181 ? 1.130 1.187 0.709 0.064 -0.292 -0.053 187 TRP BBB CE3 3555 C CZ2 . TRP B 181 ? 1.100 1.121 0.608 0.064 -0.252 -0.025 187 TRP BBB CZ2 3556 C CZ3 . TRP B 181 ? 1.180 1.185 0.681 0.071 -0.301 -0.045 187 TRP BBB CZ3 3557 C CH2 . TRP B 181 ? 1.182 1.170 0.648 0.070 -0.280 -0.030 187 TRP BBB CH2 3558 N N . SER B 182 ? 1.077 1.184 0.698 0.030 -0.211 -0.051 188 SER BBB N 3559 C CA . SER B 182 ? 1.131 1.198 0.682 0.031 -0.208 -0.049 188 SER BBB CA 3560 C C . SER B 182 ? 1.123 1.195 0.675 0.023 -0.187 -0.053 188 SER BBB C 3561 O O . SER B 182 ? 1.109 1.153 0.608 0.025 -0.179 -0.052 188 SER BBB O 3562 C CB . SER B 182 ? 1.188 1.235 0.692 0.034 -0.192 -0.036 188 SER BBB CB 3563 O OG . SER B 182 ? 1.269 1.314 0.779 0.041 -0.206 -0.032 188 SER BBB OG 3564 N N . VAL B 183 ? 1.184 1.287 0.792 0.016 -0.176 -0.055 189 VAL BBB N 3565 C CA . VAL B 183 ? 1.276 1.380 0.888 0.009 -0.160 -0.059 189 VAL BBB CA 3566 C C . VAL B 183 ? 1.383 1.462 0.978 0.008 -0.184 -0.072 189 VAL BBB C 3567 O O . VAL B 183 ? 1.396 1.486 1.027 0.004 -0.208 -0.080 189 VAL BBB O 3568 C CB . VAL B 183 ? 1.339 1.475 1.009 0.001 -0.145 -0.058 189 VAL BBB CB 3569 C CG1 . VAL B 183 ? 1.350 1.480 1.030 -0.008 -0.142 -0.065 189 VAL BBB CG1 3570 C CG2 . VAL B 183 ? 1.356 1.507 1.027 0.003 -0.118 -0.046 189 VAL BBB CG2 3571 N N . HIS B 184 ? 1.472 1.522 1.018 0.011 -0.177 -0.075 190 HIS BBB N 3572 C CA . HIS B 184 ? 1.561 1.580 1.080 0.010 -0.198 -0.089 190 HIS BBB CA 3573 C C . HIS B 184 ? 1.520 1.541 1.064 0.002 -0.187 -0.094 190 HIS BBB C 3574 O O . HIS B 184 ? 1.593 1.625 1.140 0.003 -0.159 -0.087 190 HIS BBB O 3575 C CB . HIS B 184 ? 1.732 1.712 1.175 0.020 -0.198 -0.090 190 HIS BBB CB 3576 C CG . HIS B 184 ? 1.838 1.801 1.249 0.027 -0.217 -0.086 190 HIS BBB CG 3577 N ND1 . HIS B 184 ? 1.776 1.725 1.186 0.028 -0.255 -0.096 190 HIS BBB ND1 3578 C CD2 . HIS B 184 ? 1.858 1.814 1.234 0.032 -0.205 -0.075 190 HIS BBB CD2 3579 C CE1 . HIS B 184 ? 1.846 1.777 1.219 0.036 -0.267 -0.089 190 HIS BBB CE1 3580 N NE2 . HIS B 184 ? 1.867 1.800 1.218 0.038 -0.236 -0.076 190 HIS BBB NE2 3581 N N . THR B 185 ? 1.536 1.548 1.097 -0.007 -0.210 -0.106 191 THR BBB N 3582 C CA . THR B 185 ? 1.533 1.537 1.112 -0.017 -0.204 -0.112 191 THR BBB CA 3583 C C . THR B 185 ? 1.501 1.480 1.033 -0.007 -0.182 -0.110 191 THR BBB C 3584 O O . THR B 185 ? 1.490 1.433 0.968 0.001 -0.189 -0.119 191 THR BBB O 3585 C CB . THR B 185 ? 1.628 1.608 1.208 -0.026 -0.237 -0.128 191 THR BBB CB 3586 O OG1 . THR B 185 ? 1.782 1.727 1.297 -0.013 -0.255 -0.135 191 THR BBB OG1 3587 C CG2 . THR B 185 ? 1.606 1.619 1.249 -0.038 -0.260 -0.133 191 THR BBB CG2 3588 N N . PRO B 186 ? 1.483 1.479 1.032 -0.007 -0.154 -0.101 192 PRO BBB N 3589 C CA . PRO B 186 ? 1.452 1.432 0.961 0.007 -0.132 -0.099 192 PRO BBB CA 3590 C C . PRO B 186 ? 1.402 1.340 0.875 0.011 -0.139 -0.113 192 PRO BBB C 3591 O O . PRO B 186 ? 1.437 1.362 0.930 -0.001 -0.147 -0.117 192 PRO BBB O 3592 C CB . PRO B 186 ? 1.449 1.454 0.992 0.005 -0.109 -0.089 192 PRO BBB CB 3593 C CG . PRO B 186 ? 1.452 1.489 1.045 -0.007 -0.114 -0.082 192 PRO BBB CG 3594 C CD . PRO B 186 ? 1.439 1.467 1.043 -0.017 -0.142 -0.092 192 PRO BBB CD 3595 N N . SER B 187 ? 1.287 1.202 0.706 0.025 -0.135 -0.118 193 SER BBB N 3596 C CA . SER B 187 ? 1.260 1.130 0.633 0.034 -0.139 -0.132 193 SER BBB CA 3597 C C . SER B 187 ? 1.245 1.116 0.619 0.046 -0.114 -0.130 193 SER BBB C 3598 O O . SER B 187 ? 1.266 1.170 0.657 0.052 -0.093 -0.120 193 SER BBB O 3599 C CB . SER B 187 ? 1.266 1.113 0.579 0.047 -0.142 -0.139 193 SER BBB CB 3600 O OG . SER B 187 ? 1.285 1.089 0.549 0.059 -0.140 -0.153 193 SER BBB OG 3601 N N . LEU B 188 ? 1.242 1.075 0.598 0.049 -0.120 -0.141 194 LEU BBB N 3602 C CA . LEU B 188 ? 1.228 1.052 0.576 0.065 -0.101 -0.142 194 LEU BBB CA 3603 C C . LEU B 188 ? 1.246 1.077 0.559 0.087 -0.082 -0.146 194 LEU BBB C 3604 O O . LEU B 188 ? 1.247 1.108 0.578 0.097 -0.061 -0.140 194 LEU BBB O 3605 C CB . LEU B 188 ? 1.298 1.068 0.624 0.064 -0.115 -0.154 194 LEU BBB CB 3606 C CG . LEU B 188 ? 1.362 1.118 0.691 0.075 -0.103 -0.152 194 LEU BBB CG 3607 C CD1 . LEU B 188 ? 1.416 1.118 0.732 0.065 -0.120 -0.161 194 LEU BBB CD1 3608 C CD2 . LEU B 188 ? 1.415 1.170 0.713 0.104 -0.085 -0.160 194 LEU BBB CD2 3609 N N . ALA B 189 ? 1.312 1.116 0.576 0.092 -0.089 -0.157 195 ALA BBB N 3610 C CA . ALA B 189 ? 1.370 1.177 0.594 0.111 -0.068 -0.163 195 ALA BBB CA 3611 C C . ALA B 189 ? 1.352 1.209 0.600 0.109 -0.048 -0.149 195 ALA BBB C 3612 O O . ALA B 189 ? 1.315 1.194 0.562 0.123 -0.022 -0.149 195 ALA BBB O 3613 C CB . ALA B 189 ? 1.409 1.172 0.573 0.114 -0.083 -0.176 195 ALA BBB CB 3614 N N . ALA B 190 ? 1.345 1.219 0.614 0.091 -0.061 -0.138 196 ALA BBB N 3615 C CA . ALA B 190 ? 1.321 1.235 0.608 0.086 -0.046 -0.124 196 ALA BBB CA 3616 C C . ALA B 190 ? 1.261 1.216 0.598 0.089 -0.027 -0.115 196 ALA BBB C 3617 O O . ALA B 190 ? 1.215 1.198 0.554 0.095 -0.004 -0.111 196 ALA BBB O 3618 C CB . ALA B 190 ? 1.326 1.243 0.627 0.070 -0.068 -0.116 196 ALA BBB CB 3619 N N . ALA B 191 ? 1.281 1.238 0.653 0.082 -0.038 -0.112 197 ALA BBB N 3620 C CA . ALA B 191 ? 1.250 1.238 0.666 0.084 -0.026 -0.103 197 ALA BBB CA 3621 C C . ALA B 191 ? 1.262 1.254 0.669 0.105 -0.008 -0.111 197 ALA BBB C 3622 O O . ALA B 191 ? 1.270 1.298 0.705 0.110 0.007 -0.105 197 ALA BBB O 3623 C CB . ALA B 191 ? 1.230 1.205 0.671 0.073 -0.040 -0.100 197 ALA BBB CB 3624 N N . THR B 192 ? 1.334 1.289 0.706 0.117 -0.011 -0.125 198 THR BBB N 3625 C CA . THR B 192 ? 1.391 1.345 0.751 0.142 0.005 -0.136 198 THR BBB CA 3626 C C . THR B 192 ? 1.419 1.412 0.779 0.148 0.029 -0.135 198 THR BBB C 3627 O O . THR B 192 ? 1.515 1.545 0.907 0.158 0.045 -0.134 198 THR BBB O 3628 C CB . THR B 192 ? 1.407 1.308 0.720 0.153 -0.004 -0.152 198 THR BBB CB 3629 O OG1 . THR B 192 ? 1.360 1.228 0.681 0.145 -0.024 -0.151 198 THR BBB OG1 3630 C CG2 . THR B 192 ? 1.423 1.324 0.721 0.181 0.013 -0.166 198 THR BBB CG2 3631 N N . MET B 193 ? 1.349 1.334 0.676 0.140 0.032 -0.136 199 MET BBB N 3632 C CA . MET B 193 ? 1.346 1.359 0.664 0.141 0.058 -0.135 199 MET BBB CA 3633 C C . MET B 193 ? 1.262 1.321 0.624 0.127 0.065 -0.119 199 MET BBB C 3634 O O . MET B 193 ? 1.228 1.326 0.612 0.132 0.088 -0.119 199 MET BBB O 3635 C CB . MET B 193 ? 1.452 1.431 0.712 0.135 0.055 -0.137 199 MET BBB CB 3636 C CG . MET B 193 ? 1.538 1.469 0.745 0.150 0.050 -0.155 199 MET BBB CG 3637 S SD . MET B 193 ? 1.683 1.586 0.815 0.152 0.065 -0.161 199 MET BBB SD 3638 C CE . MET B 193 ? 1.681 1.586 0.813 0.126 0.049 -0.142 199 MET BBB CE 3639 N N . CYS B 194 ? 1.234 1.290 0.611 0.110 0.046 -0.107 200 CYS BBB N 3640 C CA . CYS B 194 ? 1.273 1.365 0.688 0.096 0.049 -0.092 200 CYS BBB CA 3641 C C . CYS B 194 ? 1.130 1.257 0.593 0.103 0.056 -0.091 200 CYS BBB C 3642 O O . CYS B 194 ? 1.056 1.217 0.548 0.095 0.064 -0.081 200 CYS BBB O 3643 C CB . CYS B 194 ? 1.371 1.451 0.795 0.080 0.026 -0.083 200 CYS BBB CB 3644 S SG . CYS B 194 ? 1.588 1.645 0.969 0.069 0.017 -0.078 200 CYS BBB SG 3645 N N . GLY B 195 ? 1.087 1.200 0.553 0.118 0.051 -0.099 201 GLY BBB N 3646 C CA . GLY B 195 ? 1.051 1.186 0.555 0.128 0.052 -0.098 201 GLY BBB CA 3647 C C . GLY B 195 ? 1.037 1.169 0.563 0.115 0.036 -0.086 201 GLY BBB C 3648 O O . GLY B 195 ? 1.023 1.182 0.581 0.116 0.038 -0.080 201 GLY BBB O 3649 N N . THR B 196 ? 1.118 1.219 0.628 0.103 0.021 -0.084 202 THR BBB N 3650 C CA . THR B 196 ? 1.116 1.215 0.646 0.086 0.008 -0.073 202 THR BBB CA 3651 C C . THR B 196 ? 1.151 1.213 0.674 0.086 -0.005 -0.076 202 THR BBB C 3652 O O . THR B 196 ? 1.122 1.178 0.660 0.070 -0.014 -0.069 202 THR BBB O 3653 C CB . THR B 196 ? 1.116 1.217 0.639 0.071 0.003 -0.068 202 THR BBB CB 3654 O OG1 . THR B 196 ? 1.073 1.207 0.619 0.065 0.011 -0.058 202 THR BBB OG1 3655 C CG2 . THR B 196 ? 1.130 1.210 0.658 0.057 -0.016 -0.067 202 THR BBB CG2 3656 N N . LEU B 197 ? 1.138 1.176 0.641 0.102 -0.004 -0.086 203 LEU BBB N 3657 C CA . LEU B 197 ? 1.125 1.117 0.612 0.102 -0.016 -0.091 203 LEU BBB CA 3658 C C . LEU B 197 ? 1.055 1.045 0.563 0.097 -0.018 -0.080 203 LEU BBB C 3659 O O . LEU B 197 ? 1.011 0.968 0.514 0.085 -0.027 -0.078 203 LEU BBB O 3660 C CB . LEU B 197 ? 1.159 1.127 0.617 0.125 -0.014 -0.105 203 LEU BBB CB 3661 C CG . LEU B 197 ? 1.241 1.153 0.670 0.124 -0.028 -0.113 203 LEU BBB CG 3662 C CD1 . LEU B 197 ? 1.275 1.171 0.689 0.106 -0.040 -0.117 203 LEU BBB CD1 3663 C CD2 . LEU B 197 ? 1.305 1.195 0.705 0.151 -0.024 -0.128 203 LEU BBB CD2 3664 N N . ASP B 198 ? 1.027 1.050 0.555 0.105 -0.009 -0.074 204 ASP BBB N 3665 C CA . ASP B 198 ? 1.051 1.070 0.591 0.105 -0.010 -0.064 204 ASP BBB CA 3666 C C . ASP B 198 ? 0.982 0.999 0.535 0.081 -0.012 -0.054 204 ASP BBB C 3667 O O . ASP B 198 ? 0.945 0.935 0.493 0.075 -0.014 -0.048 204 ASP BBB O 3668 C CB . ASP B 198 ? 1.089 1.149 0.649 0.117 -0.003 -0.061 204 ASP BBB CB 3669 C CG . ASP B 198 ? 1.228 1.300 0.786 0.142 0.002 -0.073 204 ASP BBB CG 3670 O OD1 . ASP B 198 ? 1.379 1.427 0.925 0.160 -0.004 -0.077 204 ASP BBB OD1 3671 O OD2 . ASP B 198 ? 1.259 1.361 0.824 0.143 0.011 -0.079 204 ASP BBB OD2 3672 N N . TYR B 199 ? 0.928 0.971 0.497 0.067 -0.012 -0.052 205 TYR BBB N 3673 C CA . TYR B 199 ? 0.907 0.958 0.497 0.046 -0.013 -0.044 205 TYR BBB CA 3674 C C . TYR B 199 ? 0.947 0.972 0.533 0.032 -0.023 -0.049 205 TYR BBB C 3675 O O . TYR B 199 ? 0.930 0.969 0.539 0.016 -0.027 -0.046 205 TYR BBB O 3676 C CB . TYR B 199 ? 0.874 0.964 0.481 0.043 -0.010 -0.040 205 TYR BBB CB 3677 C CG . TYR B 199 ? 0.858 0.975 0.474 0.051 -0.001 -0.035 205 TYR BBB CG 3678 C CD1 . TYR B 199 ? 0.844 0.972 0.477 0.045 0.002 -0.026 205 TYR BBB CD1 3679 C CD2 . TYR B 199 ? 0.850 0.983 0.461 0.065 0.004 -0.040 205 TYR BBB CD2 3680 C CE1 . TYR B 199 ? 0.858 1.009 0.499 0.052 0.007 -0.022 205 TYR BBB CE1 3681 C CE2 . TYR B 199 ? 0.839 1.000 0.465 0.071 0.010 -0.036 205 TYR BBB CE2 3682 C CZ . TYR B 199 ? 0.877 1.045 0.517 0.065 0.010 -0.028 205 TYR BBB CZ 3683 O OH . TYR B 199 ? 0.898 1.091 0.551 0.070 0.013 -0.025 205 TYR BBB OH 3684 N N . LEU B 200 ? 0.984 0.970 0.545 0.038 -0.029 -0.056 206 LEU BBB N 3685 C CA . LEU B 200 ? 1.029 0.984 0.585 0.023 -0.040 -0.063 206 LEU BBB CA 3686 C C . LEU B 200 ? 1.084 0.996 0.624 0.022 -0.039 -0.060 206 LEU BBB C 3687 O O . LEU B 200 ? 1.143 1.028 0.654 0.040 -0.039 -0.065 206 LEU BBB O 3688 C CB . LEU B 200 ? 1.057 0.997 0.586 0.032 -0.050 -0.076 206 LEU BBB CB 3689 C CG . LEU B 200 ? 1.012 0.967 0.549 0.021 -0.062 -0.080 206 LEU BBB CG 3690 C CD1 . LEU B 200 ? 0.979 0.975 0.528 0.026 -0.054 -0.074 206 LEU BBB CD1 3691 C CD2 . LEU B 200 ? 1.038 0.961 0.539 0.028 -0.074 -0.095 206 LEU BBB CD2 3692 N N . PRO B 201 ? 1.087 0.989 0.644 0.000 -0.036 -0.053 207 PRO BBB N 3693 C CA . PRO B 201 ? 1.151 1.005 0.688 -0.005 -0.034 -0.049 207 PRO BBB CA 3694 C C . PRO B 201 ? 1.205 1.011 0.719 -0.010 -0.047 -0.061 207 PRO BBB C 3695 O O . PRO B 201 ? 1.210 1.024 0.730 -0.015 -0.059 -0.071 207 PRO BBB O 3696 C CB . PRO B 201 ? 1.142 1.008 0.708 -0.030 -0.023 -0.039 207 PRO BBB CB 3697 C CG . PRO B 201 ? 1.084 0.995 0.689 -0.042 -0.028 -0.043 207 PRO BBB CG 3698 C CD . PRO B 201 ? 1.046 0.983 0.643 -0.020 -0.034 -0.049 207 PRO BBB CD 3699 N N . PRO B 202 ? 1.275 1.025 0.757 -0.008 -0.047 -0.059 208 PRO BBB N 3700 C CA . PRO B 202 ? 1.337 1.034 0.794 -0.014 -0.060 -0.070 208 PRO BBB CA 3701 C C . PRO B 202 ? 1.352 1.054 0.835 -0.042 -0.071 -0.077 208 PRO BBB C 3702 O O . PRO B 202 ? 1.479 1.161 0.945 -0.038 -0.086 -0.091 208 PRO BBB O 3703 C CB . PRO B 202 ? 1.395 1.036 0.826 -0.021 -0.054 -0.060 208 PRO BBB CB 3704 C CG . PRO B 202 ? 1.363 1.020 0.785 0.003 -0.044 -0.049 208 PRO BBB CG 3705 C CD . PRO B 202 ? 1.293 1.024 0.756 0.003 -0.037 -0.047 208 PRO BBB CD 3706 N N . GLU B 203 ? 1.304 1.033 0.828 -0.069 -0.063 -0.069 209 GLU BBB N 3707 C CA . GLU B 203 ? 1.345 1.086 0.905 -0.098 -0.074 -0.077 209 GLU BBB CA 3708 C C . GLU B 203 ? 1.398 1.169 0.963 -0.086 -0.092 -0.090 209 GLU BBB C 3709 O O . GLU B 203 ? 1.480 1.226 1.038 -0.095 -0.112 -0.104 209 GLU BBB O 3710 C CB . GLU B 203 ? 1.324 1.109 0.937 -0.121 -0.059 -0.067 209 GLU BBB CB 3711 C CG . GLU B 203 ? 1.397 1.166 1.000 -0.126 -0.036 -0.051 209 GLU BBB CG 3712 C CD . GLU B 203 ? 1.382 1.182 0.978 -0.102 -0.023 -0.041 209 GLU BBB CD 3713 O OE1 . GLU B 203 ? 1.490 1.256 1.046 -0.086 -0.017 -0.034 209 GLU BBB OE1 3714 O OE2 . GLU B 203 ? 1.246 1.101 0.876 -0.099 -0.022 -0.042 209 GLU BBB OE2 3715 N N . MET B 204 ? 1.329 1.145 0.902 -0.068 -0.086 -0.086 210 MET BBB N 3716 C CA . MET B 204 ? 1.236 1.077 0.806 -0.055 -0.099 -0.095 210 MET BBB CA 3717 C C . MET B 204 ? 1.208 1.009 0.725 -0.034 -0.108 -0.106 210 MET BBB C 3718 O O . MET B 204 ? 1.266 1.054 0.769 -0.035 -0.126 -0.119 210 MET BBB O 3719 C CB . MET B 204 ? 1.212 1.102 0.795 -0.041 -0.086 -0.086 210 MET BBB CB 3720 C CG . MET B 204 ? 1.196 1.127 0.828 -0.057 -0.078 -0.076 210 MET BBB CG 3721 S SD . MET B 204 ? 1.180 1.165 0.828 -0.045 -0.076 -0.072 210 MET BBB SD 3722 C CE . MET B 204 ? 1.159 1.142 0.801 -0.046 -0.104 -0.086 210 MET BBB CE 3723 N N . ILE B 205 ? 1.199 0.978 0.686 -0.014 -0.095 -0.103 211 ILE BBB N 3724 C CA . ILE B 205 ? 1.249 0.992 0.688 0.011 -0.099 -0.114 211 ILE BBB CA 3725 C C . ILE B 205 ? 1.332 1.022 0.747 -0.001 -0.119 -0.128 211 ILE BBB C 3726 O O . ILE B 205 ? 1.383 1.059 0.768 0.011 -0.130 -0.142 211 ILE BBB O 3727 C CB . ILE B 205 ? 1.267 0.992 0.687 0.031 -0.086 -0.108 211 ILE BBB CB 3728 C CG1 . ILE B 205 ? 1.241 1.019 0.679 0.046 -0.070 -0.099 211 ILE BBB CG1 3729 C CG2 . ILE B 205 ? 1.329 1.006 0.701 0.054 -0.092 -0.122 211 ILE BBB CG2 3730 C CD1 . ILE B 205 ? 1.242 1.047 0.668 0.067 -0.067 -0.108 211 ILE BBB CD1 3731 N N . GLU B 206 ? 1.339 0.998 0.764 -0.023 -0.122 -0.125 212 GLU BBB N 3732 C CA . GLU B 206 ? 1.372 0.972 0.776 -0.038 -0.141 -0.137 212 GLU BBB CA 3733 C C . GLU B 206 ? 1.379 1.000 0.818 -0.065 -0.159 -0.144 212 GLU BBB C 3734 O O . GLU B 206 ? 1.415 0.994 0.849 -0.084 -0.175 -0.154 212 GLU BBB O 3735 C CB . GLU B 206 ? 1.380 0.933 0.776 -0.050 -0.133 -0.129 212 GLU BBB CB 3736 C CG . GLU B 206 ? 1.380 0.907 0.737 -0.019 -0.121 -0.124 212 GLU BBB CG 3737 C CD . GLU B 206 ? 1.403 0.872 0.739 -0.028 -0.116 -0.115 212 GLU BBB CD 3738 O OE1 . GLU B 206 ? 1.443 0.845 0.744 -0.032 -0.129 -0.124 212 GLU BBB OE1 3739 O OE2 . GLU B 206 ? 1.375 0.861 0.725 -0.030 -0.100 -0.099 212 GLU BBB OE2 3740 N N . GLY B 207 ? 1.366 1.048 0.841 -0.067 -0.158 -0.140 213 GLY BBB N 3741 C CA . GLY B 207 ? 1.415 1.121 0.927 -0.088 -0.178 -0.148 213 GLY BBB CA 3742 C C . GLY B 207 ? 1.475 1.185 1.037 -0.123 -0.179 -0.145 213 GLY BBB C 3743 O O . GLY B 207 ? 1.492 1.214 1.086 -0.143 -0.200 -0.155 213 GLY BBB O 3744 N N . ARG B 208 ? 1.504 1.204 1.072 -0.131 -0.156 -0.131 214 ARG BBB N 3745 C CA . ARG B 208 ? 1.516 1.225 1.134 -0.166 -0.147 -0.125 214 ARG BBB CA 3746 C C . ARG B 208 ? 1.419 1.202 1.097 -0.172 -0.137 -0.118 214 ARG BBB C 3747 O O . ARG B 208 ? 1.338 1.153 1.008 -0.148 -0.135 -0.114 214 ARG BBB O 3748 C CB . ARG B 208 ? 1.574 1.241 1.167 -0.170 -0.123 -0.111 214 ARG BBB CB 3749 C CG . ARG B 208 ? 1.697 1.284 1.240 -0.173 -0.134 -0.118 214 ARG BBB CG 3750 C CD . ARG B 208 ? 1.723 1.265 1.251 -0.188 -0.114 -0.104 214 ARG BBB CD 3751 N NE . ARG B 208 ? 1.707 1.282 1.242 -0.177 -0.088 -0.086 214 ARG BBB NE 3752 C CZ . ARG B 208 ? 1.756 1.322 1.251 -0.144 -0.080 -0.079 214 ARG BBB CZ 3753 N NH1 . ARG B 208 ? 1.808 1.337 1.255 -0.116 -0.093 -0.089 214 ARG BBB NH1 3754 N NH2 . ARG B 208 ? 1.775 1.374 1.282 -0.138 -0.059 -0.064 214 ARG BBB NH2 3755 N N . THR B 209 ? 1.404 1.210 1.139 -0.204 -0.132 -0.116 215 THR BBB N 3756 C CA . THR B 209 ? 1.359 1.237 1.160 -0.212 -0.123 -0.112 215 THR BBB CA 3757 C C . THR B 209 ? 1.369 1.266 1.161 -0.197 -0.093 -0.094 215 THR BBB C 3758 O O . THR B 209 ? 1.344 1.201 1.100 -0.197 -0.074 -0.084 215 THR BBB O 3759 C CB . THR B 209 ? 1.342 1.238 1.208 -0.251 -0.120 -0.116 215 THR BBB CB 3760 O OG1 . THR B 209 ? 1.358 1.242 1.235 -0.263 -0.154 -0.135 215 THR BBB OG1 3761 C CG2 . THR B 209 ? 1.292 1.261 1.226 -0.257 -0.108 -0.113 215 THR BBB CG2 3762 N N . TYR B 210 ? 1.391 1.345 1.215 -0.187 -0.091 -0.092 216 TYR BBB N 3763 C CA . TYR B 210 ? 1.338 1.315 1.152 -0.167 -0.069 -0.078 216 TYR BBB CA 3764 C C . TYR B 210 ? 1.287 1.325 1.164 -0.177 -0.060 -0.076 216 TYR BBB C 3765 O O . TYR B 210 ? 1.281 1.351 1.200 -0.182 -0.081 -0.088 216 TYR BBB O 3766 C CB . TYR B 210 ? 1.375 1.350 1.146 -0.136 -0.080 -0.079 216 TYR BBB CB 3767 C CG . TYR B 210 ? 1.378 1.385 1.167 -0.128 -0.103 -0.089 216 TYR BBB CG 3768 C CD1 . TYR B 210 ? 1.446 1.447 1.250 -0.140 -0.130 -0.104 216 TYR BBB CD1 3769 C CD2 . TYR B 210 ? 1.356 1.397 1.145 -0.109 -0.100 -0.084 216 TYR BBB CD2 3770 C CE1 . TYR B 210 ? 1.475 1.501 1.290 -0.131 -0.154 -0.113 216 TYR BBB CE1 3771 C CE2 . TYR B 210 ? 1.357 1.420 1.155 -0.102 -0.121 -0.092 216 TYR BBB CE2 3772 C CZ . TYR B 210 ? 1.464 1.518 1.273 -0.112 -0.149 -0.106 216 TYR BBB CZ 3773 O OH . TYR B 210 ? 1.521 1.592 1.334 -0.103 -0.173 -0.114 216 TYR BBB OH 3774 N N . ASP B 211 ? 1.233 1.284 1.116 -0.178 -0.031 -0.063 217 ASP BBB N 3775 C CA . ASP B 211 ? 1.167 1.275 1.105 -0.183 -0.018 -0.062 217 ASP BBB CA 3776 C C . ASP B 211 ? 1.115 1.233 1.026 -0.158 -0.004 -0.050 217 ASP BBB C 3777 O O . ASP B 211 ? 1.130 1.219 0.989 -0.139 -0.010 -0.047 217 ASP BBB O 3778 C CB . ASP B 211 ? 1.262 1.374 1.238 -0.213 0.006 -0.059 217 ASP BBB CB 3779 C CG . ASP B 211 ? 1.371 1.439 1.301 -0.217 0.035 -0.043 217 ASP BBB CG 3780 O OD1 . ASP B 211 ? 1.468 1.487 1.338 -0.203 0.029 -0.039 217 ASP BBB OD1 3781 O OD2 . ASP B 211 ? 1.312 1.395 1.266 -0.232 0.064 -0.036 217 ASP BBB OD2 3782 N N . GLU B 212 ? 1.038 1.194 0.983 -0.160 0.014 -0.046 218 GLU BBB N 3783 C CA A GLU B 212 ? 0.942 1.109 0.863 -0.138 0.025 -0.036 218 GLU BBB CA 3784 C CA B GLU B 212 ? 0.966 1.134 0.890 -0.139 0.027 -0.036 218 GLU BBB CA 3785 C C . GLU B 212 ? 0.958 1.083 0.827 -0.134 0.045 -0.023 218 GLU BBB C 3786 O O . GLU B 212 ? 0.940 1.070 0.788 -0.118 0.053 -0.016 218 GLU BBB O 3787 C CB A GLU B 212 ? 0.867 1.083 0.838 -0.140 0.038 -0.037 218 GLU BBB CB 3788 C CB B GLU B 212 ? 0.929 1.144 0.903 -0.144 0.043 -0.037 218 GLU BBB CB 3789 C CG A GLU B 212 ? 0.800 1.056 0.811 -0.132 0.014 -0.049 218 GLU BBB CG 3790 C CG B GLU B 212 ? 0.942 1.156 0.941 -0.170 0.071 -0.034 218 GLU BBB CG 3791 C CD A GLU B 212 ? 0.728 0.981 0.705 -0.107 -0.005 -0.048 218 GLU BBB CD 3792 C CD B GLU B 212 ? 0.928 1.168 0.991 -0.194 0.064 -0.046 218 GLU BBB CD 3793 O OE1 A GLU B 212 ? 0.671 0.927 0.627 -0.093 0.006 -0.040 218 GLU BBB OE1 3794 O OE1 B GLU B 212 ? 0.933 1.142 0.990 -0.215 0.068 -0.046 218 GLU BBB OE1 3795 O OE2 A GLU B 212 ? 0.700 0.945 0.669 -0.103 -0.031 -0.056 218 GLU BBB OE2 3796 O OE2 B GLU B 212 ? 0.897 1.187 1.015 -0.191 0.055 -0.056 218 GLU BBB OE2 3797 N N . LYS B 213 ? 0.982 1.064 0.829 -0.148 0.049 -0.021 219 LYS BBB N 3798 C CA . LYS B 213 ? 1.033 1.064 0.820 -0.141 0.061 -0.010 219 LYS BBB CA 3799 C C . LYS B 213 ? 1.045 1.059 0.791 -0.115 0.042 -0.011 219 LYS BBB C 3800 O O . LYS B 213 ? 1.038 1.019 0.739 -0.101 0.047 -0.003 219 LYS BBB O 3801 C CB . LYS B 213 ? 1.105 1.089 0.878 -0.164 0.070 -0.007 219 LYS BBB CB 3802 C CG . LYS B 213 ? 1.166 1.151 0.953 -0.186 0.101 0.002 219 LYS BBB CG 3803 C CD . LYS B 213 ? 1.256 1.207 1.050 -0.217 0.110 0.002 219 LYS BBB CD 3804 C CE . LYS B 213 ? 1.322 1.302 1.160 -0.244 0.141 0.004 219 LYS BBB CE 3805 N NZ . LYS B 213 ? 1.495 1.433 1.330 -0.277 0.156 0.008 219 LYS BBB NZ 3806 N N . VAL B 214 ? 1.040 1.075 0.800 -0.107 0.020 -0.022 220 VAL BBB N 3807 C CA . VAL B 214 ? 1.042 1.070 0.769 -0.082 0.006 -0.025 220 VAL BBB CA 3808 C C . VAL B 214 ? 0.985 1.037 0.706 -0.066 0.015 -0.017 220 VAL BBB C 3809 O O . VAL B 214 ? 0.983 1.019 0.669 -0.048 0.014 -0.014 220 VAL BBB O 3810 C CB . VAL B 214 ? 1.089 1.131 0.828 -0.080 -0.016 -0.037 220 VAL BBB CB 3811 C CG1 . VAL B 214 ? 1.075 1.120 0.784 -0.056 -0.024 -0.039 220 VAL BBB CG1 3812 C CG2 . VAL B 214 ? 1.172 1.182 0.907 -0.094 -0.029 -0.046 220 VAL BBB CG2 3813 N N . ASP B 215 ? 0.930 1.021 0.686 -0.071 0.021 -0.016 221 ASP BBB N 3814 C CA . ASP B 215 ? 0.895 1.007 0.648 -0.058 0.030 -0.009 221 ASP BBB CA 3815 C C . ASP B 215 ? 0.901 0.984 0.616 -0.050 0.042 -0.000 221 ASP BBB C 3816 O O . ASP B 215 ? 0.911 0.999 0.607 -0.033 0.038 0.002 221 ASP BBB O 3817 C CB . ASP B 215 ? 0.857 1.004 0.651 -0.068 0.040 -0.009 221 ASP BBB CB 3818 C CG . ASP B 215 ? 0.816 0.996 0.646 -0.069 0.024 -0.018 221 ASP BBB CG 3819 O OD1 . ASP B 215 ? 0.794 0.971 0.611 -0.059 0.006 -0.023 221 ASP BBB OD1 3820 O OD2 . ASP B 215 ? 0.767 0.976 0.639 -0.077 0.030 -0.021 221 ASP BBB OD2 3821 N N . LEU B 216 ? 0.889 0.941 0.592 -0.063 0.054 0.005 222 LEU BBB N 3822 C CA . LEU B 216 ? 0.935 0.951 0.595 -0.056 0.065 0.015 222 LEU BBB CA 3823 C C . LEU B 216 ? 0.946 0.939 0.572 -0.035 0.050 0.013 222 LEU BBB C 3824 O O . LEU B 216 ? 0.950 0.942 0.555 -0.018 0.049 0.017 222 LEU BBB O 3825 C CB . LEU B 216 ? 0.973 0.952 0.624 -0.076 0.080 0.021 222 LEU BBB CB 3826 C CG . LEU B 216 ? 0.957 0.965 0.652 -0.099 0.097 0.020 222 LEU BBB CG 3827 C CD1 . LEU B 216 ? 1.010 0.980 0.695 -0.123 0.115 0.025 222 LEU BBB CD1 3828 C CD2 . LEU B 216 ? 0.925 0.960 0.626 -0.092 0.111 0.024 222 LEU BBB CD2 3829 N N . TRP B 217 ? 0.956 0.933 0.579 -0.035 0.037 0.006 223 TRP BBB N 3830 C CA . TRP B 217 ? 0.973 0.930 0.566 -0.014 0.024 0.001 223 TRP BBB CA 3831 C C . TRP B 217 ? 0.930 0.929 0.534 0.004 0.020 -0.001 223 TRP BBB C 3832 O O . TRP B 217 ? 1.011 1.004 0.595 0.021 0.018 0.001 223 TRP BBB O 3833 C CB . TRP B 217 ? 0.978 0.916 0.569 -0.019 0.013 -0.009 223 TRP BBB CB 3834 C CG . TRP B 217 ? 0.992 0.915 0.558 0.004 0.001 -0.016 223 TRP BBB CG 3835 C CD1 . TRP B 217 ? 0.979 0.933 0.552 0.018 -0.006 -0.024 223 TRP BBB CD1 3836 C CD2 . TRP B 217 ? 1.026 0.898 0.553 0.016 -0.004 -0.018 223 TRP BBB CD2 3837 N NE1 . TRP B 217 ? 0.978 0.909 0.524 0.038 -0.012 -0.031 223 TRP BBB NE1 3838 C CE2 . TRP B 217 ? 1.021 0.902 0.540 0.039 -0.013 -0.028 223 TRP BBB CE2 3839 C CE3 . TRP B 217 ? 1.088 0.905 0.585 0.011 -0.001 -0.011 223 TRP BBB CE3 3840 C CZ2 . TRP B 217 ? 1.076 0.918 0.562 0.058 -0.020 -0.034 223 TRP BBB CZ2 3841 C CZ3 . TRP B 217 ? 1.113 0.885 0.573 0.030 -0.011 -0.016 223 TRP BBB CZ3 3842 C CH2 . TRP B 217 ? 1.098 0.884 0.554 0.055 -0.021 -0.027 223 TRP BBB CH2 3843 N N . CYS B 218 ? 0.855 0.891 0.488 -0.002 0.017 -0.006 224 CYS BBB N 3844 C CA . CYS B 218 ? 0.833 0.904 0.474 0.011 0.013 -0.009 224 CYS BBB CA 3845 C C . CYS B 218 ? 0.807 0.891 0.446 0.019 0.019 -0.002 224 CYS BBB C 3846 O O . CYS B 218 ? 0.770 0.866 0.402 0.034 0.015 -0.003 224 CYS BBB O 3847 C CB . CYS B 218 ? 0.834 0.934 0.502 0.001 0.008 -0.013 224 CYS BBB CB 3848 S SG . CYS B 218 ? 0.936 1.019 0.600 -0.005 -0.005 -0.023 224 CYS BBB SG 3849 N N . ILE B 219 ? 0.851 0.932 0.494 0.009 0.029 0.005 225 ILE BBB N 3850 C CA . ILE B 219 ? 0.846 0.934 0.481 0.015 0.034 0.012 225 ILE BBB CA 3851 C C . ILE B 219 ? 0.860 0.921 0.463 0.032 0.028 0.013 225 ILE BBB C 3852 O O . ILE B 219 ? 0.833 0.910 0.435 0.044 0.023 0.013 225 ILE BBB O 3853 C CB . ILE B 219 ? 0.888 0.970 0.528 0.002 0.049 0.018 225 ILE BBB CB 3854 C CG1 . ILE B 219 ? 0.869 0.985 0.546 -0.009 0.051 0.014 225 ILE BBB CG1 3855 C CG2 . ILE B 219 ? 0.974 1.047 0.590 0.010 0.053 0.024 225 ILE BBB CG2 3856 C CD1 . ILE B 219 ? 0.926 1.041 0.617 -0.025 0.068 0.017 225 ILE BBB CD1 3857 N N . GLY B 220 ? 0.874 0.894 0.454 0.031 0.028 0.014 226 GLY BBB N 3858 C CA . GLY B 220 ? 0.912 0.901 0.460 0.050 0.019 0.015 226 GLY BBB CA 3859 C C . GLY B 220 ? 0.889 0.903 0.448 0.068 0.008 0.005 226 GLY BBB C 3860 O O . GLY B 220 ? 0.890 0.908 0.441 0.086 -0.000 0.004 226 GLY BBB O 3861 N N . VAL B 221 ? 0.855 0.886 0.431 0.064 0.007 -0.003 227 VAL BBB N 3862 C CA . VAL B 221 ? 0.849 0.906 0.435 0.079 0.001 -0.012 227 VAL BBB CA 3863 C C . VAL B 221 ? 0.799 0.900 0.408 0.081 0.003 -0.011 227 VAL BBB C 3864 O O . VAL B 221 ? 0.746 0.861 0.357 0.098 -0.002 -0.015 227 VAL BBB O 3865 C CB . VAL B 221 ? 0.852 0.913 0.445 0.071 0.001 -0.020 227 VAL BBB CB 3866 C CG1 . VAL B 221 ? 0.846 0.930 0.443 0.086 -0.000 -0.030 227 VAL BBB CG1 3867 C CG2 . VAL B 221 ? 0.908 0.924 0.481 0.066 -0.002 -0.021 227 VAL BBB CG2 3868 N N . LEU B 222 ? 0.797 0.916 0.421 0.065 0.008 -0.007 228 LEU BBB N 3869 C CA . LEU B 222 ? 0.782 0.937 0.425 0.063 0.010 -0.006 228 LEU BBB CA 3870 C C . LEU B 222 ? 0.773 0.927 0.409 0.074 0.005 -0.003 228 LEU BBB C 3871 O O . LEU B 222 ? 0.741 0.923 0.391 0.081 0.001 -0.007 228 LEU BBB O 3872 C CB . LEU B 222 ? 0.779 0.943 0.434 0.047 0.015 -0.001 228 LEU BBB CB 3873 C CG . LEU B 222 ? 0.731 0.923 0.400 0.045 0.015 0.001 228 LEU BBB CG 3874 C CD1 . LEU B 222 ? 0.713 0.930 0.392 0.046 0.014 -0.004 228 LEU BBB CD1 3875 C CD2 . LEU B 222 ? 0.702 0.898 0.381 0.032 0.020 0.005 228 LEU BBB CD2 3876 N N . CYS B 223 ? 0.817 0.937 0.430 0.074 0.005 0.003 229 CYS BBB N 3877 C CA . CYS B 223 ? 0.836 0.946 0.432 0.086 -0.002 0.006 229 CYS BBB CA 3878 C C . CYS B 223 ? 0.853 0.969 0.450 0.107 -0.014 -0.001 229 CYS BBB C 3879 O O . CYS B 223 ? 0.871 1.012 0.481 0.115 -0.023 -0.005 229 CYS BBB O 3880 C CB . CYS B 223 ? 0.877 0.942 0.440 0.082 0.003 0.015 229 CYS BBB CB 3881 S SG . CYS B 223 ? 0.950 1.006 0.490 0.090 -0.004 0.019 229 CYS BBB SG 3882 N N . TYR B 224 ? 0.851 0.946 0.437 0.115 -0.016 -0.005 230 TYR BBB N 3883 C CA . TYR B 224 ? 0.868 0.968 0.457 0.139 -0.028 -0.014 230 TYR BBB CA 3884 C C . TYR B 224 ? 0.858 1.014 0.486 0.141 -0.026 -0.023 230 TYR BBB C 3885 O O . TYR B 224 ? 0.876 1.056 0.521 0.155 -0.036 -0.029 230 TYR BBB O 3886 C CB . TYR B 224 ? 0.905 0.970 0.474 0.146 -0.028 -0.018 230 TYR BBB CB 3887 C CG . TYR B 224 ? 0.949 1.014 0.519 0.174 -0.040 -0.029 230 TYR BBB CG 3888 C CD1 . TYR B 224 ? 0.914 1.024 0.516 0.184 -0.038 -0.041 230 TYR BBB CD1 3889 C CD2 . TYR B 224 ? 1.005 1.024 0.541 0.192 -0.054 -0.027 230 TYR BBB CD2 3890 C CE1 . TYR B 224 ? 0.926 1.042 0.534 0.212 -0.047 -0.052 230 TYR BBB CE1 3891 C CE2 . TYR B 224 ? 1.025 1.044 0.563 0.222 -0.067 -0.038 230 TYR BBB CE2 3892 C CZ . TYR B 224 ? 0.982 1.053 0.560 0.232 -0.064 -0.051 230 TYR BBB CZ 3893 O OH . TYR B 224 ? 1.011 1.089 0.598 0.263 -0.075 -0.064 230 TYR BBB OH 3894 N N . GLU B 225 ? 0.821 0.996 0.464 0.126 -0.014 -0.025 231 GLU BBB N 3895 C CA . GLU B 225 ? 0.785 1.007 0.459 0.124 -0.008 -0.032 231 GLU BBB CA 3896 C C . GLU B 225 ? 0.786 1.040 0.482 0.119 -0.011 -0.030 231 GLU BBB C 3897 O O . GLU B 225 ? 0.804 1.093 0.525 0.128 -0.013 -0.038 231 GLU BBB O 3898 C CB . GLU B 225 ? 0.775 0.999 0.448 0.107 0.004 -0.030 231 GLU BBB CB 3899 C CG . GLU B 225 ? 0.789 1.052 0.483 0.105 0.013 -0.037 231 GLU BBB CG 3900 C CD . GLU B 225 ? 0.820 1.074 0.501 0.099 0.021 -0.040 231 GLU BBB CD 3901 O OE1 . GLU B 225 ? 0.816 1.037 0.476 0.096 0.017 -0.039 231 GLU BBB OE1 3902 O OE2 . GLU B 225 ? 0.831 1.111 0.521 0.096 0.031 -0.044 231 GLU BBB OE2 3903 N N . LEU B 226 ? 0.780 1.024 0.468 0.105 -0.010 -0.021 232 LEU BBB N 3904 C CA . LEU B 226 ? 0.762 1.029 0.465 0.098 -0.014 -0.020 232 LEU BBB CA 3905 C C . LEU B 226 ? 0.786 1.060 0.494 0.115 -0.030 -0.025 232 LEU BBB C 3906 O O . LEU B 226 ? 0.796 1.106 0.533 0.114 -0.034 -0.031 232 LEU BBB O 3907 C CB . LEU B 226 ? 0.736 0.981 0.422 0.085 -0.011 -0.010 232 LEU BBB CB 3908 C CG . LEU B 226 ? 0.718 0.962 0.405 0.069 0.000 -0.006 232 LEU BBB CG 3909 C CD1 . LEU B 226 ? 0.723 0.944 0.396 0.060 0.003 0.001 232 LEU BBB CD1 3910 C CD2 . LEU B 226 ? 0.695 0.970 0.403 0.059 0.004 -0.008 232 LEU BBB CD2 3911 N N . LEU B 227 ? 0.802 1.041 0.483 0.131 -0.039 -0.023 233 LEU BBB N 3912 C CA . LEU B 227 ? 0.834 1.069 0.512 0.150 -0.059 -0.028 233 LEU BBB CA 3913 C C . LEU B 227 ? 0.819 1.087 0.528 0.169 -0.066 -0.041 233 LEU BBB C 3914 O O . LEU B 227 ? 0.819 1.115 0.552 0.179 -0.081 -0.048 233 LEU BBB O 3915 C CB . LEU B 227 ? 0.899 1.076 0.527 0.158 -0.066 -0.020 233 LEU BBB CB 3916 C CG . LEU B 227 ? 0.924 1.071 0.523 0.142 -0.059 -0.008 233 LEU BBB CG 3917 C CD1 . LEU B 227 ? 0.972 1.059 0.520 0.148 -0.060 0.000 233 LEU BBB CD1 3918 C CD2 . LEU B 227 ? 0.905 1.068 0.509 0.141 -0.070 -0.010 233 LEU BBB CD2 3919 N N . VAL B 228 ? 0.817 1.081 0.526 0.174 -0.056 -0.045 234 VAL BBB N 3920 C CA . VAL B 228 ? 0.821 1.107 0.552 0.198 -0.061 -0.058 234 VAL BBB CA 3921 C C . VAL B 228 ? 0.774 1.117 0.550 0.189 -0.045 -0.067 234 VAL BBB C 3922 O O . VAL B 228 ? 0.800 1.184 0.613 0.205 -0.050 -0.080 234 VAL BBB O 3923 C CB . VAL B 228 ? 0.880 1.122 0.578 0.211 -0.060 -0.059 234 VAL BBB CB 3924 C CG1 . VAL B 228 ? 0.947 1.208 0.666 0.240 -0.067 -0.074 234 VAL BBB CG1 3925 C CG2 . VAL B 228 ? 0.932 1.110 0.580 0.214 -0.071 -0.047 234 VAL BBB CG2 3926 N N . GLY B 229 ? 0.721 1.066 0.492 0.166 -0.027 -0.061 235 GLY BBB N 3927 C CA . GLY B 229 ? 0.707 1.096 0.509 0.154 -0.009 -0.066 235 GLY BBB CA 3928 C C . GLY B 229 ? 0.729 1.103 0.513 0.154 0.007 -0.069 235 GLY BBB C 3929 O O . GLY B 229 ? 0.751 1.149 0.545 0.141 0.024 -0.070 235 GLY BBB O 3930 N N . TYR B 230 ? 0.742 1.074 0.495 0.168 0.000 -0.069 236 TYR BBB N 3931 C CA . TYR B 230 ? 0.750 1.060 0.481 0.171 0.011 -0.073 236 TYR BBB CA 3932 C C . TYR B 230 ? 0.786 1.038 0.477 0.171 0.002 -0.066 236 TYR BBB C 3933 O O . TYR B 230 ? 0.826 1.054 0.505 0.176 -0.012 -0.060 236 TYR BBB O 3934 C CB . TYR B 230 ? 0.749 1.081 0.497 0.196 0.014 -0.089 236 TYR BBB CB 3935 C CG . TYR B 230 ? 0.782 1.104 0.534 0.224 -0.005 -0.095 236 TYR BBB CG 3936 C CD1 . TYR B 230 ? 0.815 1.079 0.527 0.236 -0.017 -0.093 236 TYR BBB CD1 3937 C CD2 . TYR B 230 ? 0.774 1.142 0.568 0.237 -0.012 -0.104 236 TYR BBB CD2 3938 C CE1 . TYR B 230 ? 0.835 1.082 0.543 0.263 -0.036 -0.097 236 TYR BBB CE1 3939 C CE2 . TYR B 230 ? 0.797 1.154 0.592 0.265 -0.033 -0.110 236 TYR BBB CE2 3940 C CZ . TYR B 230 ? 0.836 1.130 0.585 0.279 -0.046 -0.106 236 TYR BBB CZ 3941 O OH . TYR B 230 ? 0.889 1.163 0.632 0.308 -0.069 -0.111 236 TYR BBB OH 3942 N N . PRO B 231 ? 0.827 1.053 0.495 0.163 0.008 -0.066 237 PRO BBB N 3943 C CA . PRO B 231 ? 0.845 1.018 0.480 0.157 0.001 -0.060 237 PRO BBB CA 3944 C C . PRO B 231 ? 0.900 1.038 0.516 0.180 -0.010 -0.065 237 PRO BBB C 3945 O O . PRO B 231 ? 0.974 1.124 0.596 0.202 -0.009 -0.078 237 PRO BBB O 3946 C CB . PRO B 231 ? 0.866 1.028 0.487 0.145 0.009 -0.062 237 PRO BBB CB 3947 C CG . PRO B 231 ? 0.849 1.056 0.490 0.140 0.022 -0.066 237 PRO BBB CG 3948 C CD . PRO B 231 ? 0.836 1.080 0.505 0.157 0.023 -0.072 237 PRO BBB CD 3949 N N . PRO B 232 ? 0.927 1.018 0.516 0.177 -0.019 -0.056 238 PRO BBB N 3950 C CA . PRO B 232 ? 0.970 1.021 0.535 0.200 -0.031 -0.060 238 PRO BBB CA 3951 C C . PRO B 232 ? 1.028 1.053 0.575 0.215 -0.031 -0.072 238 PRO BBB C 3952 O O . PRO B 232 ? 1.048 1.066 0.592 0.243 -0.040 -0.081 238 PRO BBB O 3953 C CB . PRO B 232 ? 0.984 0.984 0.518 0.185 -0.035 -0.046 238 PRO BBB CB 3954 C CG . PRO B 232 ? 0.964 0.977 0.509 0.154 -0.023 -0.039 238 PRO BBB CG 3955 C CD . PRO B 232 ? 0.930 1.004 0.510 0.152 -0.016 -0.043 238 PRO BBB CD 3956 N N . PHE B 233 ? 1.039 1.051 0.576 0.199 -0.024 -0.073 239 PHE BBB N 3957 C CA . PHE B 233 ? 1.105 1.078 0.615 0.210 -0.026 -0.085 239 PHE BBB CA 3958 C C . PHE B 233 ? 1.125 1.135 0.648 0.224 -0.016 -0.100 239 PHE BBB C 3959 O O . PHE B 233 ? 1.147 1.126 0.647 0.240 -0.018 -0.112 239 PHE BBB O 3960 C CB . PHE B 233 ? 1.124 1.060 0.613 0.184 -0.026 -0.079 239 PHE BBB CB 3961 C CG . PHE B 233 ? 1.181 1.079 0.656 0.168 -0.032 -0.065 239 PHE BBB CG 3962 C CD1 . PHE B 233 ? 1.225 1.069 0.669 0.182 -0.042 -0.064 239 PHE BBB CD1 3963 C CD2 . PHE B 233 ? 1.160 1.073 0.650 0.140 -0.026 -0.054 239 PHE BBB CD2 3964 C CE1 . PHE B 233 ? 1.226 1.030 0.651 0.165 -0.043 -0.050 239 PHE BBB CE1 3965 C CE2 . PHE B 233 ? 1.149 1.028 0.626 0.125 -0.027 -0.041 239 PHE BBB CE2 3966 C CZ . PHE B 233 ? 1.191 1.016 0.634 0.136 -0.034 -0.039 239 PHE BBB CZ 3967 N N . GLU B 234 ? 1.158 1.227 0.715 0.218 -0.005 -0.100 240 GLU BBB N 3968 C CA . GLU B 234 ? 1.321 1.427 0.890 0.228 0.011 -0.113 240 GLU BBB CA 3969 C C . GLU B 234 ? 1.380 1.490 0.955 0.262 0.009 -0.129 240 GLU BBB C 3970 O O . GLU B 234 ? 1.443 1.548 1.026 0.278 -0.004 -0.127 240 GLU BBB O 3971 C CB . GLU B 234 ? 1.351 1.517 0.955 0.213 0.023 -0.108 240 GLU BBB CB 3972 C CG . GLU B 234 ? 1.297 1.509 0.942 0.228 0.023 -0.111 240 GLU BBB CG 3973 C CD . GLU B 234 ? 1.209 1.482 0.889 0.219 0.041 -0.114 240 GLU BBB CD 3974 O OE1 . GLU B 234 ? 1.163 1.476 0.874 0.238 0.047 -0.126 240 GLU BBB OE1 3975 O OE2 . GLU B 234 ? 1.134 1.414 0.811 0.194 0.049 -0.105 240 GLU BBB OE2 3976 N N . SER B 235 ? 1.387 1.504 0.954 0.276 0.022 -0.144 241 SER BBB N 3977 C CA . SER B 235 ? 1.391 1.516 0.965 0.312 0.024 -0.162 241 SER BBB CA 3978 C C . SER B 235 ? 1.344 1.509 0.928 0.316 0.050 -0.176 241 SER BBB C 3979 O O . SER B 235 ? 1.362 1.562 0.960 0.292 0.064 -0.168 241 SER BBB O 3980 C CB . SER B 235 ? 1.410 1.465 0.941 0.329 0.009 -0.168 241 SER BBB CB 3981 O OG . SER B 235 ? 1.395 1.415 0.888 0.321 0.015 -0.174 241 SER BBB OG 3982 N N . ALA B 236 ? 1.350 1.508 0.925 0.346 0.056 -0.195 242 ALA BBB N 3983 C CA . ALA B 236 ? 1.406 1.591 0.978 0.352 0.083 -0.210 242 ALA BBB CA 3984 C C . ALA B 236 ? 1.419 1.540 0.928 0.350 0.083 -0.215 242 ALA BBB C 3985 O O . ALA B 236 ? 1.388 1.516 0.877 0.339 0.103 -0.219 242 ALA BBB O 3986 C CB . ALA B 236 ? 1.441 1.666 1.049 0.389 0.093 -0.230 242 ALA BBB CB 3987 N N . SER B 237 ? 1.464 1.520 0.939 0.360 0.060 -0.216 243 SER BBB N 3988 C CA . SER B 237 ? 1.519 1.506 0.934 0.357 0.053 -0.222 243 SER BBB CA 3989 C C . SER B 237 ? 1.492 1.448 0.889 0.320 0.037 -0.203 243 SER BBB C 3990 O O . SER B 237 ? 1.509 1.474 0.932 0.307 0.026 -0.187 243 SER BBB O 3991 C CB . SER B 237 ? 1.603 1.535 0.992 0.388 0.037 -0.235 243 SER BBB CB 3992 O OG . SER B 237 ? 1.727 1.589 1.058 0.382 0.027 -0.240 243 SER BBB OG 3993 N N . HIS B 238 ? 1.530 1.451 0.886 0.304 0.037 -0.205 244 HIS BBB N 3994 C CA . HIS B 238 ? 1.486 1.378 0.828 0.271 0.021 -0.191 244 HIS BBB CA 3995 C C . HIS B 238 ? 1.450 1.276 0.768 0.270 -0.002 -0.191 244 HIS BBB C 3996 O O . HIS B 238 ? 1.390 1.208 0.721 0.247 -0.015 -0.175 244 HIS BBB O 3997 C CB . HIS B 238 ? 1.531 1.414 0.839 0.257 0.027 -0.196 244 HIS BBB CB 3998 C CG . HIS B 238 ? 1.519 1.462 0.849 0.252 0.051 -0.192 244 HIS BBB CG 3999 N ND1 . HIS B 238 ? 1.586 1.547 0.901 0.269 0.075 -0.206 244 HIS BBB ND1 4000 C CD2 . HIS B 238 ? 1.501 1.488 0.866 0.231 0.055 -0.176 244 HIS BBB CD2 4001 C CE1 . HIS B 238 ? 1.583 1.595 0.923 0.257 0.093 -0.197 244 HIS BBB CE1 4002 N NE2 . HIS B 238 ? 1.504 1.532 0.874 0.234 0.081 -0.179 244 HIS BBB NE2 4003 N N . SER B 239 ? 1.512 1.293 0.794 0.295 -0.006 -0.208 245 SER BBB N 4004 C CA . SER B 239 ? 1.552 1.263 0.807 0.299 -0.027 -0.210 245 SER BBB CA 4005 C C . SER B 239 ? 1.505 1.221 0.787 0.304 -0.034 -0.197 245 SER BBB C 4006 O O . SER B 239 ? 1.515 1.182 0.783 0.289 -0.051 -0.187 245 SER BBB O 4007 C CB . SER B 239 ? 1.627 1.294 0.840 0.331 -0.028 -0.232 245 SER BBB CB 4008 O OG . SER B 239 ? 1.677 1.277 0.866 0.341 -0.047 -0.234 245 SER BBB OG 4009 N N . GLU B 240 ? 1.440 1.213 0.760 0.324 -0.023 -0.197 246 GLU BBB N 4010 C CA . GLU B 240 ? 1.381 1.166 0.728 0.332 -0.031 -0.186 246 GLU BBB CA 4011 C C . GLU B 240 ? 1.309 1.109 0.675 0.295 -0.034 -0.164 246 GLU BBB C 4012 O O . GLU B 240 ? 1.323 1.077 0.673 0.284 -0.047 -0.153 246 GLU BBB O 4013 C CB . GLU B 240 ? 1.354 1.205 0.742 0.360 -0.019 -0.194 246 GLU BBB CB 4014 C CG . GLU B 240 ? 1.326 1.193 0.742 0.369 -0.030 -0.183 246 GLU BBB CG 4015 C CD . GLU B 240 ? 1.369 1.184 0.762 0.402 -0.048 -0.191 246 GLU BBB CD 4016 O OE1 . GLU B 240 ? 1.434 1.243 0.819 0.435 -0.046 -0.211 246 GLU BBB OE1 4017 O OE2 . GLU B 240 ? 1.345 1.122 0.724 0.396 -0.065 -0.176 246 GLU BBB OE2 4018 N N . THR B 241 ? 1.233 1.092 0.629 0.277 -0.020 -0.158 247 THR BBB N 4019 C CA . THR B 241 ? 1.168 1.046 0.584 0.244 -0.021 -0.139 247 THR BBB CA 4020 C C . THR B 241 ? 1.188 1.008 0.576 0.220 -0.034 -0.133 247 THR BBB C 4021 O O . THR B 241 ? 1.139 0.952 0.537 0.201 -0.039 -0.118 247 THR BBB O 4022 C CB . THR B 241 ? 1.099 1.034 0.538 0.230 -0.006 -0.138 247 THR BBB CB 4023 O OG1 . THR B 241 ? 1.047 1.036 0.517 0.248 0.007 -0.143 247 THR BBB OG1 4024 C CG2 . THR B 241 ? 1.068 1.020 0.526 0.199 -0.007 -0.121 247 THR BBB CG2 4025 N N . TYR B 242 ? 1.303 1.084 0.658 0.220 -0.038 -0.145 248 TYR BBB N 4026 C CA . TYR B 242 ? 1.406 1.131 0.737 0.196 -0.052 -0.143 248 TYR BBB CA 4027 C C . TYR B 242 ? 1.402 1.072 0.715 0.199 -0.063 -0.137 248 TYR BBB C 4028 O O . TYR B 242 ? 1.364 1.015 0.681 0.171 -0.067 -0.124 248 TYR BBB O 4029 C CB . TYR B 242 ? 1.527 1.222 0.823 0.202 -0.056 -0.161 248 TYR BBB CB 4030 C CG . TYR B 242 ? 1.687 1.337 0.964 0.174 -0.071 -0.161 248 TYR BBB CG 4031 C CD1 . TYR B 242 ? 1.693 1.370 0.986 0.148 -0.074 -0.157 248 TYR BBB CD1 4032 C CD2 . TYR B 242 ? 1.876 1.456 1.120 0.174 -0.086 -0.167 248 TYR BBB CD2 4033 C CE1 . TYR B 242 ? 1.792 1.434 1.076 0.123 -0.090 -0.159 248 TYR BBB CE1 4034 C CE2 . TYR B 242 ? 1.942 1.483 1.174 0.146 -0.101 -0.169 248 TYR BBB CE2 4035 C CZ . TYR B 242 ? 1.932 1.508 1.188 0.120 -0.103 -0.165 248 TYR BBB CZ 4036 O OH . TYR B 242 ? 2.038 1.580 1.289 0.093 -0.121 -0.169 248 TYR BBB OH 4037 N N . ARG B 243 ? 1.451 1.095 0.744 0.232 -0.066 -0.146 249 ARG BBB N 4038 C CA . ARG B 243 ? 1.517 1.098 0.782 0.241 -0.078 -0.141 249 ARG BBB CA 4039 C C . ARG B 243 ? 1.468 1.068 0.755 0.231 -0.076 -0.121 249 ARG BBB C 4040 O O . ARG B 243 ? 1.480 1.031 0.749 0.210 -0.081 -0.109 249 ARG BBB O 4041 C CB . ARG B 243 ? 1.569 1.129 0.813 0.285 -0.082 -0.157 249 ARG BBB CB 4042 C CG . ARG B 243 ? 1.676 1.162 0.883 0.299 -0.097 -0.154 249 ARG BBB CG 4043 C CD . ARG B 243 ? 1.727 1.211 0.928 0.348 -0.102 -0.169 249 ARG BBB CD 4044 N NE . ARG B 243 ? 1.692 1.254 0.940 0.363 -0.094 -0.166 249 ARG BBB NE 4045 C CZ . ARG B 243 ? 1.688 1.256 0.947 0.368 -0.101 -0.153 249 ARG BBB CZ 4046 N NH1 . ARG B 243 ? 1.774 1.272 0.995 0.360 -0.114 -0.139 249 ARG BBB NH1 4047 N NH2 . ARG B 243 ? 1.633 1.276 0.939 0.379 -0.095 -0.153 249 ARG BBB NH2 4048 N N . ARG B 244 ? 1.389 1.054 0.711 0.243 -0.068 -0.119 250 ARG BBB N 4049 C CA . ARG B 244 ? 1.350 1.037 0.691 0.239 -0.067 -0.103 250 ARG BBB CA 4050 C C . ARG B 244 ? 1.318 1.008 0.669 0.199 -0.062 -0.087 250 ARG BBB C 4051 O O . ARG B 244 ? 1.338 1.003 0.679 0.190 -0.063 -0.072 250 ARG BBB O 4052 C CB . ARG B 244 ? 1.314 1.077 0.697 0.256 -0.059 -0.106 250 ARG BBB CB 4053 C CG . ARG B 244 ? 1.368 1.140 0.752 0.298 -0.063 -0.123 250 ARG BBB CG 4054 C CD . ARG B 244 ? 1.340 1.183 0.769 0.312 -0.059 -0.124 250 ARG BBB CD 4055 N NE . ARG B 244 ? 1.388 1.221 0.817 0.313 -0.070 -0.110 250 ARG BBB NE 4056 C CZ . ARG B 244 ? 1.408 1.295 0.872 0.314 -0.070 -0.106 250 ARG BBB CZ 4057 N NH1 . ARG B 244 ? 1.419 1.378 0.928 0.314 -0.057 -0.113 250 ARG BBB NH1 4058 N NH2 . ARG B 244 ? 1.427 1.293 0.879 0.315 -0.082 -0.094 250 ARG BBB NH2 4059 N N . ILE B 245 ? 1.236 0.953 0.605 0.176 -0.055 -0.089 251 ILE BBB N 4060 C CA . ILE B 245 ? 1.199 0.927 0.586 0.140 -0.050 -0.076 251 ILE BBB CA 4061 C C . ILE B 245 ? 1.261 0.921 0.619 0.121 -0.056 -0.071 251 ILE BBB C 4062 O O . ILE B 245 ? 1.282 0.931 0.643 0.103 -0.051 -0.056 251 ILE BBB O 4063 C CB . ILE B 245 ? 1.146 0.916 0.556 0.125 -0.046 -0.082 251 ILE BBB CB 4064 C CG1 . ILE B 245 ? 1.088 0.924 0.526 0.137 -0.037 -0.083 251 ILE BBB CG1 4065 C CG2 . ILE B 245 ? 1.131 0.903 0.559 0.090 -0.045 -0.073 251 ILE BBB CG2 4066 C CD1 . ILE B 245 ? 1.070 0.933 0.514 0.133 -0.034 -0.093 251 ILE BBB CD1 4067 N N . LEU B 246 ? 1.313 0.927 0.645 0.123 -0.065 -0.083 252 LEU BBB N 4068 C CA . LEU B 246 ? 1.393 0.940 0.699 0.100 -0.072 -0.080 252 LEU BBB CA 4069 C C . LEU B 246 ? 1.469 0.959 0.741 0.108 -0.073 -0.069 252 LEU BBB C 4070 O O . LEU B 246 ? 1.502 0.949 0.762 0.080 -0.071 -0.059 252 LEU BBB O 4071 C CB . LEU B 246 ? 1.431 0.939 0.711 0.106 -0.084 -0.098 252 LEU BBB CB 4072 C CG . LEU B 246 ? 1.426 0.947 0.724 0.076 -0.088 -0.104 252 LEU BBB CG 4073 C CD1 . LEU B 246 ? 1.341 0.941 0.683 0.070 -0.080 -0.102 252 LEU BBB CD1 4074 C CD2 . LEU B 246 ? 1.488 0.968 0.753 0.088 -0.102 -0.124 252 LEU BBB CD2 4075 N N . LYS B 247 ? 1.497 0.985 0.754 0.144 -0.077 -0.072 253 LYS BBB N 4076 C CA . LYS B 247 ? 1.574 1.006 0.793 0.158 -0.083 -0.062 253 LYS BBB CA 4077 C C . LYS B 247 ? 1.512 0.983 0.749 0.156 -0.074 -0.046 253 LYS BBB C 4078 O O . LYS B 247 ? 1.496 0.924 0.700 0.168 -0.080 -0.037 253 LYS BBB O 4079 C CB . LYS B 247 ? 1.650 1.055 0.842 0.203 -0.096 -0.075 253 LYS BBB CB 4080 C CG . LYS B 247 ? 1.735 1.096 0.901 0.210 -0.105 -0.093 253 LYS BBB CG 4081 C CD . LYS B 247 ? 1.845 1.133 0.962 0.245 -0.120 -0.100 253 LYS BBB CD 4082 C CE . LYS B 247 ? 1.879 1.203 1.007 0.290 -0.125 -0.108 253 LYS BBB CE 4083 N NZ . LYS B 247 ? 1.912 1.225 1.031 0.298 -0.130 -0.091 253 LYS BBB NZ 4084 N N . VAL B 248 ? 1.447 0.991 0.732 0.140 -0.063 -0.044 254 VAL BBB N 4085 C CA . VAL B 248 ? 1.399 0.994 0.709 0.139 -0.055 -0.033 254 VAL BBB CA 4086 C C . VAL B 248 ? 1.425 1.017 0.721 0.176 -0.066 -0.034 254 VAL BBB C 4087 O O . VAL B 248 ? 1.454 1.035 0.736 0.176 -0.065 -0.021 254 VAL BBB O 4088 C CB . VAL B 248 ? 1.400 0.975 0.705 0.106 -0.043 -0.016 254 VAL BBB CB 4089 C CG1 . VAL B 248 ? 1.350 0.956 0.690 0.072 -0.033 -0.017 254 VAL BBB CG1 4090 C CG2 . VAL B 248 ? 1.523 1.010 0.773 0.101 -0.046 -0.007 254 VAL BBB CG2 4091 N N . ASP B 249 ? 1.423 1.030 0.724 0.207 -0.074 -0.050 255 ASP BBB N 4092 C CA . ASP B 249 ? 1.428 1.040 0.724 0.247 -0.087 -0.056 255 ASP BBB CA 4093 C C . ASP B 249 ? 1.343 1.033 0.684 0.250 -0.082 -0.055 255 ASP BBB C 4094 O O . ASP B 249 ? 1.316 1.063 0.692 0.268 -0.081 -0.068 255 ASP BBB O 4095 C CB . ASP B 249 ? 1.474 1.080 0.766 0.276 -0.094 -0.076 255 ASP BBB CB 4096 C CG . ASP B 249 ? 1.500 1.108 0.791 0.321 -0.109 -0.086 255 ASP BBB CG 4097 O OD1 . ASP B 249 ? 1.464 1.085 0.759 0.330 -0.116 -0.078 255 ASP BBB OD1 4098 O OD2 . ASP B 249 ? 1.523 1.122 0.809 0.347 -0.114 -0.103 255 ASP BBB OD2 4099 N N . VAL B 250 ? 1.313 1.004 0.652 0.233 -0.079 -0.039 256 VAL BBB N 4100 C CA . VAL B 250 ? 1.252 1.007 0.627 0.234 -0.077 -0.036 256 VAL BBB CA 4101 C C . VAL B 250 ? 1.291 1.040 0.656 0.270 -0.096 -0.040 256 VAL BBB C 4102 O O . VAL B 250 ? 1.329 1.010 0.645 0.280 -0.108 -0.033 256 VAL BBB O 4103 C CB . VAL B 250 ? 1.252 1.003 0.621 0.203 -0.066 -0.019 256 VAL BBB CB 4104 C CG1 . VAL B 250 ? 1.198 1.010 0.601 0.203 -0.064 -0.017 256 VAL BBB CG1 4105 C CG2 . VAL B 250 ? 1.237 0.988 0.616 0.169 -0.050 -0.016 256 VAL BBB CG2 4106 N N . ARG B 251 ? 1.299 1.116 0.709 0.287 -0.099 -0.051 257 ARG BBB N 4107 C CA . ARG B 251 ? 1.411 1.237 0.827 0.323 -0.120 -0.058 257 ARG BBB CA 4108 C C . ARG B 251 ? 1.399 1.290 0.855 0.317 -0.121 -0.057 257 ARG BBB C 4109 O O . ARG B 251 ? 1.416 1.376 0.924 0.311 -0.109 -0.066 257 ARG BBB O 4110 C CB . ARG B 251 ? 1.480 1.329 0.920 0.355 -0.126 -0.079 257 ARG BBB CB 4111 C CG . ARG B 251 ? 1.587 1.363 0.980 0.368 -0.132 -0.083 257 ARG BBB CG 4112 C CD . ARG B 251 ? 1.633 1.432 1.048 0.405 -0.138 -0.104 257 ARG BBB CD 4113 N NE . ARG B 251 ? 1.724 1.487 1.116 0.403 -0.128 -0.112 257 ARG BBB NE 4114 C CZ . ARG B 251 ? 1.767 1.567 1.186 0.418 -0.118 -0.131 257 ARG BBB CZ 4115 N NH1 . ARG B 251 ? 1.742 1.621 1.217 0.435 -0.113 -0.144 257 ARG BBB NH1 4116 N NH2 . ARG B 251 ? 1.812 1.569 1.200 0.414 -0.112 -0.137 257 ARG BBB NH2 4117 N N . PHE B 252 ? 1.387 1.251 0.817 0.318 -0.134 -0.046 258 PHE BBB N 4118 C CA . PHE B 252 ? 1.308 1.217 0.763 0.309 -0.136 -0.042 258 PHE BBB CA 4119 C C . PHE B 252 ? 1.330 1.279 0.817 0.342 -0.159 -0.056 258 PHE BBB C 4120 O O . PHE B 252 ? 1.406 1.316 0.867 0.373 -0.182 -0.060 258 PHE BBB O 4121 C CB . PHE B 252 ? 1.303 1.156 0.705 0.295 -0.138 -0.024 258 PHE BBB CB 4122 C CG . PHE B 252 ? 1.285 1.102 0.660 0.263 -0.115 -0.011 258 PHE BBB CG 4123 C CD1 . PHE B 252 ? 1.223 1.079 0.627 0.232 -0.094 -0.007 258 PHE BBB CD1 4124 C CD2 . PHE B 252 ? 1.330 1.071 0.652 0.262 -0.114 -0.004 258 PHE BBB CD2 4125 C CE1 . PHE B 252 ? 1.210 1.039 0.597 0.204 -0.075 0.003 258 PHE BBB CE1 4126 C CE2 . PHE B 252 ? 1.314 1.027 0.620 0.230 -0.093 0.007 258 PHE BBB CE2 4127 C CZ . PHE B 252 ? 1.250 1.009 0.590 0.201 -0.073 0.010 258 PHE BBB CZ 4128 N N . PRO B 253 ? 1.282 1.307 0.827 0.336 -0.156 -0.064 259 PRO BBB N 4129 C CA . PRO B 253 ? 1.293 1.363 0.878 0.364 -0.179 -0.078 259 PRO BBB CA 4130 C C . PRO B 253 ? 1.423 1.450 0.966 0.373 -0.206 -0.069 259 PRO BBB C 4131 O O . PRO B 253 ? 1.380 1.381 0.891 0.349 -0.198 -0.055 259 PRO BBB O 4132 C CB . PRO B 253 ? 1.184 1.338 0.835 0.344 -0.164 -0.085 259 PRO BBB CB 4133 C CG . PRO B 253 ? 1.171 1.310 0.801 0.306 -0.141 -0.069 259 PRO BBB CG 4134 C CD . PRO B 253 ? 1.229 1.300 0.805 0.303 -0.132 -0.060 259 PRO BBB CD 4135 N N . LEU B 254 ? 1.547 1.568 1.091 0.410 -0.237 -0.080 260 LEU BBB N 4136 C CA . LEU B 254 ? 1.675 1.639 1.164 0.426 -0.267 -0.072 260 LEU BBB CA 4137 C C . LEU B 254 ? 1.606 1.604 1.111 0.406 -0.270 -0.068 260 LEU BBB C 4138 O O . LEU B 254 ? 1.682 1.624 1.128 0.406 -0.284 -0.057 260 LEU BBB O 4139 C CB . LEU B 254 ? 1.835 1.799 1.335 0.472 -0.303 -0.088 260 LEU BBB CB 4140 C CG . LEU B 254 ? 1.954 1.854 1.412 0.498 -0.309 -0.089 260 LEU BBB CG 4141 C CD1 . LEU B 254 ? 2.013 1.804 1.372 0.489 -0.309 -0.067 260 LEU BBB CD1 4142 C CD2 . LEU B 254 ? 1.873 1.805 1.367 0.490 -0.279 -0.097 260 LEU BBB CD2 4143 N N . SER B 255 ? 1.533 1.614 1.110 0.388 -0.255 -0.077 261 SER BBB N 4144 C CA . SER B 255 ? 1.497 1.613 1.094 0.365 -0.255 -0.075 261 SER BBB CA 4145 C C . SER B 255 ? 1.405 1.483 0.957 0.331 -0.229 -0.056 261 SER BBB C 4146 O O . SER B 255 ? 1.320 1.409 0.872 0.315 -0.230 -0.052 261 SER BBB O 4147 C CB . SER B 255 ? 1.504 1.714 1.188 0.356 -0.244 -0.090 261 SER BBB CB 4148 O OG . SER B 255 ? 1.565 1.807 1.270 0.338 -0.250 -0.090 261 SER BBB OG 4149 N N . MET B 256 ? 1.408 1.444 0.927 0.321 -0.207 -0.046 262 MET BBB N 4150 C CA . MET B 256 ? 1.333 1.340 0.820 0.289 -0.179 -0.030 262 MET BBB CA 4151 C C . MET B 256 ? 1.270 1.218 0.693 0.286 -0.188 -0.017 262 MET BBB C 4152 O O . MET B 256 ? 1.268 1.156 0.637 0.307 -0.207 -0.013 262 MET BBB O 4153 C CB . MET B 256 ? 1.370 1.338 0.832 0.283 -0.160 -0.024 262 MET BBB CB 4154 C CG . MET B 256 ? 1.384 1.329 0.824 0.250 -0.133 -0.010 262 MET BBB CG 4155 S SD . MET B 256 ? 1.399 1.417 0.903 0.224 -0.108 -0.015 262 MET BBB SD 4156 C CE . MET B 256 ? 1.376 1.350 0.848 0.196 -0.082 -0.001 262 MET BBB CE 4157 N N . PRO B 257 ? 1.201 1.160 0.623 0.261 -0.174 -0.011 263 PRO BBB N 4158 C CA . PRO B 257 ? 1.231 1.129 0.586 0.254 -0.172 0.003 263 PRO BBB CA 4159 C C . PRO B 257 ? 1.275 1.103 0.573 0.246 -0.154 0.017 263 PRO BBB C 4160 O O . PRO B 257 ? 1.223 1.065 0.544 0.229 -0.131 0.019 263 PRO BBB O 4161 C CB . PRO B 257 ? 1.179 1.113 0.558 0.226 -0.152 0.005 263 PRO BBB CB 4162 C CG . PRO B 257 ? 1.142 1.155 0.597 0.227 -0.159 -0.010 263 PRO BBB CG 4163 C CD . PRO B 257 ? 1.138 1.167 0.621 0.241 -0.161 -0.017 263 PRO BBB CD 4164 N N . LEU B 258 ? 1.370 1.126 0.594 0.257 -0.165 0.027 264 LEU BBB N 4165 C CA . LEU B 258 ? 1.423 1.102 0.585 0.251 -0.150 0.041 264 LEU BBB CA 4166 C C . LEU B 258 ? 1.391 1.069 0.552 0.216 -0.112 0.051 264 LEU BBB C 4167 O O . LEU B 258 ? 1.363 1.028 0.529 0.202 -0.093 0.055 264 LEU BBB O 4168 C CB . LEU B 258 ? 1.545 1.144 0.622 0.270 -0.171 0.049 264 LEU BBB CB 4169 C CG . LEU B 258 ? 1.604 1.194 0.676 0.309 -0.213 0.039 264 LEU BBB CG 4170 C CD1 . LEU B 258 ? 1.673 1.168 0.648 0.327 -0.233 0.050 264 LEU BBB CD1 4171 C CD2 . LEU B 258 ? 1.572 1.176 0.679 0.321 -0.215 0.031 264 LEU BBB CD2 4172 N N . GLY B 259 ? 1.383 1.076 0.542 0.202 -0.101 0.054 265 GLY BBB N 4173 C CA . GLY B 259 ? 1.365 1.071 0.536 0.171 -0.066 0.060 265 GLY BBB CA 4174 C C . GLY B 259 ? 1.280 1.039 0.517 0.156 -0.051 0.055 265 GLY BBB C 4175 O O . GLY B 259 ? 1.288 1.029 0.521 0.135 -0.026 0.062 265 GLY BBB O 4176 N N . ALA B 260 ? 1.209 1.028 0.504 0.165 -0.065 0.042 266 ALA BBB N 4177 C CA . ALA B 260 ? 1.174 1.043 0.528 0.153 -0.053 0.035 266 ALA BBB CA 4178 C C . ALA B 260 ? 1.191 1.030 0.534 0.157 -0.052 0.036 266 ALA BBB C 4179 O O . ALA B 260 ? 1.177 1.015 0.532 0.137 -0.032 0.039 266 ALA BBB O 4180 C CB . ALA B 260 ? 1.125 1.058 0.533 0.163 -0.067 0.023 266 ALA BBB CB 4181 N N . ARG B 261 ? 1.227 1.039 0.548 0.183 -0.074 0.033 267 ARG BBB N 4182 C CA . ARG B 261 ? 1.266 1.036 0.566 0.191 -0.077 0.033 267 ARG BBB CA 4183 C C . ARG B 261 ? 1.303 1.015 0.561 0.167 -0.055 0.047 267 ARG BBB C 4184 O O . ARG B 261 ? 1.324 1.028 0.593 0.156 -0.045 0.045 267 ARG BBB O 4185 C CB . ARG B 261 ? 1.356 1.088 0.621 0.225 -0.106 0.030 267 ARG BBB CB 4186 C CG . ARG B 261 ? 1.453 1.127 0.685 0.236 -0.111 0.031 267 ARG BBB CG 4187 C CD . ARG B 261 ? 1.538 1.191 0.752 0.275 -0.143 0.023 267 ARG BBB CD 4188 N NE . ARG B 261 ? 1.707 1.265 0.842 0.285 -0.153 0.034 267 ARG BBB NE 4189 C CZ . ARG B 261 ? 1.805 1.303 0.905 0.281 -0.146 0.039 267 ARG BBB CZ 4190 N NH1 . ARG B 261 ? 1.939 1.345 0.960 0.289 -0.155 0.051 267 ARG BBB NH1 4191 N NH2 . ARG B 261 ? 1.708 1.232 0.846 0.268 -0.132 0.032 267 ARG BBB NH2 4192 N N . ASP B 262 ? 1.355 1.030 0.569 0.158 -0.047 0.058 268 ASP BBB N 4193 C CA . ASP B 262 ? 1.371 0.991 0.544 0.133 -0.021 0.072 268 ASP BBB CA 4194 C C . ASP B 262 ? 1.315 0.982 0.541 0.104 0.004 0.070 268 ASP BBB C 4195 O O . ASP B 262 ? 1.372 1.013 0.596 0.088 0.015 0.073 268 ASP BBB O 4196 C CB . ASP B 262 ? 1.382 0.964 0.500 0.130 -0.015 0.083 268 ASP BBB CB 4197 C CG . ASP B 262 ? 1.426 0.943 0.493 0.106 0.013 0.098 268 ASP BBB CG 4198 O OD1 . ASP B 262 ? 1.370 0.914 0.467 0.078 0.042 0.101 268 ASP BBB OD1 4199 O OD2 . ASP B 262 ? 1.502 0.943 0.501 0.116 0.005 0.108 268 ASP BBB OD2 4200 N N . LEU B 263 ? 1.219 0.947 0.490 0.097 0.009 0.065 269 LEU BBB N 4201 C CA . LEU B 263 ? 1.192 0.966 0.514 0.072 0.031 0.063 269 LEU BBB CA 4202 C C . LEU B 263 ? 1.184 0.978 0.542 0.069 0.026 0.054 269 LEU BBB C 4203 O O . LEU B 263 ? 1.191 0.982 0.564 0.047 0.041 0.056 269 LEU BBB O 4204 C CB . LEU B 263 ? 1.128 0.959 0.485 0.073 0.030 0.057 269 LEU BBB CB 4205 C CG . LEU B 263 ? 1.056 0.937 0.466 0.052 0.046 0.053 269 LEU BBB CG 4206 C CD1 . LEU B 263 ? 1.056 0.915 0.457 0.029 0.073 0.061 269 LEU BBB CD1 4207 C CD2 . LEU B 263 ? 1.021 0.946 0.455 0.056 0.043 0.049 269 LEU BBB CD2 4208 N N . ILE B 264 ? 1.164 0.979 0.537 0.091 0.005 0.045 270 ILE BBB N 4209 C CA . ILE B 264 ? 1.115 0.951 0.519 0.094 0.000 0.035 270 ILE BBB CA 4210 C C . ILE B 264 ? 1.183 0.957 0.551 0.091 -0.000 0.038 270 ILE BBB C 4211 O O . ILE B 264 ? 1.131 0.910 0.519 0.079 0.005 0.033 270 ILE BBB O 4212 C CB . ILE B 264 ? 1.047 0.920 0.472 0.119 -0.018 0.023 270 ILE BBB CB 4213 C CG1 . ILE B 264 ? 1.007 0.941 0.472 0.115 -0.016 0.020 270 ILE BBB CG1 4214 C CG2 . ILE B 264 ? 1.040 0.920 0.482 0.126 -0.023 0.013 270 ILE BBB CG2 4215 C CD1 . ILE B 264 ? 1.040 1.001 0.516 0.138 -0.034 0.013 270 ILE BBB CD1 4216 N N . SER B 265 ? 1.278 0.993 0.592 0.102 -0.006 0.046 271 SER BBB N 4217 C CA . SER B 265 ? 1.394 1.036 0.663 0.100 -0.007 0.051 271 SER BBB CA 4218 C C . SER B 265 ? 1.453 1.077 0.723 0.063 0.018 0.059 271 SER BBB C 4219 O O . SER B 265 ? 1.563 1.151 0.824 0.053 0.019 0.058 271 SER BBB O 4220 C CB . SER B 265 ? 1.419 0.998 0.625 0.120 -0.020 0.059 271 SER BBB CB 4221 O OG . SER B 265 ? 1.385 0.980 0.596 0.155 -0.045 0.049 271 SER BBB OG 4222 N N . ARG B 266 ? 1.400 1.049 0.683 0.046 0.036 0.065 272 ARG BBB N 4223 C CA . ARG B 266 ? 1.411 1.049 0.700 0.011 0.063 0.073 272 ARG BBB CA 4224 C C . ARG B 266 ? 1.291 0.990 0.647 -0.007 0.069 0.063 272 ARG BBB C 4225 O O . ARG B 266 ? 1.260 0.952 0.631 -0.035 0.086 0.065 272 ARG BBB O 4226 C CB . ARG B 266 ? 1.443 1.078 0.712 0.004 0.081 0.083 272 ARG BBB CB 4227 C CG . ARG B 266 ? 1.491 1.059 0.684 0.021 0.074 0.094 272 ARG BBB CG 4228 C CD . ARG B 266 ? 1.572 1.119 0.736 0.002 0.102 0.105 272 ARG BBB CD 4229 N NE . ARG B 266 ? 1.671 1.166 0.765 0.023 0.092 0.114 272 ARG BBB NE 4230 C CZ . ARG B 266 ? 1.757 1.168 0.778 0.028 0.087 0.125 272 ARG BBB CZ 4231 N NH1 . ARG B 266 ? 1.789 1.158 0.799 0.014 0.092 0.128 272 ARG BBB NH1 4232 N NH2 . ARG B 266 ? 1.829 1.194 0.785 0.049 0.075 0.131 272 ARG BBB NH2 4233 N N . LEU B 267 ? 1.215 0.972 0.611 0.008 0.055 0.052 273 LEU BBB N 4234 C CA . LEU B 267 ? 1.115 0.927 0.568 -0.003 0.056 0.042 273 LEU BBB CA 4235 C C . LEU B 267 ? 1.125 0.925 0.580 0.002 0.041 0.033 273 LEU BBB C 4236 O O . LEU B 267 ? 1.126 0.927 0.603 -0.019 0.045 0.029 273 LEU BBB O 4237 C CB . LEU B 267 ? 1.033 0.905 0.517 0.009 0.050 0.037 273 LEU BBB CB 4238 C CG . LEU B 267 ? 0.986 0.877 0.476 0.002 0.065 0.043 273 LEU BBB CG 4239 C CD1 . LEU B 267 ? 0.931 0.868 0.440 0.017 0.055 0.039 273 LEU BBB CD1 4240 C CD2 . LEU B 267 ? 0.962 0.877 0.490 -0.024 0.082 0.043 273 LEU BBB CD2 4241 N N . LEU B 268 ? 1.169 0.958 0.604 0.029 0.024 0.028 274 LEU BBB N 4242 C CA . LEU B 268 ? 1.155 0.928 0.585 0.040 0.010 0.017 274 LEU BBB CA 4243 C C . LEU B 268 ? 1.229 0.928 0.616 0.034 0.010 0.022 274 LEU BBB C 4244 O O . LEU B 268 ? 1.286 0.943 0.634 0.057 -0.002 0.022 274 LEU BBB O 4245 C CB . LEU B 268 ? 1.129 0.920 0.556 0.073 -0.004 0.010 274 LEU BBB CB 4246 C CG . LEU B 268 ? 1.083 0.940 0.552 0.079 -0.006 -0.000 274 LEU BBB CG 4247 C CD1 . LEU B 268 ? 1.048 0.948 0.549 0.060 0.005 0.005 274 LEU BBB CD1 4248 C CD2 . LEU B 268 ? 1.090 0.967 0.559 0.109 -0.017 -0.006 274 LEU BBB CD2 4249 N N . ARG B 269 ? 1.234 0.917 0.630 0.004 0.021 0.024 275 ARG BBB N 4250 C CA . ARG B 269 ? 1.337 0.947 0.695 -0.009 0.021 0.028 275 ARG BBB CA 4251 C C . ARG B 269 ? 1.350 0.966 0.734 -0.027 0.016 0.017 275 ARG BBB C 4252 O O . ARG B 269 ? 1.288 0.960 0.722 -0.042 0.021 0.012 275 ARG BBB O 4253 C CB . ARG B 269 ? 1.405 0.983 0.743 -0.033 0.042 0.044 275 ARG BBB CB 4254 C CG . ARG B 269 ? 1.454 1.015 0.752 -0.014 0.045 0.055 275 ARG BBB CG 4255 C CD . ARG B 269 ? 1.569 1.045 0.803 -0.022 0.052 0.069 275 ARG BBB CD 4256 N NE . ARG B 269 ? 1.641 1.055 0.832 -0.004 0.033 0.066 275 ARG BBB NE 4257 C CZ . ARG B 269 ? 1.735 1.065 0.873 -0.015 0.035 0.074 275 ARG BBB CZ 4258 N NH1 . ARG B 269 ? 1.773 1.049 0.875 0.007 0.014 0.069 275 ARG BBB NH1 4259 N NH2 . ARG B 269 ? 1.793 1.090 0.914 -0.048 0.060 0.088 275 ARG BBB NH2 4260 N N . TYR B 270 ? 1.434 0.993 0.786 -0.022 0.005 0.012 276 TYR BBB N 4261 C CA . TYR B 270 ? 1.481 1.033 0.849 -0.037 -0.004 -0.001 276 TYR BBB CA 4262 C C . TYR B 270 ? 1.470 1.039 0.876 -0.078 0.009 0.002 276 TYR BBB C 4263 O O . TYR B 270 ? 1.392 1.012 0.844 -0.088 0.004 -0.008 276 TYR BBB O 4264 C CB . TYR B 270 ? 1.567 1.038 0.883 -0.029 -0.017 -0.004 276 TYR BBB CB 4265 C CG . TYR B 270 ? 1.583 1.043 0.908 -0.039 -0.030 -0.020 276 TYR BBB CG 4266 C CD1 . TYR B 270 ? 1.633 1.077 0.976 -0.078 -0.025 -0.020 276 TYR BBB CD1 4267 C CD2 . TYR B 270 ? 1.599 1.066 0.916 -0.011 -0.046 -0.035 276 TYR BBB CD2 4268 C CE1 . TYR B 270 ? 1.661 1.094 1.012 -0.088 -0.041 -0.036 276 TYR BBB CE1 4269 C CE2 . TYR B 270 ? 1.661 1.114 0.981 -0.019 -0.059 -0.051 276 TYR BBB CE2 4270 C CZ . TYR B 270 ? 1.676 1.111 1.012 -0.058 -0.058 -0.051 276 TYR BBB CZ 4271 O OH . TYR B 270 ? 1.701 1.120 1.038 -0.066 -0.075 -0.067 276 TYR BBB OH 4272 N N . GLN B 271 ? 1.552 1.082 0.940 -0.100 0.026 0.015 277 GLN BBB N 4273 C CA . GLN B 271 ? 1.573 1.117 0.999 -0.141 0.044 0.019 277 GLN BBB CA 4274 C C . GLN B 271 ? 1.448 1.073 0.927 -0.144 0.056 0.020 277 GLN BBB C 4275 O O . GLN B 271 ? 1.403 1.038 0.867 -0.130 0.067 0.030 277 GLN BBB O 4276 C CB . GLN B 271 ? 1.680 1.156 1.065 -0.163 0.063 0.034 277 GLN BBB CB 4277 C CG . GLN B 271 ? 1.753 1.218 1.169 -0.208 0.075 0.033 277 GLN BBB CG 4278 C CD . GLN B 271 ? 1.806 1.268 1.242 -0.215 0.052 0.016 277 GLN BBB CD 4279 O OE1 . GLN B 271 ? 1.769 1.285 1.268 -0.235 0.049 0.005 277 GLN BBB OE1 4280 N NE2 . GLN B 271 ? 1.843 1.242 1.227 -0.196 0.032 0.011 277 GLN BBB NE2 4281 N N . PRO B 272 ? 1.363 1.044 0.903 -0.159 0.052 0.009 278 PRO BBB N 4282 C CA . PRO B 272 ? 1.287 1.040 0.877 -0.162 0.063 0.009 278 PRO BBB CA 4283 C C . PRO B 272 ? 1.299 1.053 0.898 -0.184 0.093 0.022 278 PRO BBB C 4284 O O . PRO B 272 ? 1.269 1.060 0.877 -0.173 0.104 0.027 278 PRO BBB O 4285 C CB . PRO B 272 ? 1.258 1.054 0.906 -0.177 0.049 -0.006 278 PRO BBB CB 4286 C CG . PRO B 272 ? 1.294 1.046 0.912 -0.171 0.025 -0.016 278 PRO BBB CG 4287 C CD . PRO B 272 ? 1.364 1.039 0.923 -0.172 0.033 -0.006 278 PRO BBB CD 4288 N N . LEU B 273 ? 1.368 1.080 0.960 -0.214 0.107 0.026 279 LEU BBB N 4289 C CA . LEU B 273 ? 1.378 1.095 0.987 -0.243 0.141 0.036 279 LEU BBB CA 4290 C C . LEU B 273 ? 1.406 1.079 0.950 -0.230 0.159 0.053 279 LEU BBB C 4291 O O . LEU B 273 ? 1.424 1.103 0.975 -0.250 0.190 0.062 279 LEU BBB O 4292 C CB . LEU B 273 ? 1.453 1.133 1.072 -0.282 0.149 0.035 279 LEU BBB CB 4293 C CG . LEU B 273 ? 1.463 1.190 1.155 -0.302 0.133 0.017 279 LEU BBB CG 4294 C CD1 . LEU B 273 ? 1.502 1.193 1.169 -0.290 0.099 0.007 279 LEU BBB CD1 4295 C CD2 . LEU B 273 ? 1.479 1.206 1.213 -0.348 0.157 0.018 279 LEU BBB CD2 4296 N N . GLU B 274 ? 1.413 1.047 0.899 -0.198 0.141 0.057 280 GLU BBB N 4297 C CA . GLU B 274 ? 1.462 1.053 0.883 -0.181 0.151 0.072 280 GLU BBB CA 4298 C C . GLU B 274 ? 1.432 1.062 0.852 -0.143 0.134 0.068 280 GLU BBB C 4299 O O . GLU B 274 ? 1.460 1.049 0.823 -0.118 0.125 0.075 280 GLU BBB O 4300 C CB . GLU B 274 ? 1.539 1.035 0.887 -0.179 0.145 0.081 280 GLU BBB CB 4301 C CG . GLU B 274 ? 1.532 1.007 0.859 -0.150 0.112 0.071 280 GLU BBB CG 4302 C CD . GLU B 274 ? 1.625 1.004 0.886 -0.151 0.104 0.077 280 GLU BBB CD 4303 O OE1 . GLU B 274 ? 1.663 1.001 0.917 -0.186 0.120 0.083 280 GLU BBB OE1 4304 O OE2 . GLU B 274 ? 1.627 0.973 0.846 -0.116 0.081 0.075 280 GLU BBB OE2 4305 N N . ARG B 275 ? 1.388 1.095 0.869 -0.140 0.130 0.058 281 ARG BBB N 4306 C CA . ARG B 275 ? 1.340 1.090 0.827 -0.110 0.117 0.054 281 ARG BBB CA 4307 C C . ARG B 275 ? 1.310 1.092 0.809 -0.113 0.138 0.060 281 ARG BBB C 4308 O O . ARG B 275 ? 1.329 1.147 0.875 -0.136 0.155 0.057 281 ARG BBB O 4309 C CB . ARG B 275 ? 1.296 1.101 0.835 -0.104 0.097 0.039 281 ARG BBB CB 4310 C CG . ARG B 275 ? 1.326 1.103 0.846 -0.091 0.074 0.031 281 ARG BBB CG 4311 C CD . ARG B 275 ? 1.290 1.118 0.843 -0.076 0.056 0.019 281 ARG BBB CD 4312 N NE . ARG B 275 ? 1.300 1.098 0.832 -0.064 0.037 0.010 281 ARG BBB NE 4313 C CZ . ARG B 275 ? 1.302 1.109 0.856 -0.072 0.025 -0.002 281 ARG BBB CZ 4314 N NH1 . ARG B 275 ? 1.329 1.103 0.855 -0.059 0.009 -0.010 281 ARG BBB NH1 4315 N NH2 . ARG B 275 ? 1.275 1.124 0.877 -0.091 0.027 -0.006 281 ARG BBB NH2 4316 N N . LEU B 276 ? 1.286 1.057 0.746 -0.090 0.134 0.066 282 LEU BBB N 4317 C CA . LEU B 276 ? 1.275 1.062 0.731 -0.090 0.154 0.072 282 LEU BBB CA 4318 C C . LEU B 276 ? 1.183 1.043 0.708 -0.099 0.161 0.063 282 LEU BBB C 4319 O O . LEU B 276 ? 1.137 1.039 0.692 -0.085 0.142 0.054 282 LEU BBB O 4320 C CB . LEU B 276 ? 1.293 1.072 0.710 -0.059 0.137 0.074 282 LEU BBB CB 4321 C CG . LEU B 276 ? 1.319 1.086 0.703 -0.057 0.155 0.083 282 LEU BBB CG 4322 C CD1 . LEU B 276 ? 1.375 1.067 0.693 -0.068 0.173 0.096 282 LEU BBB CD1 4323 C CD2 . LEU B 276 ? 1.313 1.088 0.676 -0.027 0.133 0.080 282 LEU BBB CD2 4324 N N . PRO B 277 ? 1.167 1.041 0.721 -0.124 0.188 0.064 283 PRO BBB N 4325 C CA . PRO B 277 ? 1.087 1.029 0.708 -0.131 0.194 0.054 283 PRO BBB CA 4326 C C . PRO B 277 ? 1.025 1.001 0.649 -0.109 0.190 0.052 283 PRO BBB C 4327 O O . PRO B 277 ? 0.990 0.935 0.562 -0.094 0.190 0.059 283 PRO BBB O 4328 C CB . PRO B 277 ? 1.138 1.080 0.776 -0.159 0.229 0.058 283 PRO BBB CB 4329 C CG . PRO B 277 ? 1.206 1.079 0.796 -0.175 0.238 0.068 283 PRO BBB CG 4330 C CD . PRO B 277 ? 1.226 1.051 0.749 -0.148 0.215 0.074 283 PRO BBB CD 4331 N N . LEU B 278 ? 0.983 1.018 0.666 -0.108 0.185 0.042 284 LEU BBB N 4332 C CA . LEU B 278 ? 0.966 1.034 0.657 -0.089 0.178 0.038 284 LEU BBB CA 4333 C C . LEU B 278 ? 1.001 1.052 0.659 -0.087 0.203 0.044 284 LEU BBB C 4334 O O . LEU B 278 ? 1.031 1.067 0.649 -0.068 0.193 0.047 284 LEU BBB O 4335 C CB . LEU B 278 ? 0.936 1.062 0.695 -0.093 0.174 0.026 284 LEU BBB CB 4336 C CG . LEU B 278 ? 0.918 1.063 0.706 -0.091 0.146 0.018 284 LEU BBB CG 4337 C CD1 . LEU B 278 ? 0.887 1.084 0.739 -0.095 0.142 0.007 284 LEU BBB CD1 4338 C CD2 . LEU B 278 ? 0.914 1.051 0.672 -0.070 0.123 0.019 284 LEU BBB CD2 4339 N N . ALA B 279 ? 1.011 1.063 0.684 -0.107 0.233 0.046 285 ALA BBB N 4340 C CA . ALA B 279 ? 1.020 1.056 0.661 -0.107 0.263 0.051 285 ALA BBB CA 4341 C C . ALA B 279 ? 1.074 1.047 0.630 -0.094 0.258 0.063 285 ALA BBB C 4342 O O . ALA B 279 ? 1.087 1.050 0.609 -0.082 0.265 0.064 285 ALA BBB O 4343 C CB . ALA B 279 ? 1.032 1.069 0.696 -0.135 0.298 0.052 285 ALA BBB CB 4344 N N . GLN B 280 ? 1.139 1.070 0.663 -0.096 0.243 0.069 286 GLN BBB N 4345 C CA . GLN B 280 ? 1.233 1.099 0.676 -0.083 0.235 0.080 286 GLN BBB CA 4346 C C . GLN B 280 ? 1.202 1.075 0.636 -0.056 0.199 0.076 286 GLN BBB C 4347 O O . GLN B 280 ? 1.239 1.068 0.612 -0.040 0.188 0.082 286 GLN BBB O 4348 C CB . GLN B 280 ? 1.324 1.136 0.736 -0.097 0.239 0.089 286 GLN BBB CB 4349 C CG . GLN B 280 ? 1.443 1.223 0.834 -0.123 0.279 0.097 286 GLN BBB CG 4350 C CD . GLN B 280 ? 1.560 1.289 0.928 -0.142 0.281 0.105 286 GLN BBB CD 4351 O OE1 . GLN B 280 ? 1.743 1.404 1.041 -0.132 0.271 0.115 286 GLN BBB OE1 4352 N NE2 . GLN B 280 ? 1.505 1.264 0.934 -0.167 0.293 0.099 286 GLN BBB NE2 4353 N N . ILE B 281 ? 1.141 1.064 0.629 -0.051 0.179 0.066 287 ILE BBB N 4354 C CA . ILE B 281 ? 1.090 1.029 0.576 -0.027 0.149 0.061 287 ILE BBB CA 4355 C C . ILE B 281 ? 1.077 1.027 0.551 -0.016 0.152 0.060 287 ILE BBB C 4356 O O . ILE B 281 ? 1.088 1.019 0.525 0.001 0.134 0.061 287 ILE BBB O 4357 C CB . ILE B 281 ? 1.010 0.996 0.552 -0.027 0.132 0.051 287 ILE BBB CB 4358 C CG1 . ILE B 281 ? 1.028 0.998 0.576 -0.036 0.127 0.051 287 ILE BBB CG1 4359 C CG2 . ILE B 281 ? 0.985 0.989 0.525 -0.006 0.108 0.047 287 ILE BBB CG2 4360 C CD1 . ILE B 281 ? 0.982 0.996 0.584 -0.040 0.115 0.041 287 ILE BBB CD1 4361 N N . LEU B 282 ? 1.050 1.029 0.555 -0.026 0.172 0.056 288 LEU BBB N 4362 C CA . LEU B 282 ? 1.055 1.041 0.546 -0.017 0.179 0.054 288 LEU BBB CA 4363 C C . LEU B 282 ? 1.168 1.097 0.586 -0.011 0.188 0.063 288 LEU BBB C 4364 O O . LEU B 282 ? 1.175 1.092 0.560 0.005 0.173 0.061 288 LEU BBB O 4365 C CB . LEU B 282 ? 1.015 1.036 0.552 -0.030 0.204 0.049 288 LEU BBB CB 4366 C CG . LEU B 282 ? 0.957 1.032 0.564 -0.033 0.193 0.039 288 LEU BBB CG 4367 C CD1 . LEU B 282 ? 0.932 1.039 0.585 -0.046 0.219 0.033 288 LEU BBB CD1 4368 C CD2 . LEU B 282 ? 0.916 1.015 0.533 -0.017 0.169 0.033 288 LEU BBB CD2 4369 N N . LYS B 283 ? 1.206 1.095 0.594 -0.025 0.209 0.072 289 LYS BBB N 4370 C CA . LYS B 283 ? 1.249 1.075 0.559 -0.024 0.224 0.082 289 LYS BBB CA 4371 C C . LYS B 283 ? 1.258 1.035 0.512 -0.008 0.196 0.088 289 LYS BBB C 4372 O O . LYS B 283 ? 1.311 1.029 0.492 -0.002 0.201 0.097 289 LYS BBB O 4373 C CB . LYS B 283 ? 1.310 1.114 0.613 -0.048 0.262 0.089 289 LYS BBB CB 4374 C CG . LYS B 283 ? 1.306 1.154 0.656 -0.061 0.294 0.082 289 LYS BBB CG 4375 C CD . LYS B 283 ? 1.353 1.187 0.708 -0.089 0.333 0.088 289 LYS BBB CD 4376 C CE . LYS B 283 ? 1.352 1.229 0.750 -0.099 0.368 0.080 289 LYS BBB CE 4377 N NZ . LYS B 283 ? 1.403 1.252 0.781 -0.125 0.413 0.088 289 LYS BBB NZ 4378 N N . HIS B 284 ? 1.221 1.020 0.507 -0.000 0.168 0.084 290 HIS BBB N 4379 C CA . HIS B 284 ? 1.229 0.984 0.471 0.016 0.142 0.088 290 HIS BBB CA 4380 C C . HIS B 284 ? 1.221 0.960 0.421 0.038 0.120 0.087 290 HIS BBB C 4381 O O . HIS B 284 ? 1.165 0.948 0.398 0.046 0.109 0.078 290 HIS BBB O 4382 C CB . HIS B 284 ? 1.184 0.971 0.473 0.021 0.118 0.081 290 HIS BBB CB 4383 C CG . HIS B 284 ? 1.205 0.946 0.450 0.038 0.095 0.085 290 HIS BBB CG 4384 N ND1 . HIS B 284 ? 1.181 0.925 0.412 0.063 0.066 0.080 290 HIS BBB ND1 4385 C CD2 . HIS B 284 ? 1.236 0.923 0.443 0.035 0.097 0.092 290 HIS BBB CD2 4386 C CE1 . HIS B 284 ? 1.222 0.920 0.415 0.077 0.048 0.084 290 HIS BBB CE1 4387 N NE2 . HIS B 284 ? 1.253 0.912 0.427 0.061 0.067 0.092 290 HIS BBB NE2 4388 N N . PRO B 285 ? 1.270 0.942 0.395 0.050 0.112 0.095 291 PRO BBB N 4389 C CA . PRO B 285 ? 1.265 0.914 0.342 0.071 0.090 0.093 291 PRO BBB CA 4390 C C . PRO B 285 ? 1.206 0.911 0.333 0.087 0.057 0.081 291 PRO BBB C 4391 O O . PRO B 285 ? 1.195 0.916 0.321 0.092 0.052 0.075 291 PRO BBB O 4392 C CB . PRO B 285 ? 1.346 0.920 0.349 0.084 0.075 0.103 291 PRO BBB CB 4393 C CG . PRO B 285 ? 1.363 0.927 0.384 0.071 0.085 0.108 291 PRO BBB CG 4394 C CD . PRO B 285 ? 1.340 0.950 0.417 0.044 0.120 0.106 291 PRO BBB CD 4395 N N . TRP B 286 ? 1.194 0.925 0.361 0.094 0.038 0.076 292 TRP BBB N 4396 C CA . TRP B 286 ? 1.143 0.924 0.356 0.108 0.009 0.064 292 TRP BBB CA 4397 C C . TRP B 286 ? 1.081 0.923 0.350 0.097 0.017 0.056 292 TRP BBB C 4398 O O . TRP B 286 ? 1.055 0.920 0.336 0.107 -0.002 0.048 292 TRP BBB O 4399 C CB . TRP B 286 ? 1.125 0.923 0.371 0.115 -0.005 0.060 292 TRP BBB CB 4400 C CG . TRP B 286 ? 1.075 0.926 0.370 0.128 -0.030 0.048 292 TRP BBB CG 4401 C CD1 . TRP B 286 ? 1.092 0.942 0.375 0.149 -0.059 0.042 292 TRP BBB CD1 4402 C CD2 . TRP B 286 ? 1.019 0.934 0.381 0.119 -0.026 0.040 292 TRP BBB CD2 4403 N NE1 . TRP B 286 ? 1.047 0.959 0.391 0.152 -0.072 0.031 292 TRP BBB NE1 4404 C CE2 . TRP B 286 ? 1.001 0.950 0.390 0.134 -0.051 0.030 292 TRP BBB CE2 4405 C CE3 . TRP B 286 ? 0.986 0.930 0.387 0.101 -0.006 0.040 292 TRP BBB CE3 4406 C CZ2 . TRP B 286 ? 0.934 0.942 0.383 0.129 -0.052 0.021 292 TRP BBB CZ2 4407 C CZ3 . TRP B 286 ? 0.925 0.924 0.381 0.098 -0.010 0.031 292 TRP BBB CZ3 4408 C CH2 . TRP B 286 ? 0.909 0.938 0.386 0.111 -0.031 0.023 292 TRP BBB CH2 4409 N N . VAL B 287 ? 1.083 0.947 0.387 0.078 0.043 0.057 293 VAL BBB N 4410 C CA . VAL B 287 ? 1.063 0.979 0.417 0.068 0.052 0.051 293 VAL BBB CA 4411 C C . VAL B 287 ? 1.117 1.018 0.438 0.071 0.056 0.050 293 VAL BBB C 4412 O O . VAL B 287 ? 1.109 1.035 0.446 0.078 0.040 0.043 293 VAL BBB O 4413 C CB . VAL B 287 ? 1.074 1.007 0.462 0.049 0.078 0.053 293 VAL BBB CB 4414 C CG1 . VAL B 287 ? 1.062 1.034 0.486 0.041 0.090 0.047 293 VAL BBB CG1 4415 C CG2 . VAL B 287 ? 1.061 1.014 0.485 0.046 0.071 0.051 293 VAL BBB CG2 4416 N N . GLN B 288 ? 1.190 1.046 0.462 0.066 0.078 0.058 294 GLN BBB N 4417 C CA . GLN B 288 ? 1.211 1.040 0.437 0.070 0.088 0.058 294 GLN BBB CA 4418 C C . GLN B 288 ? 1.186 1.007 0.388 0.088 0.054 0.052 294 GLN BBB C 4419 O O . GLN B 288 ? 1.204 1.037 0.408 0.090 0.051 0.045 294 GLN BBB O 4420 C CB . GLN B 288 ? 1.318 1.088 0.481 0.064 0.112 0.069 294 GLN BBB CB 4421 C CG . GLN B 288 ? 1.330 1.115 0.523 0.043 0.150 0.072 294 GLN BBB CG 4422 C CD . GLN B 288 ? 1.358 1.177 0.581 0.038 0.170 0.065 294 GLN BBB CD 4423 O OE1 . GLN B 288 ? 1.423 1.224 0.608 0.047 0.169 0.061 294 GLN BBB OE1 4424 N NE2 . GLN B 288 ? 1.313 1.180 0.602 0.024 0.186 0.061 294 GLN BBB NE2 4425 N N . ALA B 289 ? 1.155 0.959 0.341 0.101 0.028 0.053 295 ALA BBB N 4426 C CA . ALA B 289 ? 1.194 0.982 0.350 0.120 -0.007 0.048 295 ALA BBB CA 4427 C C . ALA B 289 ? 1.177 1.024 0.395 0.121 -0.029 0.036 295 ALA BBB C 4428 O O . ALA B 289 ? 1.225 1.067 0.427 0.132 -0.054 0.029 295 ALA BBB O 4429 C CB . ALA B 289 ? 1.219 0.969 0.339 0.134 -0.027 0.053 295 ALA BBB CB 4430 N N . HIS B 290 ? 1.107 1.006 0.391 0.110 -0.020 0.033 296 HIS BBB N 4431 C CA . HIS B 290 ? 1.041 0.995 0.385 0.110 -0.039 0.023 296 HIS BBB CA 4432 C C . HIS B 290 ? 0.985 0.981 0.377 0.095 -0.023 0.020 296 HIS BBB C 4433 O O . HIS B 290 ? 0.958 0.990 0.388 0.092 -0.036 0.013 296 HIS BBB O 4434 C CB . HIS B 290 ? 0.986 0.959 0.358 0.117 -0.051 0.022 296 HIS BBB CB 4435 C CG . HIS B 290 ? 1.018 0.956 0.351 0.137 -0.076 0.022 296 HIS BBB CG 4436 N ND1 . HIS B 290 ? 1.053 0.940 0.337 0.143 -0.069 0.032 296 HIS BBB ND1 4437 C CD2 . HIS B 290 ? 1.029 0.975 0.365 0.152 -0.107 0.014 296 HIS BBB CD2 4438 C CE1 . HIS B 290 ? 1.117 0.977 0.370 0.163 -0.098 0.029 296 HIS BBB CE1 4439 N NE2 . HIS B 290 ? 1.085 0.985 0.373 0.170 -0.122 0.018 296 HIS BBB NE2 4440 N N . SER B 291 ? 0.960 0.951 0.353 0.084 0.005 0.026 297 SER BBB N 4441 C CA . SER B 291 ? 0.907 0.933 0.343 0.072 0.019 0.023 297 SER BBB CA 4442 C C . SER B 291 ? 0.906 0.928 0.328 0.074 0.014 0.017 297 SER BBB C 4443 O O . SER B 291 ? 0.981 0.965 0.353 0.080 0.017 0.018 297 SER BBB O 4444 C CB . SER B 291 ? 0.927 0.949 0.368 0.062 0.047 0.028 297 SER BBB CB 4445 O OG . SER B 291 ? 0.911 0.966 0.394 0.054 0.056 0.024 297 SER BBB OG 4446 N N . ARG B 292 ? 0.847 0.901 0.308 0.068 0.006 0.011 298 ARG BBB N 4447 C CA . ARG B 292 ? 0.865 0.915 0.318 0.068 0.003 0.005 298 ARG BBB CA 4448 C C . ARG B 292 ? 0.808 0.882 0.297 0.060 0.018 0.004 298 ARG BBB C 4449 O O . ARG B 292 ? 0.801 0.887 0.306 0.057 0.008 -0.001 298 ARG BBB O 4450 C CB . ARG B 292 ? 0.874 0.937 0.338 0.069 -0.025 -0.002 298 ARG BBB CB 4451 C CG . ARG B 292 ? 0.932 0.980 0.372 0.079 -0.046 -0.003 298 ARG BBB CG 4452 C CD . ARG B 292 ? 1.052 1.053 0.431 0.088 -0.051 -0.005 298 ARG BBB CD 4453 N NE . ARG B 292 ? 1.151 1.134 0.503 0.101 -0.074 -0.005 298 ARG BBB NE 4454 C CZ . ARG B 292 ? 1.169 1.122 0.486 0.110 -0.070 0.002 298 ARG BBB CZ 4455 N NH1 . ARG B 292 ? 1.104 1.044 0.410 0.105 -0.041 0.011 298 ARG BBB NH1 4456 N NH2 . ARG B 292 ? 1.250 1.186 0.544 0.123 -0.097 -0.001 298 ARG BBB NH2 4457 N N A ARG B 293 ? 0.787 0.866 0.288 0.056 0.039 0.008 299 ARG BBB N 4458 N N B ARG B 293 ? 0.785 0.864 0.286 0.057 0.039 0.008 299 ARG BBB N 4459 C CA A ARG B 293 ? 0.769 0.872 0.307 0.051 0.051 0.006 299 ARG BBB CA 4460 C CA B ARG B 293 ? 0.757 0.859 0.294 0.051 0.052 0.007 299 ARG BBB CA 4461 C C A ARG B 293 ? 0.821 0.912 0.346 0.056 0.058 0.001 299 ARG BBB C 4462 C C B ARG B 293 ? 0.809 0.899 0.333 0.056 0.058 0.001 299 ARG BBB C 4463 O O A ARG B 293 ? 0.866 0.930 0.353 0.061 0.070 -0.000 299 ARG BBB O 4464 O O B ARG B 293 ? 0.852 0.915 0.339 0.061 0.071 -0.000 299 ARG BBB O 4465 C CB A ARG B 293 ? 0.764 0.874 0.318 0.046 0.071 0.011 299 ARG BBB CB 4466 C CB B ARG B 293 ? 0.737 0.846 0.289 0.046 0.072 0.011 299 ARG BBB CB 4467 C CG A ARG B 293 ? 0.748 0.880 0.338 0.043 0.083 0.007 299 ARG BBB CG 4468 C CG B ARG B 293 ? 0.690 0.829 0.289 0.041 0.078 0.009 299 ARG BBB CG 4469 C CD A ARG B 293 ? 0.763 0.908 0.377 0.035 0.099 0.010 299 ARG BBB CD 4470 C CD B ARG B 293 ? 0.693 0.835 0.300 0.043 0.096 0.004 299 ARG BBB CD 4471 N NE A ARG B 293 ? 0.776 0.937 0.417 0.035 0.116 0.005 299 ARG BBB NE 4472 N NE B ARG B 293 ? 0.666 0.834 0.316 0.037 0.107 0.003 299 ARG BBB NE 4473 C CZ A ARG B 293 ? 0.783 0.944 0.431 0.029 0.140 0.006 299 ARG BBB CZ 4474 C CZ B ARG B 293 ? 0.618 0.811 0.305 0.036 0.096 -0.000 299 ARG BBB CZ 4475 N NH1 A ARG B 293 ? 0.789 0.928 0.411 0.022 0.150 0.013 299 ARG BBB NH1 4476 N NH1 B ARG B 293 ? 0.597 0.791 0.282 0.040 0.077 -0.001 299 ARG BBB NH1 4477 N NH2 A ARG B 293 ? 0.803 0.987 0.484 0.030 0.155 -0.001 299 ARG BBB NH2 4478 N NH2 B ARG B 293 ? 0.603 0.818 0.327 0.031 0.104 -0.002 299 ARG BBB NH2 4479 N N . VAL B 294 ? 0.806 0.913 0.356 0.054 0.050 -0.004 300 VAL BBB N 4480 C CA . VAL B 294 ? 0.858 0.953 0.400 0.061 0.055 -0.011 300 VAL BBB CA 4481 C C . VAL B 294 ? 0.792 0.910 0.374 0.059 0.054 -0.012 300 VAL BBB C 4482 O O . VAL B 294 ? 0.819 0.950 0.419 0.053 0.038 -0.010 300 VAL BBB O 4483 C CB . VAL B 294 ? 0.934 1.005 0.444 0.064 0.037 -0.015 300 VAL BBB CB 4484 C CG1 . VAL B 294 ? 0.952 1.037 0.481 0.054 0.014 -0.014 300 VAL BBB CG1 4485 C CG2 . VAL B 294 ? 1.000 1.053 0.498 0.071 0.040 -0.024 300 VAL BBB CG2 4486 N N . LEU B 295 ? 0.764 0.889 0.362 0.066 0.071 -0.017 301 LEU BBB N 4487 C CA . LEU B 295 ? 0.748 0.893 0.383 0.068 0.068 -0.020 301 LEU BBB CA 4488 C C . LEU B 295 ? 0.754 0.883 0.378 0.070 0.047 -0.022 301 LEU BBB C 4489 O O . LEU B 295 ? 0.797 0.900 0.388 0.074 0.043 -0.026 301 LEU BBB O 4490 C CB . LEU B 295 ? 0.760 0.912 0.409 0.079 0.089 -0.028 301 LEU BBB CB 4491 C CG . LEU B 295 ? 0.770 0.936 0.430 0.074 0.114 -0.026 301 LEU BBB CG 4492 C CD1 . LEU B 295 ? 0.772 0.962 0.470 0.083 0.132 -0.035 301 LEU BBB CD1 4493 C CD2 . LEU B 295 ? 0.774 0.957 0.455 0.061 0.109 -0.018 301 LEU BBB CD2 4494 N N . PRO B 296 ? 0.719 0.860 0.367 0.066 0.034 -0.020 302 PRO BBB N 4495 C CA . PRO B 296 ? 0.730 0.850 0.365 0.067 0.017 -0.021 302 PRO BBB CA 4496 C C . PRO B 296 ? 0.747 0.854 0.381 0.083 0.019 -0.030 302 PRO BBB C 4497 O O . PRO B 296 ? 0.785 0.910 0.443 0.093 0.033 -0.035 302 PRO BBB O 4498 C CB . PRO B 296 ? 0.721 0.857 0.377 0.058 0.006 -0.015 302 PRO BBB CB 4499 C CG . PRO B 296 ? 0.702 0.866 0.389 0.061 0.017 -0.015 302 PRO BBB CG 4500 C CD . PRO B 296 ? 0.686 0.854 0.366 0.061 0.035 -0.016 302 PRO BBB CD 4501 N N . PRO B 297 ? 0.733 0.808 0.342 0.086 0.007 -0.034 303 PRO BBB N 4502 C CA . PRO B 297 ? 0.768 0.825 0.373 0.103 0.007 -0.043 303 PRO BBB CA 4503 C C . PRO B 297 ? 0.799 0.874 0.440 0.115 0.004 -0.046 303 PRO BBB C 4504 O O . PRO B 297 ? 0.841 0.919 0.490 0.107 -0.010 -0.038 303 PRO BBB O 4505 C CB . PRO B 297 ? 0.776 0.792 0.348 0.099 -0.012 -0.044 303 PRO BBB CB 4506 C CG . PRO B 297 ? 0.758 0.773 0.314 0.080 -0.017 -0.038 303 PRO BBB CG 4507 C CD . PRO B 297 ? 0.722 0.776 0.306 0.072 -0.009 -0.030 303 PRO BBB CD 4508 N N . CYS B 298 ? 0.845 0.932 0.504 0.133 0.018 -0.056 304 CYS BBB N 4509 C CA . CYS B 298 ? 0.882 0.983 0.576 0.150 0.012 -0.062 304 CYS BBB CA 4510 C C . CYS B 298 ? 1.000 1.068 0.675 0.170 0.005 -0.073 304 CYS BBB C 4511 O O . CYS B 298 ? 1.082 1.118 0.717 0.170 0.009 -0.076 304 CYS BBB O 4512 C CB . CYS B 298 ? 0.854 1.002 0.595 0.156 0.034 -0.069 304 CYS BBB CB 4513 S SG . CYS B 298 ? 0.821 1.000 0.577 0.133 0.047 -0.058 304 CYS BBB SG 4514 N N . ALA B 299 ? 1.044 1.118 0.746 0.189 -0.005 -0.080 305 ALA BBB N 4515 C CA . ALA B 299 ? 1.124 1.169 0.814 0.215 -0.011 -0.093 305 ALA BBB CA 4516 C C . ALA B 299 ? 1.184 1.273 0.924 0.236 0.010 -0.108 305 ALA BBB C 4517 O O . ALA B 299 ? 1.116 1.254 0.899 0.227 0.024 -0.106 305 ALA BBB O 4518 C CB . ALA B 299 ? 1.136 1.150 0.816 0.222 -0.042 -0.090 305 ALA BBB CB 4519 N N . GLN B 300 ? 1.323 1.394 1.056 0.262 0.014 -0.123 306 GLN BBB N 4520 C CA . GLN B 300 ? 1.391 1.502 1.176 0.288 0.032 -0.140 306 GLN BBB CA 4521 C C . GLN B 300 ? 1.397 1.555 1.209 0.275 0.070 -0.141 306 GLN BBB C 4522 O O . GLN B 300 ? 1.451 1.624 1.276 0.291 0.097 -0.155 306 GLN BBB O 4523 C CB . GLN B 300 ? 1.385 1.521 1.220 0.301 0.009 -0.143 306 GLN BBB CB 4524 C CG . GLN B 300 ? 1.358 1.557 1.267 0.321 0.027 -0.160 306 GLN BBB CG 4525 C CD . GLN B 300 ? 1.277 1.532 1.234 0.298 0.042 -0.153 306 GLN BBB CD 4526 O OE1 . GLN B 300 ? 1.185 1.451 1.157 0.286 0.019 -0.144 306 GLN BBB OE1 4527 N NE2 . GLN B 300 ? 1.274 1.561 1.248 0.290 0.080 -0.158 306 GLN BBB NE2 4528 N N . PRO C 8 ? 1.935 1.573 0.899 -0.341 0.015 0.129 841 PRO CCC N 4529 C CA . PRO C 8 ? 1.848 1.587 0.871 -0.378 0.038 0.120 841 PRO CCC CA 4530 C C . PRO C 8 ? 1.682 1.507 0.809 -0.329 0.046 0.095 841 PRO CCC C 4531 O O . PRO C 8 ? 1.620 1.555 0.813 -0.326 0.065 0.082 841 PRO CCC O 4532 C CB . PRO C 8 ? 1.873 1.692 0.895 -0.418 0.059 0.125 841 PRO CCC CB 4533 C CG . PRO C 8 ? 1.826 1.639 0.847 -0.372 0.054 0.123 841 PRO CCC CG 4534 C CD . PRO C 8 ? 1.896 1.575 0.855 -0.339 0.024 0.134 841 PRO CCC CD 4535 N N . ILE C 9 ? 1.651 1.424 0.786 -0.293 0.029 0.088 842 ILE CCC N 4536 C CA . ILE C 9 ? 1.550 1.389 0.772 -0.249 0.032 0.068 842 ILE CCC CA 4537 C C . ILE C 9 ? 1.392 1.305 0.659 -0.282 0.047 0.061 842 ILE CCC C 4538 O O . ILE C 9 ? 1.406 1.278 0.631 -0.324 0.044 0.069 842 ILE CCC O 4539 C CB . ILE C 9 ? 1.603 1.363 0.807 -0.206 0.009 0.063 842 ILE CCC CB 4540 C CG1 . ILE C 9 ? 1.725 1.433 0.898 -0.163 -0.006 0.065 842 ILE CCC CG1 4541 C CG2 . ILE C 9 ? 1.464 1.288 0.747 -0.176 0.013 0.046 842 ILE CCC CG2 4542 C CD1 . ILE C 9 ? 1.652 1.443 0.886 -0.132 0.005 0.055 842 ILE CCC CD1 4543 N N . PRO C 10 ? 1.224 1.244 0.577 -0.264 0.062 0.047 843 PRO CCC N 4544 C CA . PRO C 10 ? 1.187 1.285 0.585 -0.291 0.075 0.040 843 PRO CCC CA 4545 C C . PRO C 10 ? 1.206 1.264 0.603 -0.288 0.062 0.038 843 PRO CCC C 4546 O O . PRO C 10 ? 1.221 1.227 0.614 -0.248 0.048 0.035 843 PRO CCC O 4547 C CB . PRO C 10 ? 1.073 1.274 0.557 -0.257 0.086 0.024 843 PRO CCC CB 4548 C CG . PRO C 10 ? 1.025 1.208 0.503 -0.223 0.083 0.023 843 PRO CCC CG 4549 C CD . PRO C 10 ? 1.111 1.180 0.518 -0.217 0.065 0.036 843 PRO CCC CD 4550 N N . THR C 11 ? 1.213 1.302 0.612 -0.330 0.068 0.038 844 THR CCC N 4551 C CA . THR C 11 ? 1.199 1.246 0.584 -0.339 0.057 0.036 844 THR CCC CA 4552 C C . THR C 11 ? 1.180 1.250 0.624 -0.286 0.050 0.024 844 THR CCC C 4553 O O . THR C 11 ? 1.267 1.268 0.683 -0.270 0.035 0.022 844 THR CCC O 4554 C CB . THR C 11 ? 1.149 1.257 0.544 -0.392 0.068 0.035 844 THR CCC CB 4555 O OG1 . THR C 11 ? 1.183 1.304 0.539 -0.444 0.079 0.045 844 THR CCC OG1 4556 C CG2 . THR C 11 ? 1.228 1.270 0.584 -0.415 0.055 0.035 844 THR CCC CG2 4557 N N . TRP C 12 ? 1.088 1.248 0.605 -0.260 0.060 0.016 845 TRP CCC N 4558 C CA . TRP C 12 ? 1.018 1.215 0.594 -0.218 0.055 0.007 845 TRP CCC CA 4559 C C . TRP C 12 ? 1.090 1.226 0.652 -0.176 0.042 0.006 845 TRP CCC C 4560 O O . TRP C 12 ? 1.220 1.358 0.803 -0.153 0.034 0.001 845 TRP CCC O 4561 C CB . TRP C 12 ? 0.932 1.227 0.579 -0.202 0.066 0.001 845 TRP CCC CB 4562 C CG . TRP C 12 ? 0.907 1.209 0.563 -0.179 0.070 -0.001 845 TRP CCC CG 4563 C CD1 . TRP C 12 ? 0.911 1.241 0.556 -0.198 0.082 -0.001 845 TRP CCC CD1 4564 C CD2 . TRP C 12 ? 0.889 1.173 0.562 -0.136 0.063 -0.004 845 TRP CCC CD2 4565 N NE1 . TRP C 12 ? 0.923 1.251 0.579 -0.167 0.082 -0.004 845 TRP CCC NE1 4566 C CE2 . TRP C 12 ? 0.893 1.192 0.566 -0.130 0.070 -0.006 845 TRP CCC CE2 4567 C CE3 . TRP C 12 ? 0.837 1.101 0.526 -0.105 0.051 -0.005 845 TRP CCC CE3 4568 C CZ2 . TRP C 12 ? 0.850 1.139 0.537 -0.094 0.065 -0.010 845 TRP CCC CZ2 4569 C CZ3 . TRP C 12 ? 0.861 1.120 0.564 -0.072 0.047 -0.008 845 TRP CCC CZ3 4570 C CH2 . TRP C 12 ? 0.851 1.121 0.554 -0.067 0.053 -0.010 845 TRP CCC CH2 4571 N N . ALA C 13 ? 1.139 1.230 0.664 -0.166 0.039 0.011 846 ALA CCC N 4572 C CA . ALA C 13 ? 1.159 1.208 0.675 -0.122 0.028 0.008 846 ALA CCC CA 4573 C C . ALA C 13 ? 1.214 1.162 0.657 -0.121 0.011 0.010 846 ALA CCC C 4574 O O . ALA C 13 ? 1.212 1.115 0.626 -0.093 0.001 0.011 846 ALA CCC O 4575 C CB . ALA C 13 ? 1.143 1.209 0.665 -0.110 0.034 0.009 846 ALA CCC CB 4576 N N . ARG C 14 ? 1.275 1.188 0.689 -0.147 0.006 0.010 847 ARG CCC N 4577 C CA . ARG C 14 ? 1.395 1.200 0.731 -0.148 -0.013 0.011 847 ARG CCC CA 4578 C C . ARG C 14 ? 1.365 1.163 0.700 -0.164 -0.018 0.003 847 ARG CCC C 4579 O O . ARG C 14 ? 1.270 1.143 0.652 -0.189 -0.004 0.003 847 ARG CCC O 4580 C CB . ARG C 14 ? 1.550 1.292 0.817 -0.188 -0.013 0.027 847 ARG CCC CB 4581 C CG . ARG C 14 ? 1.789 1.403 0.967 -0.180 -0.037 0.030 847 ARG CCC CG 4582 C CD . ARG C 14 ? 1.969 1.512 1.071 -0.241 -0.039 0.046 847 ARG CCC CD 4583 N NE . ARG C 14 ? 2.102 1.518 1.112 -0.233 -0.062 0.055 847 ARG CCC NE 4584 C CZ . ARG C 14 ? 2.184 1.574 1.160 -0.231 -0.064 0.069 847 ARG CCC CZ 4585 N NH1 . ARG C 14 ? 2.155 1.640 1.182 -0.238 -0.042 0.073 847 ARG CCC NH1 4586 N NH2 . ARG C 14 ? 2.355 1.621 1.242 -0.221 -0.089 0.078 847 ARG CCC NH2 4587 N N . GLY C 15 ? 1.432 1.146 0.716 -0.146 -0.037 -0.005 848 GLY CCC N 4588 C CA . GLY C 15 ? 1.475 1.156 0.735 -0.164 -0.046 -0.014 848 GLY CCC CA 4589 C C . GLY C 15 ? 1.327 1.108 0.660 -0.166 -0.034 -0.022 848 GLY CCC C 4590 O O . GLY C 15 ? 1.240 1.091 0.634 -0.131 -0.029 -0.027 848 GLY CCC O 4591 N N . THR C 16 ? 1.316 1.099 0.640 -0.207 -0.033 -0.023 849 THR CCC N 4592 C CA . THR C 16 ? 1.240 1.109 0.623 -0.213 -0.025 -0.031 849 THR CCC CA 4593 C C . THR C 16 ? 1.168 1.146 0.628 -0.209 -0.007 -0.023 849 THR CCC C 4594 O O . THR C 16 ? 1.188 1.228 0.703 -0.181 -0.006 -0.028 849 THR CCC O 4595 C CB . THR C 16 ? 1.268 1.119 0.620 -0.266 -0.026 -0.032 849 THR CCC CB 4596 O OG1 . THR C 16 ? 1.294 1.072 0.600 -0.254 -0.044 -0.047 849 THR CCC OG1 4597 C CG2 . THR C 16 ? 1.176 1.137 0.592 -0.290 -0.012 -0.031 849 THR CCC CG2 4598 N N . PRO C 17 ? 1.118 1.123 0.583 -0.238 0.005 -0.012 850 PRO CCC N 4599 C CA . PRO C 17 ? 1.003 1.112 0.540 -0.234 0.020 -0.009 850 PRO CCC CA 4600 C C . PRO C 17 ? 0.943 1.082 0.526 -0.184 0.019 -0.011 850 PRO CCC C 4601 O O . PRO C 17 ? 0.911 1.126 0.553 -0.173 0.024 -0.012 850 PRO CCC O 4602 C CB . PRO C 17 ? 1.049 1.158 0.564 -0.264 0.031 0.001 850 PRO CCC CB 4603 C CG . PRO C 17 ? 1.157 1.184 0.596 -0.307 0.024 0.005 850 PRO CCC CG 4604 C CD . PRO C 17 ? 1.187 1.125 0.586 -0.278 0.005 -0.003 850 PRO CCC CD 4605 N N . LEU C 18 ? 0.968 1.047 0.520 -0.154 0.011 -0.012 851 LEU CCC N 4606 C CA . LEU C 18 ? 0.896 1.002 0.485 -0.110 0.008 -0.015 851 LEU CCC CA 4607 C C . LEU C 18 ? 0.866 0.989 0.474 -0.088 -0.000 -0.024 851 LEU CCC C 4608 O O . LEU C 18 ? 0.796 0.983 0.459 -0.074 0.003 -0.023 851 LEU CCC O 4609 C CB . LEU C 18 ? 0.944 0.985 0.489 -0.090 0.001 -0.015 851 LEU CCC CB 4610 C CG . LEU C 18 ? 0.892 0.960 0.470 -0.048 -0.001 -0.019 851 LEU CCC CG 4611 C CD1 . LEU C 18 ? 0.833 0.970 0.466 -0.049 0.011 -0.014 851 LEU CCC CD1 4612 C CD2 . LEU C 18 ? 0.912 0.915 0.441 -0.025 -0.011 -0.020 851 LEU CCC CD2 4613 N N . SER C 19 ? 0.916 0.983 0.480 -0.085 -0.012 -0.033 852 SER CCC N 4614 C CA . SER C 19 ? 0.903 0.990 0.481 -0.064 -0.020 -0.045 852 SER CCC CA 4615 C C . SER C 19 ? 0.817 0.978 0.443 -0.082 -0.013 -0.042 852 SER CCC C 4616 O O . SER C 19 ? 0.784 0.998 0.449 -0.063 -0.014 -0.043 852 SER CCC O 4617 C CB . SER C 19 ? 0.977 0.989 0.495 -0.058 -0.034 -0.059 852 SER CCC CB 4618 O OG . SER C 19 ? 1.091 1.063 0.574 -0.099 -0.034 -0.057 852 SER CCC OG 4619 N N . GLN C 20 ? 0.831 1.001 0.455 -0.119 -0.007 -0.036 853 GLN CCC N 4620 C CA . GLN C 20 ? 0.828 1.074 0.500 -0.138 -0.001 -0.032 853 GLN CCC CA 4621 C C . GLN C 20 ? 0.777 1.088 0.507 -0.120 0.005 -0.023 853 GLN CCC C 4622 O O . GLN C 20 ? 0.739 1.104 0.508 -0.113 0.003 -0.020 853 GLN CCC O 4623 C CB . GLN C 20 ? 0.907 1.155 0.564 -0.181 0.005 -0.029 853 GLN CCC CB 4624 C CG . GLN C 20 ? 1.070 1.265 0.675 -0.206 -0.003 -0.038 853 GLN CCC CG 4625 C CD . GLN C 20 ? 1.177 1.390 0.793 -0.189 -0.012 -0.049 853 GLN CCC CD 4626 O OE1 . GLN C 20 ? 1.138 1.425 0.800 -0.191 -0.009 -0.046 853 GLN CCC OE1 4627 N NE2 . GLN C 20 ? 1.249 1.397 0.822 -0.169 -0.023 -0.062 853 GLN CCC NE2 4628 N N . ALA C 21 ? 0.748 1.051 0.481 -0.114 0.011 -0.018 854 ALA CCC N 4629 C CA . ALA C 21 ? 0.631 0.983 0.412 -0.098 0.016 -0.011 854 ALA CCC CA 4630 C C . ALA C 21 ? 0.572 0.929 0.370 -0.067 0.009 -0.011 854 ALA CCC C 4631 O O . ALA C 21 ? 0.495 0.897 0.335 -0.058 0.007 -0.005 854 ALA CCC O 4632 C CB . ALA C 21 ? 0.633 0.971 0.404 -0.101 0.024 -0.010 854 ALA CCC CB 4633 N N . ILE C 22 ? 0.613 0.924 0.377 -0.052 0.003 -0.018 855 ILE CCC N 4634 C CA . ILE C 22 ? 0.674 0.997 0.450 -0.026 -0.003 -0.021 855 ILE CCC CA 4635 C C . ILE C 22 ? 0.677 1.041 0.471 -0.028 -0.008 -0.021 855 ILE CCC C 4636 O O . ILE C 22 ? 0.658 1.063 0.484 -0.020 -0.010 -0.014 855 ILE CCC O 4637 C CB . ILE C 22 ? 0.764 1.036 0.498 -0.006 -0.009 -0.031 855 ILE CCC CB 4638 C CG1 . ILE C 22 ? 0.810 1.050 0.529 -0.001 -0.005 -0.028 855 ILE CCC CG1 4639 C CG2 . ILE C 22 ? 0.712 1.013 0.457 0.018 -0.016 -0.038 855 ILE CCC CG2 4640 C CD1 . ILE C 22 ? 0.910 1.083 0.573 0.014 -0.013 -0.037 855 ILE CCC CD1 4641 N N . ILE C 23 ? 0.693 1.041 0.462 -0.041 -0.011 -0.028 856 ILE CCC N 4642 C CA . ILE C 23 ? 0.634 1.021 0.414 -0.047 -0.015 -0.031 856 ILE CCC CA 4643 C C . ILE C 23 ? 0.565 1.009 0.391 -0.058 -0.013 -0.015 856 ILE CCC C 4644 O O . ILE C 23 ? 0.546 1.031 0.394 -0.052 -0.018 -0.010 856 ILE CCC O 4645 C CB . ILE C 23 ? 0.673 1.027 0.416 -0.063 -0.018 -0.042 856 ILE CCC CB 4646 C CG1 . ILE C 23 ? 0.734 1.032 0.430 -0.043 -0.026 -0.060 856 ILE CCC CG1 4647 C CG2 . ILE C 23 ? 0.637 1.041 0.399 -0.078 -0.020 -0.041 856 ILE CCC CG2 4648 C CD1 . ILE C 23 ? 0.812 1.046 0.457 -0.060 -0.030 -0.071 856 ILE CCC CD1 4649 N N . HIS C 24 ? 0.543 0.994 0.382 -0.073 -0.008 -0.009 857 HIS CCC N 4650 C CA . HIS C 24 ? 0.512 1.015 0.394 -0.077 -0.009 0.004 857 HIS CCC CA 4651 C C . HIS C 24 ? 0.480 0.992 0.387 -0.057 -0.013 0.013 857 HIS CCC C 4652 O O . HIS C 24 ? 0.489 1.033 0.419 -0.055 -0.020 0.024 857 HIS CCC O 4653 C CB . HIS C 24 ? 0.511 1.026 0.402 -0.092 -0.003 0.004 857 HIS CCC CB 4654 C CG . HIS C 24 ? 0.519 1.087 0.453 -0.087 -0.007 0.013 857 HIS CCC CG 4655 N ND1 . HIS C 24 ? 0.518 1.091 0.477 -0.068 -0.008 0.018 857 HIS CCC ND1 4656 C CD2 . HIS C 24 ? 0.560 1.175 0.515 -0.095 -0.013 0.018 857 HIS CCC CD2 4657 C CE1 . HIS C 24 ? 0.554 1.169 0.545 -0.062 -0.015 0.025 857 HIS CCC CE1 4658 N NE2 . HIS C 24 ? 0.582 1.227 0.573 -0.078 -0.019 0.026 857 HIS CCC NE2 4659 N N . GLN C 25 ? 0.502 0.983 0.400 -0.045 -0.008 0.009 858 GLN CCC N 4660 C CA . GLN C 25 ? 0.505 0.988 0.423 -0.029 -0.012 0.016 858 GLN CCC CA 4661 C C . GLN C 25 ? 0.495 0.992 0.412 -0.025 -0.019 0.020 858 GLN CCC C 4662 O O . GLN C 25 ? 0.455 0.967 0.393 -0.022 -0.026 0.031 858 GLN CCC O 4663 C CB . GLN C 25 ? 0.489 0.937 0.391 -0.020 -0.006 0.009 858 GLN CCC CB 4664 C CG . GLN C 25 ? 0.490 0.941 0.414 -0.007 -0.009 0.014 858 GLN CCC CG 4665 C CD . GLN C 25 ? 0.570 0.996 0.483 0.000 -0.001 0.006 858 GLN CCC CD 4666 O OE1 . GLN C 25 ? 0.603 1.029 0.514 -0.007 0.006 0.003 858 GLN CCC OE1 4667 N NE2 . GLN C 25 ? 0.576 0.986 0.481 0.012 -0.003 0.004 858 GLN CCC NE2 4668 N N . TYR C 26 ? 0.490 0.983 0.382 -0.025 -0.019 0.009 859 TYR CCC N 4669 C CA . TYR C 26 ? 0.531 1.050 0.421 -0.020 -0.024 0.008 859 TYR CCC CA 4670 C C . TYR C 26 ? 0.539 1.101 0.445 -0.035 -0.030 0.021 859 TYR CCC C 4671 O O . TYR C 26 ? 0.507 1.095 0.427 -0.038 -0.036 0.032 859 TYR CCC O 4672 C CB . TYR C 26 ? 0.568 1.072 0.425 -0.009 -0.023 -0.011 859 TYR CCC CB 4673 C CG . TYR C 26 ? 0.591 1.137 0.448 -0.003 -0.028 -0.017 859 TYR CCC CG 4674 C CD1 . TYR C 26 ? 0.564 1.119 0.423 0.010 -0.029 -0.020 859 TYR CCC CD1 4675 C CD2 . TYR C 26 ? 0.673 1.258 0.530 -0.012 -0.031 -0.018 859 TYR CCC CD2 4676 C CE1 . TYR C 26 ? 0.614 1.221 0.474 0.012 -0.032 -0.026 859 TYR CCC CE1 4677 C CE2 . TYR C 26 ? 0.676 1.312 0.532 -0.009 -0.033 -0.024 859 TYR CCC CE2 4678 C CZ . TYR C 26 ? 0.686 1.335 0.545 0.002 -0.034 -0.028 859 TYR CCC CZ 4679 O OH . TYR C 26 ? 0.755 1.467 0.615 0.002 -0.035 -0.035 859 TYR CCC OH 4680 N N . TYR C 27 ? 0.548 1.118 0.452 -0.045 -0.030 0.019 860 TYR CCC N 4681 C CA . TYR C 27 ? 0.550 1.162 0.462 -0.059 -0.037 0.028 860 TYR CCC CA 4682 C C . TYR C 27 ? 0.552 1.177 0.492 -0.064 -0.043 0.048 860 TYR CCC C 4683 O O . TYR C 27 ? 0.635 1.293 0.583 -0.074 -0.052 0.061 860 TYR CCC O 4684 C CB . TYR C 27 ? 0.548 1.164 0.442 -0.068 -0.035 0.015 860 TYR CCC CB 4685 C CG . TYR C 27 ? 0.537 1.142 0.400 -0.059 -0.033 -0.007 860 TYR CCC CG 4686 C CD1 . TYR C 27 ? 0.520 1.166 0.379 -0.056 -0.037 -0.011 860 TYR CCC CD1 4687 C CD2 . TYR C 27 ? 0.563 1.115 0.397 -0.051 -0.030 -0.024 860 TYR CCC CD2 4688 C CE1 . TYR C 27 ? 0.563 1.205 0.395 -0.042 -0.037 -0.035 860 TYR CCC CE1 4689 C CE2 . TYR C 27 ? 0.592 1.128 0.395 -0.036 -0.032 -0.046 860 TYR CCC CE2 4690 C CZ . TYR C 27 ? 0.590 1.173 0.393 -0.029 -0.035 -0.053 860 TYR CCC CZ 4691 O OH . TYR C 27 ? 0.601 1.172 0.374 -0.008 -0.039 -0.079 860 TYR CCC OH 4692 N N . HIS C 28 ? 0.528 1.130 0.481 -0.057 -0.040 0.049 861 HIS CCC N 4693 C CA . HIS C 28 ? 0.572 1.186 0.551 -0.054 -0.048 0.062 861 HIS CCC CA 4694 C C . HIS C 28 ? 0.569 1.155 0.559 -0.039 -0.048 0.063 861 HIS CCC C 4695 O O . HIS C 28 ? 0.553 1.137 0.557 -0.032 -0.045 0.058 861 HIS CCC O 4696 C CB . HIS C 28 ? 0.604 1.238 0.590 -0.061 -0.045 0.056 861 HIS CCC CB 4697 C CG . HIS C 28 ? 0.603 1.265 0.579 -0.077 -0.047 0.054 861 HIS CCC CG 4698 N ND1 . HIS C 28 ? 0.611 1.259 0.558 -0.086 -0.040 0.039 861 HIS CCC ND1 4699 C CD2 . HIS C 28 ? 0.581 1.282 0.568 -0.085 -0.056 0.064 861 HIS CCC CD2 4700 C CE1 . HIS C 28 ? 0.611 1.290 0.553 -0.099 -0.044 0.039 861 HIS CCC CE1 4701 N NE2 . HIS C 28 ? 0.634 1.349 0.601 -0.100 -0.053 0.055 861 HIS CCC NE2 4702 N N . PRO C 29 ? 0.580 1.149 0.565 -0.036 -0.051 0.068 862 PRO CCC N 4703 C CA . PRO C 29 ? 0.589 1.129 0.581 -0.023 -0.051 0.066 862 PRO CCC CA 4704 C C . PRO C 29 ? 0.599 1.135 0.611 -0.014 -0.064 0.077 862 PRO CCC C 4705 O O . PRO C 29 ? 0.671 1.223 0.690 -0.018 -0.076 0.090 862 PRO CCC O 4706 C CB . PRO C 29 ? 0.600 1.135 0.579 -0.028 -0.054 0.070 862 PRO CCC CB 4707 C CG . PRO C 29 ? 0.569 1.134 0.545 -0.044 -0.062 0.084 862 PRO CCC CG 4708 C CD . PRO C 29 ? 0.575 1.160 0.548 -0.047 -0.056 0.076 862 PRO CCC CD 4709 N N . PRO C 30 ? 0.598 1.111 0.620 0.002 -0.063 0.069 863 PRO CCC N 4710 C CA . PRO C 30 ? 0.599 1.104 0.639 0.017 -0.077 0.075 863 PRO CCC CA 4711 C C . PRO C 30 ? 0.608 1.077 0.641 0.016 -0.093 0.089 863 PRO CCC C 4712 O O . PRO C 30 ? 0.613 1.073 0.630 0.003 -0.089 0.090 863 PRO CCC O 4713 C CB . PRO C 30 ? 0.612 1.115 0.661 0.033 -0.066 0.056 863 PRO CCC CB 4714 C CG . PRO C 30 ? 0.629 1.112 0.658 0.025 -0.053 0.047 863 PRO CCC CG 4715 C CD . PRO C 30 ? 0.614 1.107 0.626 0.007 -0.050 0.054 863 PRO CCC CD 4716 N N . ASN C 31 ? 0.644 1.093 0.686 0.030 -0.112 0.097 864 ASN CCC N 4717 C CA . ASN C 31 ? 0.690 1.088 0.721 0.030 -0.130 0.108 864 ASN CCC CA 4718 C C . ASN C 31 ? 0.707 1.084 0.738 0.040 -0.120 0.088 864 ASN CCC C 4719 O O . ASN C 31 ? 0.707 1.089 0.754 0.064 -0.115 0.070 864 ASN CCC O 4720 C CB . ASN C 31 ? 0.724 1.096 0.759 0.049 -0.156 0.119 864 ASN CCC CB 4721 C CG . ASN C 31 ? 0.788 1.097 0.802 0.041 -0.179 0.135 864 ASN CCC CG 4722 O OD1 . ASN C 31 ? 0.831 1.113 0.834 0.031 -0.174 0.130 864 ASN CCC OD1 4723 N ND2 . ASN C 31 ? 0.811 1.092 0.815 0.044 -0.205 0.156 864 ASN CCC ND2 4724 N N . LEU C 32 ? 0.690 1.052 0.705 0.023 -0.116 0.090 865 LEU CCC N 4725 C CA . LEU C 32 ? 0.658 1.005 0.670 0.029 -0.105 0.073 865 LEU CCC CA 4726 C C . LEU C 32 ? 0.722 1.018 0.733 0.043 -0.122 0.069 865 LEU CCC C 4727 O O . LEU C 32 ? 0.704 0.995 0.723 0.062 -0.115 0.049 865 LEU CCC O 4728 C CB . LEU C 32 ? 0.610 0.967 0.606 0.005 -0.098 0.076 865 LEU CCC CB 4729 C CG . LEU C 32 ? 0.543 0.943 0.534 -0.002 -0.081 0.072 865 LEU CCC CG 4730 C CD1 . LEU C 32 ? 0.513 0.930 0.490 -0.019 -0.077 0.072 865 LEU CCC CD1 4731 C CD2 . LEU C 32 ? 0.534 0.941 0.530 0.015 -0.065 0.053 865 LEU CCC CD2 4732 N N . LEU C 33 ? 0.823 1.083 0.824 0.034 -0.146 0.088 866 LEU CCC N 4733 C CA . LEU C 33 ? 0.971 1.166 0.963 0.047 -0.168 0.087 866 LEU CCC CA 4734 C C . LEU C 33 ? 0.994 1.187 1.006 0.088 -0.172 0.068 866 LEU CCC C 4735 O O . LEU C 33 ? 1.039 1.194 1.050 0.107 -0.181 0.052 866 LEU CCC O 4736 C CB . LEU C 33 ? 1.087 1.239 1.056 0.027 -0.195 0.116 866 LEU CCC CB 4737 C CG . LEU C 33 ? 1.160 1.230 1.112 0.039 -0.224 0.118 866 LEU CCC CG 4738 C CD1 . LEU C 33 ? 1.199 1.239 1.141 0.030 -0.221 0.102 866 LEU CCC CD1 4739 C CD2 . LEU C 33 ? 1.183 1.207 1.106 0.013 -0.252 0.151 866 LEU CCC CD2 4740 N N . GLU C 34 ? 0.997 1.235 1.027 0.101 -0.167 0.068 867 GLU CCC N 4741 C CA . GLU C 34 ? 1.029 1.285 1.083 0.140 -0.171 0.048 867 GLU CCC CA 4742 C C . GLU C 34 ? 0.943 1.246 1.012 0.148 -0.143 0.022 867 GLU CCC C 4743 O O . GLU C 34 ? 1.007 1.318 1.091 0.178 -0.145 -0.001 867 GLU CCC O 4744 C CB . GLU C 34 ? 1.158 1.447 1.223 0.147 -0.180 0.061 867 GLU CCC CB 4745 C CG . GLU C 34 ? 1.209 1.573 1.291 0.136 -0.154 0.055 867 GLU CCC CG 4746 C CD . GLU C 34 ? 1.338 1.741 1.432 0.141 -0.163 0.065 867 GLU CCC CD 4747 O OE1 . GLU C 34 ? 1.309 1.688 1.405 0.164 -0.189 0.072 867 GLU CCC OE1 4748 O OE2 . GLU C 34 ? 1.441 1.895 1.541 0.123 -0.145 0.065 867 GLU CCC OE2 4749 N N . LEU C 35 ? 0.867 1.200 0.931 0.122 -0.121 0.025 868 LEU CCC N 4750 C CA . LEU C 35 ? 0.770 1.142 0.839 0.122 -0.095 0.005 868 LEU CCC CA 4751 C C . LEU C 35 ? 0.735 1.078 0.795 0.128 -0.091 -0.010 868 LEU CCC C 4752 O O . LEU C 35 ? 0.697 1.064 0.766 0.145 -0.081 -0.032 868 LEU CCC O 4753 C CB . LEU C 35 ? 0.701 1.099 0.760 0.095 -0.078 0.015 868 LEU CCC CB 4754 C CG . LEU C 35 ? 0.629 1.068 0.689 0.091 -0.056 0.002 868 LEU CCC CG 4755 C CD1 . LEU C 35 ? 0.604 1.086 0.687 0.104 -0.057 -0.005 868 LEU CCC CD1 4756 C CD2 . LEU C 35 ? 0.598 1.047 0.642 0.067 -0.045 0.012 868 LEU CCC CD2 4757 N N . PHE C 36 ? 0.698 1.000 0.740 0.113 -0.099 -0.001 869 PHE CCC N 4758 C CA . PHE C 36 ? 0.690 0.970 0.720 0.113 -0.094 -0.015 869 PHE CCC CA 4759 C C . PHE C 36 ? 0.727 0.949 0.749 0.119 -0.117 -0.016 869 PHE CCC C 4760 O O . PHE C 36 ? 0.790 0.993 0.802 0.119 -0.115 -0.029 869 PHE CCC O 4761 C CB . PHE C 36 ? 0.654 0.942 0.667 0.087 -0.083 -0.006 869 PHE CCC CB 4762 C CG . PHE C 36 ? 0.629 0.959 0.642 0.081 -0.062 -0.007 869 PHE CCC CG 4763 C CD1 . PHE C 36 ? 0.628 0.973 0.636 0.089 -0.046 -0.024 869 PHE CCC CD1 4764 C CD2 . PHE C 36 ? 0.612 0.961 0.622 0.066 -0.060 0.008 869 PHE CCC CD2 4765 C CE1 . PHE C 36 ? 0.622 0.991 0.621 0.080 -0.030 -0.023 869 PHE CCC CE1 4766 C CE2 . PHE C 36 ? 0.602 0.978 0.606 0.060 -0.044 0.005 869 PHE CCC CE2 4767 C CZ . PHE C 36 ? 0.626 1.007 0.622 0.067 -0.029 -0.009 869 PHE CCC CZ 4768 N N . GLY C 37 ? 0.746 0.936 0.767 0.124 -0.140 -0.002 870 GLY CCC N 4769 C CA . GLY C 37 ? 0.819 0.938 0.825 0.129 -0.167 -0.001 870 GLY CCC CA 4770 C C . GLY C 37 ? 0.834 0.922 0.815 0.093 -0.171 0.011 870 GLY CCC C 4771 O O . GLY C 37 ? 0.763 0.891 0.742 0.068 -0.153 0.019 870 GLY CCC O 4772 N N . THR C 38 ? 0.958 0.976 0.919 0.091 -0.195 0.011 871 THR CCC N 4773 C CA . THR C 38 ? 1.045 1.027 0.979 0.052 -0.204 0.024 871 THR CCC CA 4774 C C . THR C 38 ? 1.002 1.000 0.936 0.051 -0.188 0.000 871 THR CCC C 4775 O O . THR C 38 ? 1.051 1.033 0.992 0.082 -0.189 -0.026 871 THR CCC O 4776 C CB . THR C 38 ? 1.213 1.103 1.120 0.047 -0.240 0.037 871 THR CCC CB 4777 O OG1 . THR C 38 ? 1.338 1.206 1.216 -0.003 -0.248 0.059 871 THR CCC OG1 4778 C CG2 . THR C 38 ? 1.292 1.123 1.193 0.079 -0.255 0.009 871 THR CCC CG2 4779 N N . ILE C 39 ? 0.967 1.001 0.895 0.018 -0.175 0.008 872 ILE CCC N 4780 C CA . ILE C 39 ? 0.966 1.023 0.891 0.014 -0.161 -0.013 872 ILE CCC CA 4781 C C . ILE C 39 ? 1.031 1.022 0.935 0.003 -0.182 -0.021 872 ILE CCC C 4782 O O . ILE C 39 ? 1.052 1.015 0.934 -0.035 -0.197 -0.002 872 ILE CCC O 4783 C CB . ILE C 39 ? 0.963 1.079 0.886 -0.015 -0.145 -0.002 872 ILE CCC CB 4784 C CG1 . ILE C 39 ? 0.936 1.107 0.876 -0.004 -0.127 0.005 872 ILE CCC CG1 4785 C CG2 . ILE C 39 ? 0.949 1.089 0.868 -0.017 -0.134 -0.022 872 ILE CCC CG2 4786 C CD1 . ILE C 39 ? 0.912 1.140 0.849 -0.026 -0.115 0.013 872 ILE CCC CD1 4787 N N . LEU C 40 ? 1.072 1.038 0.978 0.033 -0.184 -0.048 873 LEU CCC N 4788 C CA . LEU C 40 ? 1.166 1.059 1.049 0.028 -0.206 -0.061 873 LEU CCC CA 4789 C C . LEU C 40 ? 1.117 1.038 0.992 0.005 -0.196 -0.074 873 LEU CCC C 4790 O O . LEU C 40 ? 1.053 1.040 0.943 0.014 -0.171 -0.083 873 LEU CCC O 4791 C CB . LEU C 40 ? 1.292 1.153 1.183 0.076 -0.214 -0.089 873 LEU CCC CB 4792 C CG . LEU C 40 ? 1.365 1.284 1.275 0.105 -0.189 -0.118 873 LEU CCC CG 4793 C CD1 . LEU C 40 ? 1.442 1.325 1.336 0.110 -0.197 -0.147 873 LEU CCC CD1 4794 C CD2 . LEU C 40 ? 1.412 1.357 1.346 0.147 -0.183 -0.130 873 LEU CCC CD2 4795 N N . PRO C 41 ? 1.140 1.008 0.987 -0.026 -0.215 -0.074 874 PRO CCC N 4796 C CA . PRO C 41 ? 1.090 0.992 0.929 -0.053 -0.207 -0.084 874 PRO CCC CA 4797 C C . PRO C 41 ? 1.024 0.958 0.875 -0.020 -0.190 -0.116 874 PRO CCC C 4798 O O . PRO C 41 ? 1.012 0.909 0.865 0.015 -0.196 -0.137 874 PRO CCC O 4799 C CB . PRO C 41 ? 1.193 1.015 0.997 -0.089 -0.235 -0.082 874 PRO CCC CB 4800 C CG . PRO C 41 ? 1.268 0.998 1.060 -0.065 -0.260 -0.079 874 PRO CCC CG 4801 C CD . PRO C 41 ? 1.221 0.991 1.040 -0.038 -0.248 -0.064 874 PRO CCC CD 4802 N N . LEU C 42 ? 0.999 1.004 0.856 -0.030 -0.171 -0.121 875 LEU CCC N 4803 C CA . LEU C 42 ? 0.986 1.030 0.849 -0.005 -0.154 -0.147 875 LEU CCC CA 4804 C C . LEU C 42 ? 1.059 1.057 0.904 -0.007 -0.169 -0.173 875 LEU CCC C 4805 O O . LEU C 42 ? 1.045 1.037 0.873 -0.044 -0.179 -0.172 875 LEU CCC O 4806 C CB . LEU C 42 ? 0.930 1.051 0.797 -0.018 -0.137 -0.141 875 LEU CCC CB 4807 C CG . LEU C 42 ? 0.900 1.064 0.769 0.009 -0.119 -0.160 875 LEU CCC CG 4808 C CD1 . LEU C 42 ? 0.878 1.059 0.762 0.040 -0.103 -0.157 875 LEU CCC CD1 4809 C CD2 . LEU C 42 ? 0.869 1.097 0.734 -0.006 -0.111 -0.158 875 LEU CCC CD2 4810 N N . ASP C 43 ? 1.121 1.093 0.969 0.030 -0.169 -0.197 876 ASP CCC N 4811 C CA . ASP C 43 ? 1.231 1.158 1.062 0.038 -0.182 -0.229 876 ASP CCC CA 4812 C C . ASP C 43 ? 1.206 1.195 1.036 0.041 -0.164 -0.248 876 ASP CCC C 4813 O O . ASP C 43 ? 1.216 1.245 1.058 0.074 -0.147 -0.261 876 ASP CCC O 4814 C CB . ASP C 43 ? 1.297 1.180 1.134 0.081 -0.191 -0.248 876 ASP CCC CB 4815 C CG . ASP C 43 ? 1.376 1.188 1.191 0.091 -0.213 -0.280 876 ASP CCC CG 4816 O OD1 . ASP C 43 ? 1.345 1.153 1.142 0.066 -0.217 -0.291 876 ASP CCC OD1 4817 O OD2 . ASP C 43 ? 1.451 1.212 1.266 0.125 -0.228 -0.294 876 ASP CCC OD2 4818 N N . LEU C 44 ? 1.192 1.193 1.007 0.006 -0.169 -0.248 877 LEU CCC N 4819 C CA . LEU C 44 ? 1.135 1.203 0.947 0.006 -0.154 -0.261 877 LEU CCC CA 4820 C C . LEU C 44 ? 1.140 1.196 0.944 0.031 -0.154 -0.297 877 LEU CCC C 4821 O O . LEU C 44 ? 1.067 1.180 0.874 0.051 -0.135 -0.307 877 LEU CCC O 4822 C CB . LEU C 44 ? 1.156 1.243 0.956 -0.039 -0.163 -0.254 877 LEU CCC CB 4823 C CG . LEU C 44 ? 1.140 1.268 0.950 -0.065 -0.159 -0.223 877 LEU CCC CG 4824 C CD1 . LEU C 44 ? 1.171 1.336 0.969 -0.109 -0.166 -0.222 877 LEU CCC CD1 4825 C CD2 . LEU C 44 ? 1.038 1.230 0.865 -0.037 -0.136 -0.212 877 LEU CCC CD2 4826 N N . GLU C 45 ? 1.222 1.205 1.012 0.032 -0.175 -0.317 878 GLU CCC N 4827 C CA . GLU C 45 ? 1.319 1.286 1.099 0.059 -0.177 -0.356 878 GLU CCC CA 4828 C C . GLU C 45 ? 1.326 1.324 1.125 0.105 -0.159 -0.365 878 GLU CCC C 4829 O O . GLU C 45 ? 1.323 1.362 1.119 0.125 -0.147 -0.390 878 GLU CCC O 4830 C CB . GLU C 45 ? 1.454 1.323 1.211 0.052 -0.207 -0.376 878 GLU CCC CB 4831 C CG . GLU C 45 ? 1.526 1.327 1.289 0.073 -0.222 -0.368 878 GLU CCC CG 4832 C CD . GLU C 45 ? 1.653 1.343 1.386 0.073 -0.256 -0.389 878 GLU CCC CD 4833 O OE1 . GLU C 45 ? 1.663 1.320 1.397 0.119 -0.264 -0.419 878 GLU CCC OE1 4834 O OE2 . GLU C 45 ? 1.745 1.384 1.453 0.027 -0.276 -0.376 878 GLU CCC OE2 4835 N N . ASP C 46 ? 1.395 1.382 1.211 0.118 -0.159 -0.346 879 ASP CCC N 4836 C CA . ASP C 46 ? 1.443 1.462 1.279 0.158 -0.143 -0.353 879 ASP CCC CA 4837 C C . ASP C 46 ? 1.294 1.396 1.139 0.157 -0.115 -0.339 879 ASP CCC C 4838 O O . ASP C 46 ? 1.303 1.447 1.153 0.182 -0.099 -0.354 879 ASP CCC O 4839 C CB . ASP C 46 ? 1.529 1.509 1.379 0.169 -0.154 -0.336 879 ASP CCC CB 4840 C CG . ASP C 46 ? 1.583 1.587 1.453 0.213 -0.146 -0.353 879 ASP CCC CG 4841 O OD1 . ASP C 46 ? 1.599 1.579 1.465 0.242 -0.157 -0.389 879 ASP CCC OD1 4842 O OD2 . ASP C 46 ? 1.549 1.597 1.438 0.217 -0.131 -0.333 879 ASP CCC OD2 4843 N N . ILE C 47 ? 1.172 1.296 1.014 0.128 -0.110 -0.311 880 ILE CCC N 4844 C CA . ILE C 47 ? 1.061 1.248 0.907 0.127 -0.088 -0.291 880 ILE CCC CA 4845 C C . ILE C 47 ? 1.009 1.238 0.837 0.122 -0.079 -0.301 880 ILE CCC C 4846 O O . ILE C 47 ? 0.970 1.241 0.793 0.135 -0.061 -0.299 880 ILE CCC O 4847 C CB . ILE C 47 ? 1.029 1.215 0.884 0.106 -0.090 -0.257 880 ILE CCC CB 4848 C CG1 . ILE C 47 ? 1.115 1.273 0.988 0.118 -0.094 -0.246 880 ILE CCC CG1 4849 C CG2 . ILE C 47 ? 0.942 1.183 0.794 0.104 -0.072 -0.239 880 ILE CCC CG2 4850 C CD1 . ILE C 47 ? 1.153 1.305 1.032 0.095 -0.099 -0.214 880 ILE CCC CD1 4851 N N . PHE C 48 ? 1.009 1.228 0.824 0.102 -0.092 -0.309 881 PHE CCC N 4852 C CA . PHE C 48 ? 1.051 1.315 0.848 0.095 -0.086 -0.315 881 PHE CCC CA 4853 C C . PHE C 48 ? 1.163 1.419 0.945 0.099 -0.093 -0.349 881 PHE CCC C 4854 O O . PHE C 48 ? 1.231 1.436 1.014 0.103 -0.106 -0.369 881 PHE CCC O 4855 C CB . PHE C 48 ? 1.065 1.347 0.862 0.067 -0.093 -0.296 881 PHE CCC CB 4856 C CG . PHE C 48 ? 1.041 1.343 0.849 0.067 -0.085 -0.265 881 PHE CCC CG 4857 C CD1 . PHE C 48 ? 1.032 1.367 0.836 0.086 -0.069 -0.256 881 PHE CCC CD1 4858 C CD2 . PHE C 48 ? 1.070 1.355 0.890 0.046 -0.094 -0.247 881 PHE CCC CD2 4859 C CE1 . PHE C 48 ? 1.047 1.394 0.858 0.087 -0.063 -0.231 881 PHE CCC CE1 4860 C CE2 . PHE C 48 ? 1.015 1.322 0.845 0.047 -0.086 -0.222 881 PHE CCC CE2 4861 C CZ . PHE C 48 ? 0.991 1.327 0.818 0.069 -0.071 -0.215 881 PHE CCC CZ 4862 N N . LYS C 49 ? 1.167 1.470 0.932 0.100 -0.085 -0.357 882 LYS CCC N 4863 C CA . LYS C 49 ? 1.242 1.550 0.989 0.104 -0.089 -0.390 882 LYS CCC CA 4864 C C . LYS C 49 ? 1.321 1.610 1.061 0.074 -0.109 -0.399 882 LYS CCC C 4865 O O . LYS C 49 ? 1.442 1.722 1.191 0.051 -0.117 -0.378 882 LYS CCC O 4866 C CB . LYS C 49 ? 1.249 1.616 0.976 0.115 -0.075 -0.390 882 LYS CCC CB 4867 C CG . LYS C 49 ? 1.232 1.639 0.950 0.101 -0.077 -0.371 882 LYS CCC CG 4868 C CD . LYS C 49 ? 1.149 1.598 0.847 0.117 -0.063 -0.357 882 LYS CCC CD 4869 C CE . LYS C 49 ? 1.124 1.593 0.799 0.130 -0.055 -0.379 882 LYS CCC CE 4870 N NZ . LYS C 49 ? 1.121 1.599 0.786 0.120 -0.067 -0.408 882 LYS CCC NZ 4871 N N . LYS C 50 ? 1.317 1.604 1.039 0.072 -0.116 -0.431 883 LYS CCC N 4872 C CA . LYS C 50 ? 1.346 1.613 1.056 0.040 -0.136 -0.446 883 LYS CCC CA 4873 C C . LYS C 50 ? 1.401 1.584 1.115 0.025 -0.155 -0.448 883 LYS CCC C 4874 O O . LYS C 50 ? 1.393 1.533 1.118 0.046 -0.155 -0.444 883 LYS CCC O 4875 C CB . LYS C 50 ? 1.293 1.613 1.003 0.013 -0.138 -0.425 883 LYS CCC CB 4876 C CG . LYS C 50 ? 1.236 1.632 0.938 0.030 -0.124 -0.420 883 LYS CCC CG 4877 C CD . LYS C 50 ? 1.237 1.685 0.927 0.008 -0.133 -0.426 883 LYS CCC CD 4878 C CE . LYS C 50 ? 1.267 1.705 0.939 -0.005 -0.145 -0.462 883 LYS CCC CE 4879 N NZ . LYS C 50 ? 1.260 1.768 0.919 -0.017 -0.149 -0.469 883 LYS CCC NZ 4880 N N . PRO D 8 ? 1.319 2.195 0.961 -0.384 0.197 0.038 841 PRO DDD N 4881 C CA . PRO D 8 ? 1.366 2.136 0.942 -0.418 0.164 0.072 841 PRO DDD CA 4882 C C . PRO D 8 ? 1.345 2.022 0.924 -0.367 0.128 0.075 841 PRO DDD C 4883 O O . PRO D 8 ? 1.444 2.018 0.953 -0.362 0.108 0.089 841 PRO DDD O 4884 C CB . PRO D 8 ? 1.449 2.155 0.920 -0.458 0.169 0.091 841 PRO DDD CB 4885 C CG . PRO D 8 ? 1.406 2.130 0.881 -0.414 0.186 0.067 841 PRO DDD CG 4886 C CD . PRO D 8 ? 1.344 2.197 0.925 -0.382 0.214 0.033 841 PRO DDD CD 4887 N N . ILE D 9 ? 1.265 1.982 0.922 -0.330 0.121 0.059 842 ILE DDD N 4888 C CA . ILE D 9 ? 1.190 1.835 0.858 -0.281 0.093 0.058 842 ILE DDD CA 4889 C C . ILE D 9 ? 1.085 1.645 0.707 -0.309 0.064 0.083 842 ILE DDD C 4890 O O . ILE D 9 ? 1.072 1.661 0.702 -0.350 0.062 0.094 842 ILE DDD O 4891 C CB . ILE D 9 ? 1.177 1.894 0.937 -0.239 0.095 0.033 842 ILE DDD CB 4892 C CG1 . ILE D 9 ? 1.222 1.995 1.016 -0.200 0.116 0.006 842 ILE DDD CG1 4893 C CG2 . ILE D 9 ? 1.104 1.752 0.871 -0.206 0.066 0.037 842 ILE DDD CG2 4894 C CD1 . ILE D 9 ? 1.176 2.027 1.058 -0.162 0.119 -0.020 842 ILE DDD CD1 4895 N N . PRO D 10 ? 1.010 1.464 0.583 -0.287 0.040 0.092 843 PRO DDD N 4896 C CA . PRO D 10 ? 1.043 1.408 0.566 -0.308 0.012 0.113 843 PRO DDD CA 4897 C C . PRO D 10 ? 1.039 1.426 0.613 -0.300 0.002 0.108 843 PRO DDD C 4898 O O . PRO D 10 ? 0.998 1.437 0.636 -0.262 0.008 0.089 843 PRO DDD O 4899 C CB . PRO D 10 ? 1.027 1.294 0.506 -0.272 -0.007 0.115 843 PRO DDD CB 4900 C CG . PRO D 10 ? 0.994 1.295 0.487 -0.244 0.010 0.100 843 PRO DDD CG 4901 C CD . PRO D 10 ? 0.960 1.375 0.526 -0.240 0.037 0.082 843 PRO DDD CD 4902 N N . THR D 11 ? 1.075 1.416 0.614 -0.337 -0.018 0.126 844 THR DDD N 4903 C CA . THR D 11 ? 1.051 1.412 0.629 -0.341 -0.031 0.124 844 THR DDD CA 4904 C C . THR D 11 ? 1.087 1.416 0.690 -0.286 -0.041 0.110 844 THR DDD C 4905 O O . THR D 11 ? 1.098 1.481 0.759 -0.273 -0.043 0.100 844 THR DDD O 4906 C CB . THR D 11 ? 1.091 1.383 0.607 -0.392 -0.054 0.147 844 THR DDD CB 4907 O OG1 . THR D 11 ? 1.144 1.315 0.586 -0.376 -0.073 0.155 844 THR DDD OG1 4908 C CG2 . THR D 11 ? 1.122 1.457 0.619 -0.456 -0.043 0.162 844 THR DDD CG2 4909 N N . TRP D 12 ? 1.109 1.356 0.671 -0.255 -0.049 0.109 845 TRP DDD N 4910 C CA . TRP D 12 ? 1.067 1.275 0.641 -0.208 -0.057 0.098 845 TRP DDD CA 4911 C C . TRP D 12 ? 1.036 1.317 0.679 -0.171 -0.041 0.078 845 TRP DDD C 4912 O O . TRP D 12 ? 1.223 1.496 0.889 -0.146 -0.049 0.070 845 TRP DDD O 4913 C CB . TRP D 12 ? 1.085 1.204 0.607 -0.185 -0.066 0.099 845 TRP DDD CB 4914 C CG . TRP D 12 ? 1.048 1.182 0.572 -0.166 -0.053 0.094 845 TRP DDD CG 4915 C CD1 . TRP D 12 ? 1.096 1.209 0.576 -0.189 -0.054 0.105 845 TRP DDD CD1 4916 C CD2 . TRP D 12 ? 0.979 1.146 0.546 -0.124 -0.041 0.077 845 TRP DDD CD2 4917 N NE1 . TRP D 12 ? 1.090 1.223 0.583 -0.162 -0.043 0.096 845 TRP DDD NE1 4918 C CE2 . TRP D 12 ? 1.003 1.170 0.552 -0.123 -0.035 0.078 845 TRP DDD CE2 4919 C CE3 . TRP D 12 ? 0.908 1.099 0.523 -0.091 -0.037 0.062 845 TRP DDD CE3 4920 C CZ2 . TRP D 12 ? 0.947 1.140 0.526 -0.089 -0.026 0.064 845 TRP DDD CZ2 4921 C CZ3 . TRP D 12 ? 0.878 1.093 0.521 -0.059 -0.027 0.049 845 TRP DDD CZ3 4922 C CH2 . TRP D 12 ? 0.889 1.105 0.516 -0.058 -0.022 0.050 845 TRP DDD CH2 4923 N N . ALA D 13 ? 0.982 1.326 0.652 -0.169 -0.022 0.071 846 ALA DDD N 4924 C CA . ALA D 13 ? 0.895 1.297 0.621 -0.131 -0.009 0.051 846 ALA DDD CA 4925 C C . ALA D 13 ? 0.840 1.336 0.628 -0.137 -0.002 0.041 846 ALA DDD C 4926 O O . ALA D 13 ? 0.769 1.324 0.597 -0.116 0.014 0.024 846 ALA DDD O 4927 C CB . ALA D 13 ? 0.888 1.294 0.599 -0.121 0.006 0.046 846 ALA DDD CB 4928 N N . ARG D 14 ? 0.914 1.421 0.711 -0.164 -0.014 0.050 847 ARG DDD N 4929 C CA . ARG D 14 ? 0.925 1.529 0.789 -0.174 -0.012 0.041 847 ARG DDD CA 4930 C C . ARG D 14 ? 0.930 1.512 0.796 -0.190 -0.038 0.050 847 ARG DDD C 4931 O O . ARG D 14 ? 0.999 1.494 0.804 -0.206 -0.052 0.066 847 ARG DDD O 4932 C CB . ARG D 14 ? 0.992 1.662 0.859 -0.215 0.008 0.045 847 ARG DDD CB 4933 C CG . ARG D 14 ? 1.049 1.842 0.998 -0.210 0.022 0.026 847 ARG DDD CG 4934 C CD . ARG D 14 ? 1.154 2.020 1.117 -0.266 0.032 0.034 847 ARG DDD CD 4935 N NE . ARG D 14 ? 1.141 2.133 1.177 -0.259 0.058 0.011 847 ARG DDD NE 4936 C CZ . ARG D 14 ? 1.153 2.186 1.181 -0.261 0.090 0.001 847 ARG DDD CZ 4937 N NH1 . ARG D 14 ? 1.226 2.181 1.174 -0.273 0.098 0.014 847 ARG DDD NH1 4938 N NH2 . ARG D 14 ? 1.151 2.303 1.249 -0.250 0.114 -0.024 847 ARG DDD NH2 4939 N N . GLY D 15 ? 0.899 1.555 0.831 -0.183 -0.046 0.040 848 GLY DDD N 4940 C CA . GLY D 15 ? 0.918 1.573 0.861 -0.205 -0.073 0.048 848 GLY DDD CA 4941 C C . GLY D 15 ? 0.885 1.428 0.768 -0.198 -0.096 0.058 848 GLY DDD C 4942 O O . GLY D 15 ? 0.814 1.308 0.680 -0.160 -0.093 0.051 848 GLY DDD O 4943 N N . THR D 16 ? 0.914 1.421 0.765 -0.235 -0.117 0.073 849 THR DDD N 4944 C CA . THR D 16 ? 0.912 1.316 0.704 -0.230 -0.140 0.080 849 THR DDD CA 4945 C C . THR D 16 ? 0.922 1.237 0.648 -0.216 -0.128 0.083 849 THR DDD C 4946 O O . THR D 16 ? 0.968 1.228 0.672 -0.184 -0.130 0.077 849 THR DDD O 4947 C CB . THR D 16 ? 0.902 1.280 0.668 -0.274 -0.167 0.094 849 THR DDD CB 4948 O OG1 . THR D 16 ? 0.931 1.270 0.644 -0.316 -0.164 0.109 849 THR DDD OG1 4949 C CG2 . THR D 16 ? 0.883 1.360 0.724 -0.290 -0.182 0.091 849 THR DDD CG2 4950 N N . PRO D 17 ? 0.890 1.188 0.582 -0.238 -0.116 0.092 850 PRO DDD N 4951 C CA . PRO D 17 ? 0.905 1.115 0.535 -0.222 -0.111 0.094 850 PRO DDD CA 4952 C C . PRO D 17 ? 0.879 1.085 0.527 -0.172 -0.097 0.079 850 PRO DDD C 4953 O O . PRO D 17 ? 0.949 1.082 0.555 -0.153 -0.100 0.077 850 PRO DDD O 4954 C CB . PRO D 17 ? 0.938 1.159 0.547 -0.251 -0.099 0.104 850 PRO DDD CB 4955 C CG . PRO D 17 ? 0.968 1.249 0.600 -0.299 -0.105 0.114 850 PRO DDD CG 4956 C CD . PRO D 17 ? 0.894 1.255 0.602 -0.280 -0.107 0.100 850 PRO DDD CD 4957 N N . LEU D 18 ? 0.800 1.084 0.507 -0.153 -0.083 0.068 851 LEU DDD N 4958 C CA . LEU D 18 ? 0.749 1.033 0.476 -0.109 -0.072 0.054 851 LEU DDD CA 4959 C C . LEU D 18 ? 0.774 1.036 0.508 -0.089 -0.084 0.049 851 LEU DDD C 4960 O O . LEU D 18 ? 0.824 1.033 0.531 -0.067 -0.081 0.045 851 LEU DDD O 4961 C CB . LEU D 18 ? 0.693 1.062 0.475 -0.098 -0.055 0.043 851 LEU DDD CB 4962 C CG . LEU D 18 ? 0.658 1.029 0.460 -0.057 -0.046 0.029 851 LEU DDD CG 4963 C CD1 . LEU D 18 ? 0.677 0.993 0.437 -0.048 -0.038 0.032 851 LEU DDD CD1 4964 C CD2 . LEU D 18 ? 0.606 1.059 0.462 -0.045 -0.034 0.016 851 LEU DDD CD2 4965 N N . SER D 19 ? 0.771 1.074 0.539 -0.097 -0.099 0.048 852 SER DDD N 4966 C CA . SER D 19 ? 0.784 1.063 0.554 -0.081 -0.117 0.044 852 SER DDD CA 4967 C C . SER D 19 ? 0.828 1.015 0.529 -0.089 -0.125 0.051 852 SER DDD C 4968 O O . SER D 19 ? 0.864 1.010 0.545 -0.068 -0.124 0.046 852 SER DDD O 4969 C CB . SER D 19 ? 0.735 1.070 0.551 -0.090 -0.138 0.043 852 SER DDD CB 4970 O OG . SER D 19 ? 0.761 1.101 0.565 -0.129 -0.149 0.055 852 SER DDD OG 4971 N N . GLN D 20 ? 0.866 1.020 0.528 -0.119 -0.131 0.061 853 GLN DDD N 4972 C CA . GLN D 20 ? 0.950 1.011 0.541 -0.125 -0.137 0.065 853 GLN DDD CA 4973 C C . GLN D 20 ? 0.931 0.954 0.499 -0.096 -0.116 0.057 853 GLN DDD C 4974 O O . GLN D 20 ? 0.968 0.935 0.499 -0.083 -0.115 0.051 853 GLN DDD O 4975 C CB . GLN D 20 ? 1.025 1.059 0.580 -0.162 -0.149 0.077 853 GLN DDD CB 4976 C CG . GLN D 20 ? 1.093 1.144 0.655 -0.195 -0.175 0.085 853 GLN DDD CG 4977 C CD . GLN D 20 ? 1.147 1.167 0.695 -0.183 -0.192 0.081 853 GLN DDD CD 4978 O OE1 . GLN D 20 ? 1.182 1.120 0.667 -0.177 -0.194 0.078 853 GLN DDD OE1 4979 N NE2 . GLN D 20 ? 1.120 1.205 0.725 -0.179 -0.203 0.079 853 GLN DDD NE2 4980 N N . ALA D 21 ? 0.876 0.928 0.464 -0.088 -0.101 0.056 854 ALA DDD N 4981 C CA . ALA D 21 ? 0.835 0.860 0.411 -0.062 -0.085 0.048 854 ALA DDD CA 4982 C C . ALA D 21 ? 0.764 0.807 0.367 -0.033 -0.073 0.037 854 ALA DDD C 4983 O O . ALA D 21 ? 0.730 0.737 0.314 -0.014 -0.063 0.029 854 ALA DDD O 4984 C CB . ALA D 21 ? 0.822 0.875 0.411 -0.065 -0.076 0.052 854 ALA DDD CB 4985 N N . ILE D 22 ? 0.748 0.847 0.397 -0.030 -0.075 0.035 855 ILE DDD N 4986 C CA . ILE D 22 ? 0.825 0.936 0.496 -0.007 -0.069 0.026 855 ILE DDD CA 4987 C C . ILE D 22 ? 0.876 0.937 0.512 -0.009 -0.077 0.027 855 ILE DDD C 4988 O O . ILE D 22 ? 0.884 0.922 0.507 0.005 -0.065 0.020 855 ILE DDD O 4989 C CB . ILE D 22 ? 0.864 1.040 0.589 -0.001 -0.074 0.023 855 ILE DDD CB 4990 C CG1 . ILE D 22 ? 0.923 1.146 0.677 0.004 -0.061 0.019 855 ILE DDD CG1 4991 C CG2 . ILE D 22 ? 0.822 0.990 0.556 0.017 -0.078 0.017 855 ILE DDD CG2 4992 C CD1 . ILE D 22 ? 1.012 1.306 0.817 0.005 -0.064 0.014 855 ILE DDD CD1 4993 N N . ILE D 23 ? 0.872 0.920 0.492 -0.029 -0.097 0.034 856 ILE DDD N 4994 C CA . ILE D 23 ? 0.874 0.867 0.447 -0.036 -0.109 0.035 856 ILE DDD CA 4995 C C . ILE D 23 ? 0.885 0.818 0.406 -0.032 -0.093 0.030 856 ILE DDD C 4996 O O . ILE D 23 ? 0.877 0.781 0.373 -0.024 -0.084 0.024 856 ILE DDD O 4997 C CB . ILE D 23 ? 0.912 0.903 0.477 -0.062 -0.136 0.044 856 ILE DDD CB 4998 C CG1 . ILE D 23 ? 0.912 0.961 0.531 -0.059 -0.155 0.046 856 ILE DDD CG1 4999 C CG2 . ILE D 23 ? 0.967 0.882 0.463 -0.074 -0.147 0.046 856 ILE DDD CG2 5000 C CD1 . ILE D 23 ? 0.971 1.052 0.610 -0.084 -0.179 0.053 856 ILE DDD CD1 5001 N N . HIS D 24 ? 0.873 0.787 0.375 -0.036 -0.089 0.030 857 HIS DDD N 5002 C CA . HIS D 24 ? 0.909 0.769 0.367 -0.025 -0.075 0.021 857 HIS DDD CA 5003 C C . HIS D 24 ? 0.889 0.772 0.374 0.001 -0.051 0.011 857 HIS DDD C 5004 O O . HIS D 24 ? 0.991 0.845 0.449 0.011 -0.036 0.000 857 HIS DDD O 5005 C CB . HIS D 24 ? 0.906 0.739 0.343 -0.032 -0.081 0.025 857 HIS DDD CB 5006 C CG . HIS D 24 ? 0.972 0.752 0.371 -0.012 -0.069 0.012 857 HIS DDD CG 5007 N ND1 . HIS D 24 ? 0.968 0.767 0.392 0.014 -0.053 0.003 857 HIS DDD ND1 5008 C CD2 . HIS D 24 ? 1.086 0.798 0.425 -0.012 -0.072 0.004 857 HIS DDD CD2 5009 C CE1 . HIS D 24 ? 1.048 0.798 0.437 0.031 -0.046 -0.011 857 HIS DDD CE1 5010 N NE2 . HIS D 24 ? 1.122 0.816 0.456 0.017 -0.056 -0.011 857 HIS DDD NE2 5011 N N . GLN D 25 ? 0.858 0.795 0.394 0.010 -0.046 0.012 858 GLN DDD N 5012 C CA . GLN D 25 ? 0.842 0.805 0.408 0.032 -0.026 0.003 858 GLN DDD CA 5013 C C . GLN D 25 ? 0.808 0.773 0.374 0.033 -0.019 -0.001 858 GLN DDD C 5014 O O . GLN D 25 ? 0.753 0.720 0.324 0.045 0.000 -0.010 858 GLN DDD O 5015 C CB . GLN D 25 ? 0.783 0.796 0.394 0.036 -0.027 0.006 858 GLN DDD CB 5016 C CG . GLN D 25 ? 0.778 0.813 0.417 0.057 -0.012 -0.003 858 GLN DDD CG 5017 C CD . GLN D 25 ? 0.815 0.885 0.482 0.060 -0.015 -0.000 858 GLN DDD CD 5018 O OE1 . GLN D 25 ? 0.887 0.944 0.538 0.054 -0.022 0.005 858 GLN DDD OE1 5019 N NE2 . GLN D 25 ? 0.788 0.895 0.490 0.069 -0.010 -0.004 858 GLN DDD NE2 5020 N N . TYR D 26 ? 0.803 0.768 0.366 0.020 -0.035 0.007 859 TYR DDD N 5021 C CA . TYR D 26 ? 0.815 0.773 0.372 0.018 -0.035 0.007 859 TYR DDD CA 5022 C C . TYR D 26 ? 0.864 0.769 0.362 0.010 -0.026 0.003 859 TYR DDD C 5023 O O . TYR D 26 ? 0.839 0.740 0.330 0.012 -0.007 -0.003 859 TYR DDD O 5024 C CB . TYR D 26 ? 0.794 0.766 0.366 0.011 -0.061 0.015 859 TYR DDD CB 5025 C CG . TYR D 26 ? 0.819 0.772 0.377 0.010 -0.067 0.017 859 TYR DDD CG 5026 C CD1 . TYR D 26 ? 0.778 0.756 0.369 0.021 -0.063 0.014 859 TYR DDD CD1 5027 C CD2 . TYR D 26 ? 0.944 0.844 0.447 -0.005 -0.077 0.021 859 TYR DDD CD2 5028 C CE1 . TYR D 26 ? 0.823 0.772 0.392 0.016 -0.071 0.017 859 TYR DDD CE1 5029 C CE2 . TYR D 26 ? 0.976 0.848 0.455 -0.011 -0.084 0.025 859 TYR DDD CE2 5030 C CZ . TYR D 26 ? 0.937 0.833 0.449 -0.000 -0.081 0.023 859 TYR DDD CZ 5031 O OH . TYR D 26 ? 1.037 0.896 0.519 -0.009 -0.091 0.029 859 TYR DDD OH 5032 N N . TYR D 27 ? 0.925 0.790 0.381 -0.002 -0.037 0.006 860 TYR DDD N 5033 C CA . TYR D 27 ? 1.015 0.821 0.403 -0.013 -0.032 0.002 860 TYR DDD CA 5034 C C . TYR D 27 ? 1.093 0.880 0.459 -0.000 -0.007 -0.014 860 TYR DDD C 5035 O O . TYR D 27 ? 1.319 1.065 0.631 -0.005 0.007 -0.022 860 TYR DDD O 5036 C CB . TYR D 27 ? 1.051 0.818 0.399 -0.032 -0.061 0.011 860 TYR DDD CB 5037 C CG . TYR D 27 ? 1.007 0.788 0.372 -0.042 -0.090 0.023 860 TYR DDD CG 5038 C CD1 . TYR D 27 ? 1.005 0.757 0.337 -0.050 -0.096 0.027 860 TYR DDD CD1 5039 C CD2 . TYR D 27 ? 0.951 0.774 0.364 -0.044 -0.113 0.031 860 TYR DDD CD2 5040 C CE1 . TYR D 27 ? 1.012 0.771 0.359 -0.054 -0.128 0.037 860 TYR DDD CE1 5041 C CE2 . TYR D 27 ? 0.933 0.776 0.370 -0.047 -0.141 0.039 860 TYR DDD CE2 5042 C CZ . TYR D 27 ? 0.983 0.789 0.386 -0.050 -0.152 0.042 860 TYR DDD CZ 5043 O OH . TYR D 27 ? 0.981 0.800 0.407 -0.049 -0.185 0.049 860 TYR DDD OH 5044 N N . HIS D 28 ? 1.020 0.831 0.421 0.016 -0.002 -0.018 861 HIS DDD N 5045 C CA . HIS D 28 ? 1.059 0.852 0.445 0.034 0.016 -0.034 861 HIS DDD CA 5046 C C . HIS D 28 ? 1.047 0.890 0.493 0.056 0.027 -0.039 861 HIS DDD C 5047 O O . HIS D 28 ? 1.036 0.872 0.488 0.068 0.021 -0.042 861 HIS DDD O 5048 C CB . HIS D 28 ? 1.112 0.852 0.456 0.030 -0.002 -0.033 861 HIS DDD CB 5049 C CG . HIS D 28 ? 1.161 0.847 0.442 0.008 -0.015 -0.029 861 HIS DDD CG 5050 N ND1 . HIS D 28 ? 1.162 0.853 0.444 -0.015 -0.040 -0.013 861 HIS DDD ND1 5051 C CD2 . HIS D 28 ? 1.201 0.825 0.415 0.008 -0.010 -0.042 861 HIS DDD CD2 5052 C CE1 . HIS D 28 ? 1.188 0.821 0.405 -0.032 -0.051 -0.013 861 HIS DDD CE1 5053 N NE2 . HIS D 28 ? 1.259 0.848 0.431 -0.019 -0.032 -0.030 861 HIS DDD NE2 5054 N N . PRO D 29 ? 1.016 0.905 0.501 0.058 0.042 -0.041 862 PRO DDD N 5055 C CA . PRO D 29 ? 0.986 0.924 0.528 0.075 0.047 -0.044 862 PRO DDD CA 5056 C C . PRO D 29 ? 1.002 0.939 0.549 0.099 0.064 -0.062 862 PRO DDD C 5057 O O . PRO D 29 ? 1.122 1.033 0.635 0.103 0.079 -0.075 862 PRO DDD O 5058 C CB . PRO D 29 ? 0.976 0.948 0.544 0.067 0.057 -0.041 862 PRO DDD CB 5059 C CG . PRO D 29 ? 0.984 0.923 0.502 0.053 0.070 -0.045 862 PRO DDD CG 5060 C CD . PRO D 29 ? 1.021 0.909 0.490 0.044 0.052 -0.039 862 PRO DDD CD 5061 N N . PRO D 30 ? 0.904 0.871 0.494 0.118 0.060 -0.065 863 PRO DDD N 5062 C CA . PRO D 30 ? 0.899 0.869 0.502 0.146 0.070 -0.084 863 PRO DDD CA 5063 C C . PRO D 30 ? 0.864 0.893 0.515 0.152 0.095 -0.096 863 PRO DDD C 5064 O O . PRO D 30 ? 0.800 0.856 0.467 0.134 0.098 -0.086 863 PRO DDD O 5065 C CB . PRO D 30 ? 0.913 0.882 0.533 0.157 0.047 -0.076 863 PRO DDD CB 5066 C CG . PRO D 30 ? 0.878 0.883 0.526 0.138 0.039 -0.059 863 PRO DDD CG 5067 C CD . PRO D 30 ? 0.872 0.870 0.497 0.115 0.045 -0.052 863 PRO DDD CD 5068 N N . ASN D 31 ? 0.925 0.970 0.596 0.178 0.109 -0.117 864 ASN DDD N 5069 C CA . ASN D 31 ? 0.932 1.046 0.662 0.186 0.129 -0.130 864 ASN DDD CA 5070 C C . ASN D 31 ? 0.906 1.051 0.683 0.190 0.108 -0.119 864 ASN DDD C 5071 O O . ASN D 31 ? 0.941 1.069 0.722 0.211 0.086 -0.119 864 ASN DDD O 5072 C CB . ASN D 31 ? 0.981 1.111 0.729 0.218 0.147 -0.158 864 ASN DDD CB 5073 C CG . ASN D 31 ? 0.989 1.198 0.797 0.219 0.174 -0.173 864 ASN DDD CG 5074 O OD1 . ASN D 31 ? 0.973 1.226 0.826 0.208 0.168 -0.163 864 ASN DDD OD1 5075 N ND2 . ASN D 31 ? 1.011 1.241 0.821 0.230 0.205 -0.198 864 ASN DDD ND2 5076 N N . LEU D 32 ? 0.857 1.038 0.659 0.169 0.112 -0.109 865 LEU DDD N 5077 C CA . LEU D 32 ? 0.799 1.005 0.636 0.168 0.092 -0.098 865 LEU DDD CA 5078 C C . LEU D 32 ? 0.800 1.056 0.695 0.190 0.092 -0.112 865 LEU DDD C 5079 O O . LEU D 32 ? 0.782 1.038 0.693 0.203 0.069 -0.108 865 LEU DDD O 5080 C CB . LEU D 32 ? 0.740 0.960 0.578 0.140 0.096 -0.086 865 LEU DDD CB 5081 C CG . LEU D 32 ? 0.700 0.876 0.491 0.122 0.086 -0.071 865 LEU DDD CG 5082 C CD1 . LEU D 32 ? 0.658 0.842 0.451 0.100 0.085 -0.062 865 LEU DDD CD1 5083 C CD2 . LEU D 32 ? 0.720 0.877 0.502 0.129 0.062 -0.061 865 LEU DDD CD2 5084 N N . LEU D 33 ? 0.831 1.129 0.756 0.193 0.118 -0.130 866 LEU DDD N 5085 C CA . LEU D 33 ? 0.867 1.228 0.860 0.214 0.119 -0.146 866 LEU DDD CA 5086 C C . LEU D 33 ? 0.885 1.226 0.884 0.253 0.098 -0.156 866 LEU DDD C 5087 O O . LEU D 33 ? 0.864 1.240 0.913 0.271 0.080 -0.162 866 LEU DDD O 5088 C CB . LEU D 33 ? 0.959 1.369 0.977 0.207 0.156 -0.165 866 LEU DDD CB 5089 C CG . LEU D 33 ? 0.947 1.436 1.045 0.229 0.162 -0.186 866 LEU DDD CG 5090 C CD1 . LEU D 33 ? 0.920 1.447 1.063 0.216 0.142 -0.175 866 LEU DDD CD1 5091 C CD2 . LEU D 33 ? 0.931 1.475 1.050 0.218 0.205 -0.206 866 LEU DDD CD2 5092 N N . GLU D 34 ? 0.939 1.222 0.888 0.265 0.096 -0.159 867 GLU DDD N 5093 C CA . GLU D 34 ? 1.031 1.276 0.972 0.303 0.073 -0.169 867 GLU DDD CA 5094 C C . GLU D 34 ? 0.977 1.172 0.884 0.296 0.037 -0.145 867 GLU DDD C 5095 O O . GLU D 34 ? 1.023 1.200 0.937 0.322 0.009 -0.148 867 GLU DDD O 5096 C CB . GLU D 34 ? 1.203 1.402 1.098 0.316 0.086 -0.183 867 GLU DDD CB 5097 C CG . GLU D 34 ? 1.302 1.419 1.119 0.298 0.072 -0.165 867 GLU DDD CG 5098 C CD . GLU D 34 ? 1.482 1.544 1.246 0.311 0.081 -0.180 867 GLU DDD CD 5099 O OE1 . GLU D 34 ? 1.659 1.668 1.363 0.286 0.079 -0.166 867 GLU DDD OE1 5100 O OE2 . GLU D 34 ? 1.365 1.438 1.150 0.347 0.089 -0.207 867 GLU DDD OE2 5101 N N . LEU D 35 ? 0.904 1.077 0.774 0.263 0.038 -0.124 868 LEU DDD N 5102 C CA . LEU D 35 ? 0.911 1.042 0.745 0.250 0.011 -0.103 868 LEU DDD CA 5103 C C . LEU D 35 ? 0.825 0.991 0.696 0.249 -0.005 -0.096 868 LEU DDD C 5104 O O . LEU D 35 ? 0.883 1.019 0.736 0.257 -0.032 -0.088 868 LEU DDD O 5105 C CB . LEU D 35 ? 0.908 1.017 0.702 0.218 0.020 -0.087 868 LEU DDD CB 5106 C CG . LEU D 35 ? 0.902 0.960 0.647 0.204 -0.002 -0.069 868 LEU DDD CG 5107 C CD1 . LEU D 35 ? 0.947 0.945 0.652 0.220 -0.015 -0.074 868 LEU DDD CD1 5108 C CD2 . LEU D 35 ? 0.903 0.955 0.624 0.175 0.007 -0.057 868 LEU DDD CD2 5109 N N . PHE D 36 ? 0.710 0.932 0.624 0.238 0.010 -0.099 869 PHE DDD N 5110 C CA . PHE D 36 ? 0.669 0.921 0.610 0.232 -0.005 -0.092 869 PHE DDD CA 5111 C C . PHE D 36 ? 0.628 0.939 0.634 0.247 -0.004 -0.107 869 PHE DDD C 5112 O O . PHE D 36 ? 0.623 0.955 0.651 0.242 -0.020 -0.103 869 PHE DDD O 5113 C CB . PHE D 36 ? 0.646 0.908 0.579 0.202 0.006 -0.081 869 PHE DDD CB 5114 C CG . PHE D 36 ? 0.691 0.911 0.573 0.187 0.002 -0.066 869 PHE DDD CG 5115 C CD1 . PHE D 36 ? 0.698 0.899 0.557 0.184 -0.017 -0.055 869 PHE DDD CD1 5116 C CD2 . PHE D 36 ? 0.711 0.914 0.567 0.174 0.018 -0.064 869 PHE DDD CD2 5117 C CE1 . PHE D 36 ? 0.718 0.893 0.539 0.167 -0.018 -0.043 869 PHE DDD CE1 5118 C CE2 . PHE D 36 ? 0.718 0.890 0.536 0.159 0.012 -0.052 869 PHE DDD CE2 5119 C CZ . PHE D 36 ? 0.733 0.897 0.538 0.156 -0.004 -0.042 869 PHE DDD CZ 5120 N N . GLY D 37 ? 0.620 0.959 0.657 0.262 0.014 -0.125 870 GLY DDD N 5121 C CA . GLY D 37 ? 0.619 1.027 0.727 0.276 0.016 -0.142 870 GLY DDD CA 5122 C C . GLY D 37 ? 0.598 1.055 0.736 0.245 0.030 -0.138 870 GLY DDD C 5123 O O . GLY D 37 ? 0.599 1.030 0.699 0.217 0.038 -0.124 870 GLY DDD O 5124 N N . THR D 38 ? 0.634 1.158 0.840 0.249 0.031 -0.151 871 THR DDD N 5125 C CA . THR D 38 ? 0.651 1.223 0.889 0.217 0.041 -0.148 871 THR DDD CA 5126 C C . THR D 38 ? 0.639 1.193 0.868 0.208 0.008 -0.134 871 THR DDD C 5127 O O . THR D 38 ? 0.682 1.233 0.925 0.231 -0.022 -0.136 871 THR DDD O 5128 C CB . THR D 38 ? 0.631 1.290 0.947 0.221 0.057 -0.169 871 THR DDD CB 5129 O OG1 . THR D 38 ? 0.634 1.311 0.990 0.263 0.034 -0.183 871 THR DDD OG1 5130 C CG2 . THR D 38 ? 0.645 1.328 0.960 0.211 0.100 -0.181 871 THR DDD CG2 5131 N N . ILE D 39 ? 0.627 1.165 0.829 0.176 0.013 -0.121 872 ILE DDD N 5132 C CA . ILE D 39 ? 0.660 1.181 0.850 0.163 -0.013 -0.111 872 ILE DDD CA 5133 C C . ILE D 39 ? 0.667 1.247 0.920 0.160 -0.027 -0.120 872 ILE DDD C 5134 O O . ILE D 39 ? 0.651 1.275 0.937 0.135 -0.009 -0.124 872 ILE DDD O 5135 C CB . ILE D 39 ? 0.677 1.166 0.825 0.133 -0.002 -0.100 872 ILE DDD CB 5136 C CG1 . ILE D 39 ? 0.673 1.112 0.767 0.136 0.009 -0.092 872 ILE DDD CG1 5137 C CG2 . ILE D 39 ? 0.682 1.153 0.817 0.123 -0.027 -0.093 872 ILE DDD CG2 5138 C CD1 . ILE D 39 ? 0.700 1.110 0.758 0.111 0.017 -0.083 872 ILE DDD CD1 5139 N N . LEU D 40 ? 0.666 1.246 0.933 0.180 -0.059 -0.121 873 LEU DDD N 5140 C CA . LEU D 40 ? 0.669 1.306 1.000 0.181 -0.081 -0.129 873 LEU DDD CA 5141 C C . LEU D 40 ? 0.697 1.318 1.009 0.152 -0.098 -0.121 873 LEU DDD C 5142 O O . LEU D 40 ? 0.703 1.264 0.952 0.148 -0.105 -0.110 873 LEU DDD O 5143 C CB . LEU D 40 ? 0.705 1.337 1.049 0.218 -0.114 -0.134 873 LEU DDD CB 5144 C CG . LEU D 40 ? 0.761 1.383 1.105 0.252 -0.106 -0.142 873 LEU DDD CG 5145 C CD1 . LEU D 40 ? 0.803 1.373 1.114 0.280 -0.144 -0.137 873 LEU DDD CD1 5146 C CD2 . LEU D 40 ? 0.770 1.473 1.197 0.267 -0.091 -0.164 873 LEU DDD CD2 5147 N N . PRO D 41 ? 0.717 1.392 1.082 0.133 -0.107 -0.126 874 PRO DDD N 5148 C CA . PRO D 41 ? 0.702 1.354 1.044 0.105 -0.126 -0.119 874 PRO DDD CA 5149 C C . PRO D 41 ? 0.692 1.292 0.989 0.121 -0.161 -0.114 874 PRO DDD C 5150 O O . PRO D 41 ? 0.674 1.282 0.987 0.148 -0.183 -0.117 874 PRO DDD O 5151 C CB . PRO D 41 ? 0.686 1.414 1.105 0.086 -0.135 -0.128 874 PRO DDD CB 5152 C CG . PRO D 41 ? 0.679 1.476 1.159 0.096 -0.105 -0.140 874 PRO DDD CG 5153 C CD . PRO D 41 ? 0.706 1.467 1.157 0.137 -0.100 -0.141 874 PRO DDD CD 5154 N N . LEU D 42 ? 0.700 1.246 0.938 0.104 -0.167 -0.106 875 LEU DDD N 5155 C CA . LEU D 42 ? 0.728 1.221 0.910 0.114 -0.194 -0.102 875 LEU DDD CA 5156 C C . LEU D 42 ? 0.744 1.256 0.952 0.111 -0.233 -0.107 875 LEU DDD C 5157 O O . LEU D 42 ? 0.696 1.220 0.919 0.084 -0.241 -0.109 875 LEU DDD O 5158 C CB . LEU D 42 ? 0.783 1.223 0.904 0.099 -0.185 -0.099 875 LEU DDD CB 5159 C CG . LEU D 42 ? 0.848 1.235 0.903 0.110 -0.200 -0.097 875 LEU DDD CG 5160 C CD1 . LEU D 42 ? 0.887 1.256 0.914 0.130 -0.186 -0.091 875 LEU DDD CD1 5161 C CD2 . LEU D 42 ? 0.876 1.222 0.884 0.096 -0.197 -0.100 875 LEU DDD CD2 5162 N N . ASP D 43 ? 0.808 1.316 1.016 0.136 -0.259 -0.106 876 ASP DDD N 5163 C CA . ASP D 43 ? 0.867 1.389 1.097 0.138 -0.303 -0.110 876 ASP DDD CA 5164 C C . ASP D 43 ? 0.929 1.385 1.080 0.128 -0.325 -0.105 876 ASP DDD C 5165 O O . ASP D 43 ? 1.013 1.421 1.104 0.144 -0.332 -0.099 876 ASP DDD O 5166 C CB . ASP D 43 ? 0.881 1.419 1.141 0.172 -0.323 -0.111 876 ASP DDD CB 5167 C CG . ASP D 43 ? 0.878 1.453 1.189 0.179 -0.369 -0.117 876 ASP DDD CG 5168 O OD1 . ASP D 43 ? 0.898 1.470 1.203 0.155 -0.392 -0.117 876 ASP DDD OD1 5169 O OD2 . ASP D 43 ? 0.853 1.457 1.209 0.209 -0.384 -0.122 876 ASP DDD OD2 5170 N N . LEU D 44 ? 0.924 1.375 1.069 0.102 -0.335 -0.109 877 LEU DDD N 5171 C CA . LEU D 44 ? 0.951 1.336 1.015 0.092 -0.348 -0.109 877 LEU DDD CA 5172 C C . LEU D 44 ? 0.975 1.335 1.008 0.101 -0.392 -0.108 877 LEU DDD C 5173 O O . LEU D 44 ? 0.982 1.283 0.934 0.105 -0.395 -0.106 877 LEU DDD O 5174 C CB . LEU D 44 ? 0.955 1.338 1.024 0.061 -0.351 -0.114 877 LEU DDD CB 5175 C CG . LEU D 44 ? 0.945 1.293 0.974 0.052 -0.318 -0.115 877 LEU DDD CG 5176 C CD1 . LEU D 44 ? 0.901 1.277 0.959 0.062 -0.279 -0.110 877 LEU DDD CD1 5177 C CD2 . LEU D 44 ? 0.960 1.300 0.995 0.020 -0.326 -0.119 877 LEU DDD CD2 5178 N N . GLU D 45 ? 0.965 1.369 1.060 0.103 -0.425 -0.110 878 GLU DDD N 5179 C CA . GLU D 45 ? 1.081 1.461 1.150 0.113 -0.475 -0.107 878 GLU DDD CA 5180 C C . GLU D 45 ? 1.117 1.459 1.139 0.140 -0.473 -0.099 878 GLU DDD C 5181 O O . GLU D 45 ? 1.222 1.505 1.167 0.141 -0.499 -0.094 878 GLU DDD O 5182 C CB . GLU D 45 ? 1.122 1.569 1.282 0.113 -0.511 -0.112 878 GLU DDD CB 5183 C CG . GLU D 45 ? 1.117 1.631 1.363 0.139 -0.498 -0.114 878 GLU DDD CG 5184 C CD . GLU D 45 ? 1.123 1.703 1.458 0.151 -0.541 -0.121 878 GLU DDD CD 5185 O OE1 . GLU D 45 ? 1.078 1.744 1.509 0.145 -0.526 -0.130 878 GLU DDD OE1 5186 O OE2 . GLU D 45 ? 1.159 1.705 1.466 0.166 -0.590 -0.117 878 GLU DDD OE2 5187 N N . ASP D 46 ? 1.128 1.498 1.187 0.157 -0.443 -0.097 879 ASP DDD N 5188 C CA . ASP D 46 ? 1.242 1.576 1.263 0.181 -0.443 -0.088 879 ASP DDD CA 5189 C C . ASP D 46 ? 1.239 1.513 1.166 0.171 -0.414 -0.082 879 ASP DDD C 5190 O O . ASP D 46 ? 1.348 1.571 1.210 0.179 -0.427 -0.072 879 ASP DDD O 5191 C CB . ASP D 46 ? 1.288 1.670 1.379 0.202 -0.420 -0.091 879 ASP DDD CB 5192 C CG . ASP D 46 ? 1.372 1.720 1.439 0.231 -0.435 -0.084 879 ASP DDD CG 5193 O OD1 . ASP D 46 ? 1.357 1.699 1.434 0.248 -0.482 -0.084 879 ASP DDD OD1 5194 O OD2 . ASP D 46 ? 1.384 1.708 1.419 0.235 -0.403 -0.079 879 ASP DDD OD2 5195 N N . ILE D 47 ? 1.121 1.400 1.042 0.155 -0.379 -0.087 880 ILE DDD N 5196 C CA . ILE D 47 ? 1.062 1.304 0.916 0.150 -0.344 -0.084 880 ILE DDD CA 5197 C C . ILE D 47 ? 1.109 1.306 0.888 0.135 -0.353 -0.088 880 ILE DDD C 5198 O O . ILE D 47 ? 1.188 1.347 0.897 0.134 -0.342 -0.084 880 ILE DDD O 5199 C CB . ILE D 47 ? 0.978 1.251 0.872 0.146 -0.302 -0.087 880 ILE DDD CB 5200 C CG1 . ILE D 47 ? 0.978 1.281 0.921 0.162 -0.289 -0.083 880 ILE DDD CG1 5201 C CG2 . ILE D 47 ? 0.928 1.171 0.765 0.139 -0.272 -0.088 880 ILE DDD CG2 5202 C CD1 . ILE D 47 ? 0.931 1.267 0.917 0.156 -0.252 -0.086 880 ILE DDD CD1 5203 N N . PHE D 48 ? 1.068 1.269 0.859 0.122 -0.371 -0.098 881 PHE DDD N 5204 C CA . PHE D 48 ? 1.160 1.317 0.880 0.110 -0.374 -0.107 881 PHE DDD CA 5205 C C . PHE D 48 ? 1.306 1.435 0.994 0.103 -0.423 -0.108 881 PHE DDD C 5206 O O . PHE D 48 ? 1.335 1.488 1.070 0.108 -0.456 -0.102 881 PHE DDD O 5207 C CB . PHE D 48 ? 1.146 1.313 0.890 0.099 -0.356 -0.118 881 PHE DDD CB 5208 C CG . PHE D 48 ? 1.101 1.281 0.856 0.106 -0.312 -0.117 881 PHE DDD CG 5209 C CD1 . PHE D 48 ? 1.109 1.266 0.809 0.114 -0.287 -0.118 881 PHE DDD CD1 5210 C CD2 . PHE D 48 ? 1.055 1.273 0.877 0.101 -0.296 -0.116 881 PHE DDD CD2 5211 C CE1 . PHE D 48 ? 1.092 1.264 0.808 0.119 -0.251 -0.117 881 PHE DDD CE1 5212 C CE2 . PHE D 48 ? 0.978 1.202 0.805 0.107 -0.260 -0.114 881 PHE DDD CE2 5213 C CZ . PHE D 48 ? 1.017 1.219 0.795 0.117 -0.239 -0.115 881 PHE DDD CZ 5214 N N . LYS D 49 ? 1.416 1.497 1.024 0.094 -0.427 -0.117 882 LYS DDD N 5215 C CA . LYS D 49 ? 1.552 1.591 1.105 0.084 -0.471 -0.120 882 LYS DDD CA 5216 C C . LYS D 49 ? 1.583 1.637 1.182 0.070 -0.499 -0.129 882 LYS DDD C 5217 O O . LYS D 49 ? 1.619 1.713 1.285 0.066 -0.479 -0.131 882 LYS DDD O 5218 C CB . LYS D 49 ? 1.664 1.646 1.110 0.080 -0.457 -0.131 882 LYS DDD CB 5219 C CG . LYS D 49 ? 1.708 1.674 1.096 0.085 -0.431 -0.122 882 LYS DDD CG 5220 C CD . LYS D 49 ? 1.802 1.717 1.081 0.077 -0.420 -0.133 882 LYS DDD CD 5221 C CE . LYS D 49 ? 1.770 1.680 1.034 0.078 -0.395 -0.157 882 LYS DDD CE 5222 N NZ . LYS D 49 ? 1.839 1.706 1.061 0.068 -0.432 -0.171 882 LYS DDD NZ 5223 N N . LYS D 50 ? 1.577 1.598 1.137 0.059 -0.545 -0.132 883 LYS DDD N 5224 C CA . LYS D 50 ? 1.625 1.658 1.226 0.041 -0.583 -0.138 883 LYS DDD CA 5225 C C . LYS D 50 ? 1.712 1.816 1.421 0.044 -0.606 -0.128 883 LYS DDD C 5226 O O . LYS D 50 ? 1.792 1.926 1.556 0.026 -0.634 -0.132 883 LYS DDD O 5227 C CB . LYS D 50 ? 1.529 1.558 1.139 0.027 -0.559 -0.150 883 LYS DDD CB 5228 C CG . LYS D 50 ? 1.527 1.497 1.045 0.032 -0.531 -0.165 883 LYS DDD CG 5229 C CD . LYS D 50 ? 1.635 1.538 1.049 0.028 -0.558 -0.174 883 LYS DDD CD 5230 C CE . LYS D 50 ? 1.676 1.550 1.078 0.006 -0.607 -0.182 883 LYS DDD CE 5231 N NZ . LYS D 50 ? 1.672 1.519 1.065 -0.004 -0.597 -0.198 883 LYS DDD NZ 5232 N N . SER D 51 ? 1.704 1.833 1.441 0.066 -0.598 -0.117 884 SER DDD N 5233 C CA . SER D 51 ? 1.630 1.826 1.467 0.079 -0.620 -0.110 884 SER DDD CA 5234 C C . SER D 51 ? 1.598 1.786 1.436 0.074 -0.686 -0.109 884 SER DDD C 5235 O O . SER D 51 ? 1.505 1.729 1.400 0.091 -0.718 -0.104 884 SER DDD O 5236 C CB . SER D 51 ? 1.579 1.780 1.421 0.106 -0.601 -0.100 884 SER DDD CB 5237 O OG . SER D 51 ? 1.612 1.749 1.367 0.114 -0.630 -0.092 884 SER DDD OG #