Acta Crystallographica Section D
Acta Crystallographica
Section D
STRUCTURAL BIOLOGY
IUCr
IT
WDC
search IUCr Journals
home
archive
editors
for authors
for readers
submit
subscribe
open access
journal menu
home
archive
editors
for authors
for readers
submit
subscribe
open access
3D view
STRUCTURAL
BIOLOGY
Volume 63
|
Part 9
|
September 2007
|
Pages 982–992
https://doi.org/10.1107/S0907444907036955
Open
access
ISSN: 2059-7983
My images
view article
STRUCTURAL
BIOLOGY
Volume 63
|
Part 9
|
September 2007
|
Pages 982–992
https://doi.org/10.1107/S0907444907036955
Open
access
ISSN: 2059-7983
Visualization options
Jmol (JAVA applet)
JSmol (HTML5 version of Jmol)
CIFmol (light-weight HTML5 CIF viewer)
Follow Acta Cryst. D
E-alerts
twitter.com
Facebook
RSS
Please wait...
...
Generating image - please wait
3D viewers
Jmol (JAVA applet)
JSmol (HTML5 version of Jmol)
CIFmol (light-weight CIF viewer)
remember my choice
data_2QPN # _entry.id 2QPN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2QPN RCSB RCSB043897 WWPDB D_1000043897 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2QPN _pdbx_database_status.recvd_initial_deposition_date 2007-07-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Smith, C.A.' 1 'Caccamo, M.' 2 'Kantardjieff, K.A.' 3 'Vakulenko, S.' 4 # _citation.id primary _citation.title ;Structure of GES-1 at atomic resolution: insights into the evolution of carbapenamase activity in the class A extended-spectrum beta-lactamases. ; _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 63 _citation.page_first 982 _citation.page_last 992 _citation.year 2007 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17704567 _citation.pdbx_database_id_DOI 10.1107/S0907444907036955 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Smith, C.A.' 1 primary 'Caccamo, M.' 2 primary 'Kantardjieff, K.A.' 3 primary 'Vakulenko, S.' 4 # _cell.entry_id 2QPN _cell.length_a 42.410 _cell.length_b 80.820 _cell.length_c 71.440 _cell.angle_alpha 90.00 _cell.angle_beta 101.43 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2QPN _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta-lactamase GES-1' 31192.438 2 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 728 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GES-1 extended-spectrum beta-lactamase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRFIHALLLAGIAHSAYASEKLTFKTDLEKLEREKAAQIGVAIVDPQGEIVAGHRMAQRFAMCSTFKFPLAALVFERIDS GTERGDRKLSYGPDMIVEWSPATERFLASGHMTVLEAAQAAVQLSDNGATNLLLREIGGPAAMTQYFRKIGDSVSRLDRK EPEMGDNTPGDLRDTTTPIAMARTVAKVLYGGALTSTSTHTIERWLIGNQTGDATLRAGFPKDWVVGEKTGTCANGGRND IGFFKAQERDYAVAVYTTAPKLSAVERDELVASVGQVITQLILSTDK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRFIHALLLAGIAHSAYASEKLTFKTDLEKLEREKAAQIGVAIVDPQGEIVAGHRMAQRFAMCSTFKFPLAALVFERIDS GTERGDRKLSYGPDMIVEWSPATERFLASGHMTVLEAAQAAVQLSDNGATNLLLREIGGPAAMTQYFRKIGDSVSRLDRK EPEMGDNTPGDLRDTTTPIAMARTVAKVLYGGALTSTSTHTIERWLIGNQTGDATLRAGFPKDWVVGEKTGTCANGGRND IGFFKAQERDYAVAVYTTAPKLSAVERDELVASVGQVITQLILSTDK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 PHE n 1 4 ILE n 1 5 HIS n 1 6 ALA n 1 7 LEU n 1 8 LEU n 1 9 LEU n 1 10 ALA n 1 11 GLY n 1 12 ILE n 1 13 ALA n 1 14 HIS n 1 15 SER n 1 16 ALA n 1 17 TYR n 1 18 ALA n 1 19 SER n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 THR n 1 24 PHE n 1 25 LYS n 1 26 THR n 1 27 ASP n 1 28 LEU n 1 29 GLU n 1 30 LYS n 1 31 LEU n 1 32 GLU n 1 33 ARG n 1 34 GLU n 1 35 LYS n 1 36 ALA n 1 37 ALA n 1 38 GLN n 1 39 ILE n 1 40 GLY n 1 41 VAL n 1 42 ALA n 1 43 ILE n 1 44 VAL n 1 45 ASP n 1 46 PRO n 1 47 GLN n 1 48 GLY n 1 49 GLU n 1 50 ILE n 1 51 VAL n 1 52 ALA n 1 53 GLY n 1 54 HIS n 1 55 ARG n 1 56 MET n 1 57 ALA n 1 58 GLN n 1 59 ARG n 1 60 PHE n 1 61 ALA n 1 62 MET n 1 63 CYS n 1 64 SER n 1 65 THR n 1 66 PHE n 1 67 LYS n 1 68 PHE n 1 69 PRO n 1 70 LEU n 1 71 ALA n 1 72 ALA n 1 73 LEU n 1 74 VAL n 1 75 PHE n 1 76 GLU n 1 77 ARG n 1 78 ILE n 1 79 ASP n 1 80 SER n 1 81 GLY n 1 82 THR n 1 83 GLU n 1 84 ARG n 1 85 GLY n 1 86 ASP n 1 87 ARG n 1 88 LYS n 1 89 LEU n 1 90 SER n 1 91 TYR n 1 92 GLY n 1 93 PRO n 1 94 ASP n 1 95 MET n 1 96 ILE n 1 97 VAL n 1 98 GLU n 1 99 TRP n 1 100 SER n 1 101 PRO n 1 102 ALA n 1 103 THR n 1 104 GLU n 1 105 ARG n 1 106 PHE n 1 107 LEU n 1 108 ALA n 1 109 SER n 1 110 GLY n 1 111 HIS n 1 112 MET n 1 113 THR n 1 114 VAL n 1 115 LEU n 1 116 GLU n 1 117 ALA n 1 118 ALA n 1 119 GLN n 1 120 ALA n 1 121 ALA n 1 122 VAL n 1 123 GLN n 1 124 LEU n 1 125 SER n 1 126 ASP n 1 127 ASN n 1 128 GLY n 1 129 ALA n 1 130 THR n 1 131 ASN n 1 132 LEU n 1 133 LEU n 1 134 LEU n 1 135 ARG n 1 136 GLU n 1 137 ILE n 1 138 GLY n 1 139 GLY n 1 140 PRO n 1 141 ALA n 1 142 ALA n 1 143 MET n 1 144 THR n 1 145 GLN n 1 146 TYR n 1 147 PHE n 1 148 ARG n 1 149 LYS n 1 150 ILE n 1 151 GLY n 1 152 ASP n 1 153 SER n 1 154 VAL n 1 155 SER n 1 156 ARG n 1 157 LEU n 1 158 ASP n 1 159 ARG n 1 160 LYS n 1 161 GLU n 1 162 PRO n 1 163 GLU n 1 164 MET n 1 165 GLY n 1 166 ASP n 1 167 ASN n 1 168 THR n 1 169 PRO n 1 170 GLY n 1 171 ASP n 1 172 LEU n 1 173 ARG n 1 174 ASP n 1 175 THR n 1 176 THR n 1 177 THR n 1 178 PRO n 1 179 ILE n 1 180 ALA n 1 181 MET n 1 182 ALA n 1 183 ARG n 1 184 THR n 1 185 VAL n 1 186 ALA n 1 187 LYS n 1 188 VAL n 1 189 LEU n 1 190 TYR n 1 191 GLY n 1 192 GLY n 1 193 ALA n 1 194 LEU n 1 195 THR n 1 196 SER n 1 197 THR n 1 198 SER n 1 199 THR n 1 200 HIS n 1 201 THR n 1 202 ILE n 1 203 GLU n 1 204 ARG n 1 205 TRP n 1 206 LEU n 1 207 ILE n 1 208 GLY n 1 209 ASN n 1 210 GLN n 1 211 THR n 1 212 GLY n 1 213 ASP n 1 214 ALA n 1 215 THR n 1 216 LEU n 1 217 ARG n 1 218 ALA n 1 219 GLY n 1 220 PHE n 1 221 PRO n 1 222 LYS n 1 223 ASP n 1 224 TRP n 1 225 VAL n 1 226 VAL n 1 227 GLY n 1 228 GLU n 1 229 LYS n 1 230 THR n 1 231 GLY n 1 232 THR n 1 233 CYS n 1 234 ALA n 1 235 ASN n 1 236 GLY n 1 237 GLY n 1 238 ARG n 1 239 ASN n 1 240 ASP n 1 241 ILE n 1 242 GLY n 1 243 PHE n 1 244 PHE n 1 245 LYS n 1 246 ALA n 1 247 GLN n 1 248 GLU n 1 249 ARG n 1 250 ASP n 1 251 TYR n 1 252 ALA n 1 253 VAL n 1 254 ALA n 1 255 VAL n 1 256 TYR n 1 257 THR n 1 258 THR n 1 259 ALA n 1 260 PRO n 1 261 LYS n 1 262 LEU n 1 263 SER n 1 264 ALA n 1 265 VAL n 1 266 GLU n 1 267 ARG n 1 268 ASP n 1 269 GLU n 1 270 LEU n 1 271 VAL n 1 272 ALA n 1 273 SER n 1 274 VAL n 1 275 GLY n 1 276 GLN n 1 277 VAL n 1 278 ILE n 1 279 THR n 1 280 GLN n 1 281 LEU n 1 282 ILE n 1 283 LEU n 1 284 SER n 1 285 THR n 1 286 ASP n 1 287 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ges-1, blaGES-1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9KJY7_KLEPN _struct_ref.pdbx_db_accession Q9KJY7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRFIHALLLAGIAHSAYASEKLTFKTDLEKLEREKAAQIGVAIVDPQGEIVAGHRMAQRFAMCSTFKFPLAALVFERIDS GTERGDRKLSYGPDMIVEWSPATERFLASGHMTVLEAAQAAVQLSDNGATNLLLREIGGPAAMTQYFRKIGDSVSRLDRK EPEMGDNTPGDLRDTTTPIAMARTVAKVLYGGALTSTSTHTIERWLIGNQTGDATLRAGFPKDWVVGEKTGTCANGGRND IGFFKAQERDYAVAVYTTAPKLSAVERDELVASVGQVITQLILSTDK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2QPN A 1 ? 287 ? Q9KJY7 1 ? 287 ? 1 287 2 1 2QPN B 1 ? 287 ? Q9KJY7 1 ? 287 ? 1 287 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2QPN _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.92 _exptl_crystal.density_percent_sol 36.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details '10% PEG8000, 10% PEG1000, VAPOR DIFFUSION, SITTING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.pdbx_collection_date 2007-05-23 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.82653 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.82653 # _reflns.entry_id 2QPN _reflns.observed_criterion_sigma_F 4.0 _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.0 _reflns.d_resolution_low 20.0 _reflns.number_all 237028 _reflns.number_obs 163829 _reflns.percent_possible_obs 93.4 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.47 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.0 _reflns_shell.d_res_low 1.05 _reflns_shell.percent_possible_all 90.1 _reflns_shell.Rmerge_I_obs 0.349 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.69 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2QPN _refine.ls_d_res_high 1.1 _refine.ls_d_res_low 10.0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 179807 _refine.ls_number_reflns_obs 163829 _refine.ls_number_reflns_R_free 9025 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.1354 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.133 _refine.ls_R_factor_R_free 0.1821 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details '5% randomly selected' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean 18.0 _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details 'anisotropic displacement parameter refinement' _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 4135 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 728 _refine_hist.number_atoms_total 4873 _refine_hist.d_res_high 1.1 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.032 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.072 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.082 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.098 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.092 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2QPN _struct.title 'GES-1 beta-lactamase' _struct.pdbx_descriptor 'Beta-lactamase GES-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2QPN _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'beta-lactamase, apo-enzyme, Plasmid, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 21 ? ALA A 36 ? LYS A 21 ALA A 36 1 ? 16 HELX_P HELX_P2 2 CYS A 63 ? THR A 65 ? CYS A 63 THR A 65 5 ? 3 HELX_P HELX_P3 3 PHE A 66 ? SER A 80 ? PHE A 66 SER A 80 1 ? 15 HELX_P HELX_P4 4 GLY A 92 ? ILE A 96 ? GLY A 92 ILE A 96 5 ? 5 HELX_P HELX_P5 5 SER A 100 ? LEU A 107 ? SER A 100 LEU A 107 1 ? 8 HELX_P HELX_P6 6 VAL A 114 ? SER A 125 ? VAL A 114 SER A 125 1 ? 12 HELX_P HELX_P7 7 ASP A 126 ? GLY A 138 ? ASP A 126 GLY A 138 1 ? 13 HELX_P HELX_P8 8 GLY A 138 ? ILE A 150 ? GLY A 138 ILE A 150 1 ? 13 HELX_P HELX_P9 9 PRO A 162 ? ASP A 166 ? PRO A 162 ASP A 166 5 ? 5 HELX_P HELX_P10 10 THR A 177 ? TYR A 190 ? THR A 177 TYR A 190 1 ? 14 HELX_P HELX_P11 11 THR A 195 ? GLY A 208 ? THR A 195 GLY A 208 1 ? 14 HELX_P HELX_P12 12 THR A 215 ? PHE A 220 ? THR A 215 PHE A 220 5 ? 6 HELX_P HELX_P13 13 SER A 263 ? THR A 285 ? SER A 263 THR A 285 1 ? 23 HELX_P HELX_P14 14 SER B 19 ? ALA B 36 ? SER B 19 ALA B 36 1 ? 18 HELX_P HELX_P15 15 CYS B 63 ? THR B 65 ? CYS B 63 THR B 65 5 ? 3 HELX_P HELX_P16 16 PHE B 66 ? SER B 80 ? PHE B 66 SER B 80 1 ? 15 HELX_P HELX_P17 17 GLY B 92 ? ILE B 96 ? GLY B 92 ILE B 96 5 ? 5 HELX_P HELX_P18 18 SER B 100 ? LEU B 107 ? SER B 100 LEU B 107 1 ? 8 HELX_P HELX_P19 19 VAL B 114 ? SER B 125 ? VAL B 114 SER B 125 1 ? 12 HELX_P HELX_P20 20 ASP B 126 ? GLY B 138 ? ASP B 126 GLY B 138 1 ? 13 HELX_P HELX_P21 21 GLY B 138 ? ILE B 150 ? GLY B 138 ILE B 150 1 ? 13 HELX_P HELX_P22 22 PRO B 162 ? ASP B 166 ? PRO B 162 ASP B 166 5 ? 5 HELX_P HELX_P23 23 THR B 177 ? GLY B 191 ? THR B 177 GLY B 191 1 ? 15 HELX_P HELX_P24 24 THR B 195 ? GLY B 208 ? THR B 195 GLY B 208 1 ? 14 HELX_P HELX_P25 25 THR B 215 ? PHE B 220 ? THR B 215 PHE B 220 1 ? 6 HELX_P HELX_P26 26 SER B 263 ? SER B 284 ? SER B 263 SER B 284 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 63 SG A ? ? 1_555 A CYS 233 SG ? ? A CYS 63 A CYS 233 1_555 ? ? ? ? ? ? ? 2.170 ? disulf2 disulf ? ? B CYS 63 SG A ? ? 1_555 B CYS 233 SG ? ? B CYS 63 B CYS 233 1_555 ? ? ? ? ? ? ? 2.323 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 161 A . ? GLU 161 A PRO 162 A ? PRO 162 A 1 -1.11 2 GLU 161 B . ? GLU 161 B PRO 162 B ? PRO 162 B 1 -0.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? D ? 5 ? E ? 2 ? F ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel D 4 5 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 50 ? HIS A 54 ? ILE A 50 HIS A 54 A 2 GLN A 38 ? VAL A 44 ? GLN A 38 VAL A 44 A 3 ARG A 249 ? THR A 258 ? ARG A 249 THR A 258 A 4 GLY A 237 ? ALA A 246 ? GLY A 237 ALA A 246 A 5 VAL A 225 ? CYS A 233 ? VAL A 225 CYS A 233 B 1 PHE A 60 ? ALA A 61 ? PHE A 60 ALA A 61 B 2 THR A 175 ? THR A 176 ? THR A 175 THR A 176 C 1 LYS A 88 ? SER A 90 ? LYS A 88 SER A 90 C 2 HIS A 111 ? THR A 113 ? HIS A 111 THR A 113 D 1 ILE B 50 ? HIS B 54 ? ILE B 50 HIS B 54 D 2 GLN B 38 ? VAL B 44 ? GLN B 38 VAL B 44 D 3 ARG B 249 ? THR B 258 ? ARG B 249 THR B 258 D 4 GLY B 237 ? ALA B 246 ? GLY B 237 ALA B 246 D 5 VAL B 225 ? CYS B 233 ? VAL B 225 CYS B 233 E 1 PHE B 60 ? ALA B 61 ? PHE B 60 ALA B 61 E 2 THR B 175 ? THR B 176 ? THR B 175 THR B 176 F 1 LYS B 88 ? SER B 90 ? LYS B 88 SER B 90 F 2 HIS B 111 ? THR B 113 ? HIS B 111 THR B 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 51 ? O VAL A 51 N ILE A 43 ? N ILE A 43 A 2 3 N GLY A 40 ? N GLY A 40 O TYR A 256 ? O TYR A 256 A 3 4 O VAL A 255 ? O VAL A 255 N ASP A 240 ? N ASP A 240 A 4 5 O ILE A 241 ? O ILE A 241 N LYS A 229 ? N LYS A 229 B 1 2 N PHE A 60 ? N PHE A 60 O THR A 176 ? O THR A 176 C 1 2 N LEU A 89 ? N LEU A 89 O MET A 112 ? O MET A 112 D 1 2 O VAL B 51 ? O VAL B 51 N ILE B 43 ? N ILE B 43 D 2 3 N GLY B 40 ? N GLY B 40 O TYR B 256 ? O TYR B 256 D 3 4 O VAL B 253 ? O VAL B 253 N GLY B 242 ? N GLY B 242 D 4 5 O ASN B 239 ? O ASN B 239 N GLY B 231 ? N GLY B 231 E 1 2 N PHE B 60 ? N PHE B 60 O THR B 176 ? O THR B 176 F 1 2 N LEU B 89 ? N LEU B 89 O MET B 112 ? O MET B 112 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 300' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 B 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 SER A 64 ? SER A 64 . ? 1_555 ? 2 AC1 9 SER A 125 ? SER A 125 . ? 1_555 ? 3 AC1 9 LYS A 229 ? LYS A 229 . ? 1_555 ? 4 AC1 9 THR A 230 ? THR A 230 . ? 1_555 ? 5 AC1 9 GLY A 231 ? GLY A 231 . ? 1_555 ? 6 AC1 9 THR A 232 ? THR A 232 . ? 1_555 ? 7 AC1 9 ARG A 238 ? ARG A 238 . ? 1_555 ? 8 AC1 9 HOH E . ? HOH A 302 . ? 1_555 ? 9 AC1 9 HOH E . ? HOH A 539 . ? 1_555 ? 10 AC2 8 SER B 64 ? SER B 64 . ? 1_555 ? 11 AC2 8 SER B 125 ? SER B 125 . ? 1_555 ? 12 AC2 8 LYS B 229 ? LYS B 229 . ? 1_555 ? 13 AC2 8 THR B 230 ? THR B 230 . ? 1_555 ? 14 AC2 8 GLY B 231 ? GLY B 231 . ? 1_555 ? 15 AC2 8 THR B 232 ? THR B 232 . ? 1_555 ? 16 AC2 8 ARG B 238 ? ARG B 238 . ? 1_555 ? 17 AC2 8 HOH F . ? HOH B 302 . ? 1_555 ? # _database_PDB_matrix.entry_id 2QPN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2QPN _atom_sites.fract_transf_matrix[1][1] 0.023579 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004767 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012373 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014281 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_asym_id _atom_site.label_entity_id _atom_site.label_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.B_iso_or_equiv _atom_site.pdbx_formal_charge _atom_site.auth_seq_id _atom_site.auth_comp_id _atom_site.auth_asym_id _atom_site.auth_atom_id _atom_site.pdbx_PDB_model_num ATOM 1 N N . LYS A 1 21 ? -4.039 -23.093 25.261 1.00 17.68 ? 21 LYS A N 1 ATOM 2 C CA . LYS A 1 21 ? -3.481 -22.989 26.619 1.00 25.81 ? 21 LYS A CA 1 ATOM 3 C C . LYS A 1 21 ? -2.422 -24.059 26.965 1.00 34.51 ? 21 LYS A C 1 ATOM 4 O O . LYS A 1 21 ? -1.419 -23.638 27.640 1.00 24.95 ? 21 LYS A O 1 ATOM 5 C CB . LYS A 1 21 ? -4.134 -22.638 27.941 1.00 16.68 ? 21 LYS A CB 1 ATOM 6 C CG . LYS A 1 21 ? -3.947 -21.194 28.390 1.00 31.49 ? 21 LYS A CG 1 ATOM 7 C CD . LYS A 1 21 ? -5.059 -20.527 29.131 1.00 36.43 ? 21 LYS A CD 1 ATOM 8 C CE . LYS A 1 21 ? -4.753 -20.304 30.612 1.00 35.90 ? 21 LYS A CE 1 ATOM 9 N NZ . LYS A 1 21 ? -5.441 -21.405 31.389 1.00 45.56 ? 21 LYS A NZ 1 ATOM 10 N N . LEU A 1 22 ? -2.505 -25.322 26.533 1.00 33.43 ? 22 LEU A N 1 ATOM 11 C CA . LEU A 1 22 ? -1.166 -25.946 26.582 1.00 30.35 ? 22 LEU A CA 1 ATOM 12 C C . LEU A 1 22 ? -0.575 -25.673 25.201 1.00 21.07 ? 22 LEU A C 1 ATOM 13 O O . LEU A 1 22 ? 0.618 -25.633 25.249 1.00 21.56 ? 22 LEU A O 1 ATOM 14 C CB . LEU A 1 22 ? -1.041 -27.368 27.081 1.00 33.60 ? 22 LEU A CB 1 ATOM 15 C CG . LEU A 1 22 ? -1.255 -27.502 28.615 1.00 34.07 ? 22 LEU A CG 1 ATOM 16 C CD1 . LEU A 1 22 ? -2.754 -27.552 28.892 1.00 26.19 ? 22 LEU A CD1 1 ATOM 17 C CD2 . LEU A 1 22 ? -0.448 -28.641 29.179 1.00 36.10 ? 22 LEU A CD2 1 ATOM 18 N N . THR A 1 23 ? -1.393 -25.319 24.190 1.00 18.56 ? 23 THR A N 1 ATOM 19 C CA . THR A 1 23 ? -0.890 -24.709 22.989 1.00 16.00 ? 23 THR A CA 1 ATOM 20 C C . THR A 1 23 ? -0.171 -23.435 23.389 1.00 16.58 ? 23 THR A C 1 ATOM 21 O O . THR A 1 23 ? 0.945 -23.206 22.967 1.00 16.91 ? 23 THR A O 1 ATOM 22 C CB . THR A 1 23 ? -1.984 -24.454 21.918 1.00 18.43 ? 23 THR A CB 1 ATOM 23 O OG1 . THR A 1 23 ? -2.506 -25.730 21.518 1.00 20.46 ? 23 THR A OG1 1 ATOM 24 C CG2 . THR A 1 23 ? -1.333 -23.759 20.746 1.00 29.02 ? 23 THR A CG2 1 ATOM 25 N N . PHE A 1 24 ? -0.679 -22.596 24.238 1.00 16.11 ? 24 PHE A N 1 ATOM 26 C CA . PHE A 1 24 ? -0.178 -21.348 24.723 1.00 12.15 ? 24 PHE A CA 1 ATOM 27 C C . PHE A 1 24 ? 1.121 -21.675 25.459 1.00 13.01 ? 24 PHE A C 1 ATOM 28 O O . PHE A 1 24 ? 2.142 -21.111 25.030 1.00 11.76 ? 24 PHE A O 1 ATOM 29 C CB . PHE A 1 24 ? -1.069 -20.581 25.612 1.00 14.37 ? 24 PHE A CB 1 ATOM 30 C CG . PHE A 1 24 ? -0.698 -19.343 26.276 1.00 12.29 ? 24 PHE A CG 1 ATOM 31 C CD1 . PHE A 1 24 ? -0.179 -19.321 27.544 1.00 13.46 ? 24 PHE A CD1 1 ATOM 32 C CD2 . PHE A 1 24 ? -0.843 -18.137 25.594 1.00 14.00 ? 24 PHE A CD2 1 ATOM 33 C CE1 . PHE A 1 24 ? 0.189 -18.112 28.126 1.00 13.29 ? 24 PHE A CE1 1 ATOM 34 C CE2 . PHE A 1 24 ? -0.442 -16.957 26.167 1.00 14.21 ? 24 PHE A CE2 1 ATOM 35 C CZ . PHE A 1 24 ? 0.081 -16.952 27.407 1.00 17.15 ? 24 PHE A CZ 1 ATOM 36 N N . LYS A 1 25 ? 1.123 -22.524 26.479 1.00 13.09 ? 25 LYS A N 1 ATOM 37 C CA . LYS A 1 25 ? 2.375 -22.806 27.163 1.00 13.45 ? 25 LYS A CA 1 ATOM 38 C C . LYS A 1 25 ? 3.404 -23.395 26.218 1.00 13.91 ? 25 LYS A C 1 ATOM 39 O O . LYS A 1 25 ? 4.576 -23.013 26.171 1.00 13.57 ? 25 LYS A O 1 ATOM 40 C CB . LYS A 1 25 ? 2.144 -23.765 28.322 1.00 15.51 ? 25 LYS A CB 1 ATOM 41 C CG . LYS A 1 25 ? 3.405 -24.209 29.024 1.00 18.38 ? 25 LYS A CG 1 ATOM 42 C CD . LYS A 1 25 ? 3.001 -25.071 30.201 1.00 25.29 ? 25 LYS A CD 1 ATOM 43 C CE . LYS A 1 25 ? 4.111 -25.775 30.957 1.00 29.76 ? 25 LYS A CE 1 ATOM 44 N NZ . LYS A 1 25 ? 5.110 -24.887 31.580 1.00 50.71 ? 25 LYS A NZ 1 ATOM 45 N N . THR A 1 26 ? 2.971 -24.422 25.460 1.00 13.76 ? 26 THR A N 1 ATOM 46 C CA . THR A 1 26 ? 3.879 -25.113 24.538 1.00 16.49 ? 26 THR A CA 1 ATOM 47 C C . THR A 1 26 ? 4.505 -24.167 23.536 1.00 12.89 ? 26 THR A C 1 ATOM 48 O O . THR A 1 26 ? 5.702 -24.260 23.232 1.00 14.19 ? 26 THR A O 1 ATOM 49 C CB . THR A 1 26 ? 3.101 -26.242 23.783 1.00 21.20 ? 26 THR A CB 1 ATOM 50 O OG1 . THR A 1 26 ? 2.583 -27.162 24.753 1.00 26.04 ? 26 THR A OG1 1 ATOM 51 C CG2 . THR A 1 26 ? 3.966 -27.015 22.791 1.00 27.67 ? 26 THR A CG2 1 ATOM 52 N N . ASP A 1 27 ? 3.708 -23.274 22.976 1.00 12.05 ? 27 ASP A N 1 ATOM 53 C CA . ASP A 1 27 ? 4.225 -22.390 21.958 1.00 13.61 ? 27 ASP A CA 1 ATOM 54 C C . ASP A 1 27 ? 5.172 -21.399 22.589 1.00 13.04 ? 27 ASP A C 1 ATOM 55 O O . ASP A 1 27 ? 6.189 -21.050 21.978 1.00 12.64 ? 27 ASP A O 1 ATOM 56 C CB . ASP A 1 27 ? 3.099 -21.682 21.205 1.00 17.92 ? 27 ASP A CB 1 ATOM 57 C CG . ASP A 1 27 ? 2.521 -22.646 20.170 1.00 23.32 ? 27 ASP A CG 1 ATOM 58 O OD1 . ASP A 1 27 ? 3.098 -23.748 20.057 1.00 34.68 ? 27 ASP A OD1 1 ATOM 59 O OD2 . ASP A 1 27 ? 1.514 -22.310 19.535 1.00 25.35 ? 27 ASP A OD2 1 ATOM 60 N N . LEU A 1 28 ? 4.873 -20.912 23.788 1.00 11.59 ? 28 LEU A N 1 ATOM 61 C CA . LEU A 1 28 ? 5.863 -19.994 24.381 1.00 11.36 ? 28 LEU A CA 1 ATOM 62 C C . LEU A 1 28 ? 7.152 -20.703 24.745 1.00 12.39 ? 28 LEU A C 1 ATOM 63 O O . LEU A 1 28 ? 8.225 -20.113 24.590 1.00 12.02 ? 28 LEU A O 1 ATOM 64 C CB . LEU A 1 28 ? 5.288 -19.341 25.618 1.00 12.11 ? 28 LEU A CB 1 ATOM 65 C CG . LEU A 1 28 ? 4.114 -18.383 25.367 1.00 11.26 ? 28 LEU A CG 1 ATOM 66 C CD1 . LEU A 1 28 ? 3.625 -17.872 26.710 1.00 12.44 ? 28 LEU A CD1 1 ATOM 67 C CD2 . LEU A 1 28 ? 4.487 -17.223 24.475 1.00 11.91 ? 28 LEU A CD2 1 ATOM 68 N N . GLU A 1 29 ? 7.087 -21.952 25.199 1.00 11.85 ? 29 GLU A N 1 ATOM 69 C CA . GLU A 1 29 ? 8.324 -22.659 25.564 1.00 14.71 ? 29 GLU A CA 1 ATOM 70 C C . GLU A 1 29 ? 9.133 -22.957 24.345 1.00 14.51 ? 29 GLU A C 1 ATOM 71 O O . GLU A 1 29 ? 10.366 -22.966 24.389 1.00 14.22 ? 29 GLU A O 1 ATOM 72 C CB . GLU A 1 29 ? 7.982 -23.930 26.350 1.00 17.16 ? 29 GLU A CB 1 ATOM 73 C CG . GLU A 1 29 ? 7.474 -23.562 27.735 1.00 27.52 ? 29 GLU A CG 1 ATOM 74 C CD . GLU A 1 29 ? 6.928 -24.648 28.618 1.00 39.69 ? 29 GLU A CD 1 ATOM 75 O OE1 . GLU A 1 29 ? 6.636 -25.764 28.161 1.00 40.95 ? 29 GLU A OE1 1 ATOM 76 O OE2 . GLU A 1 29 ? 6.778 -24.322 29.818 1.00 47.05 ? 29 GLU A OE2 1 ATOM 77 N N . LYS A 1 30 ? 8.483 -23.192 23.207 1.00 13.65 ? 30 LYS A N 1 ATOM 78 C CA . LYS A 1 30 ? 9.274 -23.384 22.001 1.00 15.54 ? 30 LYS A CA 1 ATOM 79 C C . LYS A 1 30 ? 10.005 -22.110 21.618 1.00 14.50 ? 30 LYS A C 1 ATOM 80 O O . LYS A 1 30 ? 11.171 -22.190 21.207 1.00 15.96 ? 30 LYS A O 1 ATOM 81 C CB . LYS A 1 30 ? 8.383 -23.891 20.861 1.00 18.43 ? 30 LYS A CB 1 ATOM 82 C CG . LYS A 1 30 ? 8.987 -24.045 19.508 1.00 22.26 ? 30 LYS A CG 1 ATOM 83 C CD . LYS A 1 30 ? 8.008 -24.416 18.404 1.00 29.51 ? 30 LYS A CD 1 ATOM 84 C CE . LYS A 1 30 ? 8.698 -24.511 17.049 1.00 33.21 ? 30 LYS A CE 1 ATOM 85 N NZ . LYS A 1 30 ? 9.429 -25.807 16.874 1.00 49.30 ? 30 LYS A NZ 1 ATOM 86 N N . LEU A 1 31 ? 9.378 -20.951 21.662 1.00 13.03 ? 31 LEU A N 1 ATOM 87 C CA . LEU A 1 31 ? 10.066 -19.715 21.445 1.00 13.59 ? 31 LEU A CA 1 ATOM 88 C C . LEU A 1 31 ? 11.207 -19.524 22.442 1.00 12.45 ? 31 LEU A C 1 ATOM 89 O O . LEU A 1 31 ? 12.274 -19.112 21.998 1.00 13.64 ? 31 LEU A O 1 ATOM 90 C CB . LEU A 1 31 ? 9.150 -18.498 21.641 1.00 16.24 ? 31 LEU A CB 1 ATOM 91 C CG . LEU A 1 31 ? 8.137 -18.295 20.537 1.00 17.89 ? 31 LEU A CG 1 ATOM 92 C CD1 . LEU A 1 31 ? 7.126 -17.231 20.915 1.00 21.63 ? 31 LEU A CD1 1 ATOM 93 C CD2 . LEU A 1 31 ? 8.797 -17.824 19.235 1.00 19.79 ? 31 LEU A CD2 1 ATOM 94 N N . GLU A 1 32 ? 10.995 -19.813 23.709 1.00 12.28 ? 32 GLU A N 1 ATOM 95 C CA . GLU A 1 32 ? 12.083 -19.675 24.671 1.00 12.37 ? 32 GLU A CA 1 ATOM 96 C C . GLU A 1 32 ? 13.274 -20.555 24.346 1.00 13.16 ? 32 GLU A C 1 ATOM 97 O O . GLU A 1 32 ? 14.441 -20.119 24.419 1.00 13.42 ? 32 GLU A O 1 ATOM 98 C CB . GLU A 1 32 ? 11.600 -20.031 26.066 1.00 11.95 ? 32 GLU A CB 1 ATOM 99 C CG . GLU A 1 32 ? 10.643 -19.038 26.681 1.00 11.95 ? 32 GLU A CG 1 ATOM 100 C CD . GLU A 1 32 ? 10.323 -19.316 28.131 1.00 13.81 ? 32 GLU A CD 1 ATOM 101 O OE1 . GLU A 1 32 ? 10.473 -20.479 28.612 1.00 23.10 ? 32 GLU A OE1 1 ATOM 102 O OE2 . GLU A 1 32 ? 9.972 -18.372 28.842 1.00 12.45 ? 32 GLU A OE2 1 ATOM 103 N N . ARG A 1 33 ? 13.007 -21.789 23.958 1.00 12.80 ? 33 ARG A N 1 ATOM 104 C CA . ARG A 1 33 ? 14.070 -22.732 23.715 1.00 16.41 ? 33 ARG A CA 1 ATOM 105 C C . ARG A 1 33 ? 14.846 -22.304 22.479 1.00 16.84 ? 33 ARG A C 1 ATOM 106 O O . ARG A 1 33 ? 16.085 -22.297 22.378 1.00 22.55 ? 33 ARG A O 1 ATOM 107 C CB . ARG A 1 33 ? 13.501 -24.147 23.539 1.00 19.70 ? 33 ARG A CB 1 ATOM 108 C CG . ARG A 1 33 ? 12.871 -24.753 24.756 1.00 25.57 ? 33 ARG A CG 1 ATOM 109 C CD . ARG A 1 33 ? 12.579 -26.240 24.628 1.00 39.44 ? 33 ARG A CD 1 ATOM 110 N NE . ARG A 1 33 ? 11.390 -26.496 23.802 1.00 52.35 ? 33 ARG A NE 1 ATOM 111 C CZ . ARG A 1 33 ? 11.400 -26.655 22.490 1.00 52.86 ? 33 ARG A CZ 1 ATOM 112 N NH1 . ARG A 1 33 ? 12.521 -26.584 21.770 1.00 62.89 ? 33 ARG A NH1 1 ATOM 113 N NH2 . ARG A 1 33 ? 10.263 -26.885 21.831 1.00 60.28 ? 33 ARG A NH2 1 ATOM 114 N N . GLU A 1 34 ? 14.123 -21.910 21.423 1.00 19.11 ? 34 GLU A N 1 ATOM 115 C CA . GLU A 1 34 ? 14.720 -21.620 20.149 1.00 20.88 ? 34 GLU A CA 1 ATOM 116 C C . GLU A 1 34 ? 15.412 -20.277 20.110 1.00 18.64 ? 34 GLU A C 1 ATOM 117 O O . GLU A 1 34 ? 16.401 -20.116 19.383 1.00 22.68 ? 34 GLU A O 1 ATOM 118 C CB . GLU A 1 34 ? 13.610 -21.734 19.080 1.00 23.72 ? 34 GLU A CB 1 ATOM 119 C CG . GLU A 1 34 ? 13.192 -23.181 18.904 1.00 25.97 ? 34 GLU A CG 1 ATOM 120 C CD . GLU A 1 34 ? 12.294 -23.498 17.741 0.46 31.30 ? 34 GLU A CD 1 ATOM 121 O OE1 . GLU A 1 34 ? 11.418 -22.675 17.409 0.46 41.84 ? 34 GLU A OE1 1 ATOM 122 O OE2 . GLU A 1 34 ? 12.446 -24.593 17.144 0.46 39.58 ? 34 GLU A OE2 1 ATOM 123 N N . LYS A 1 35 ? 14.977 -19.327 20.915 1.00 17.00 ? 35 LYS A N 1 ATOM 124 C CA . LYS A 1 35 ? 15.585 -17.992 20.907 1.00 20.07 ? 35 LYS A CA 1 ATOM 125 C C . LYS A 1 35 ? 16.480 -17.732 22.119 1.00 20.42 ? 35 LYS A C 1 ATOM 126 O O . LYS A 1 35 ? 17.059 -16.648 22.287 1.00 21.11 ? 35 LYS A O 1 ATOM 127 C CB . LYS A 1 35 ? 14.476 -16.940 20.821 1.00 23.76 ? 35 LYS A CB 1 ATOM 128 C CG . LYS A 1 35 ? 13.630 -17.028 19.564 1.00 27.11 ? 35 LYS A CG 1 ATOM 129 C CD . LYS A 1 35 ? 14.429 -16.967 18.273 1.00 31.68 ? 35 LYS A CD 1 ATOM 130 C CE . LYS A 1 35 ? 13.445 -17.054 17.106 1.00 36.67 ? 35 LYS A CE 1 ATOM 131 N NZ . LYS A 1 35 ? 14.093 -17.255 15.786 1.00 43.25 ? 35 LYS A NZ 1 ATOM 132 N N . ALA A 1 36 ? 16.617 -18.761 22.941 1.00 18.31 ? 36 ALA A N 1 ATOM 133 C CA . ALA A 1 36 ? 17.377 -18.671 24.198 1.00 16.99 ? 36 ALA A CA 1 ATOM 134 C C . ALA A 1 36 ? 16.839 -17.503 25.011 1.00 15.49 ? 36 ALA A C 1 ATOM 135 O O . ALA A 1 36 ? 17.603 -16.639 25.430 1.00 16.66 ? 36 ALA A O 1 ATOM 136 C CB . ALA A 1 36 ? 18.866 -18.588 23.904 1.00 21.44 ? 36 ALA A CB 1 ATOM 137 N N . ALA A 1 37 ? 15.537 -17.474 25.239 1.00 13.83 ? 37 ALA A N 1 ATOM 138 C CA . ALA A 1 37 ? 14.843 -16.359 25.859 1.00 12.66 ? 37 ALA A CA 1 ATOM 139 C C . ALA A 1 37 ? 14.052 -16.827 27.062 1.00 11.38 ? 37 ALA A C 1 ATOM 140 O O . ALA A 1 37 ? 13.715 -18.007 27.160 1.00 12.58 ? 37 ALA A O 1 ATOM 141 C CB . ALA A 1 37 ? 13.921 -15.717 24.816 1.00 15.05 ? 37 ALA A CB 1 ATOM 142 N N . GLN A 1 38 ? 13.725 -15.883 27.925 1.00 11.44 ? 38 GLN A N 1 ATOM 143 C CA . GLN A 1 38 ? 12.728 -16.053 28.941 1.00 11.38 ? 38 GLN A CA 1 ATOM 144 C C . GLN A 1 38 ? 11.590 -15.095 28.595 1.00 10.50 ? 38 GLN A C 1 ATOM 145 O O . GLN A 1 38 ? 11.893 -13.902 28.362 1.00 11.98 ? 38 GLN A O 1 ATOM 146 C CB . GLN A 1 38 ? 13.269 -15.786 30.326 1.00 12.07 ? 38 GLN A CB 1 ATOM 147 C CG . GLN A 1 38 ? 14.337 -16.779 30.750 1.00 16.66 ? 38 GLN A CG 1 ATOM 148 C CD . GLN A 1 38 ? 14.831 -16.508 32.150 1.00 17.63 ? 38 GLN A CD 1 ATOM 149 O OE1 . GLN A 1 38 ? 14.636 -15.513 32.869 1.00 25.92 ? 38 GLN A OE1 1 ATOM 150 N NE2 . GLN A 1 38 ? 15.520 -17.537 32.588 1.00 23.31 ? 38 GLN A NE2 1 ATOM 151 N N . ILE A 1 39 ? 10.377 -15.580 28.649 1.00 10.35 ? 39 ILE A N 1 ATOM 152 C CA . ILE A 1 39 ? 9.198 -14.840 28.268 1.00 9.40 ? 39 ILE A CA 1 ATOM 153 C C . ILE A 1 39 ? 8.206 -14.869 29.434 1.00 9.24 ? 39 ILE A C 1 ATOM 154 O O . ILE A 1 39 ? 7.683 -15.907 29.788 1.00 11.96 ? 39 ILE A O 1 ATOM 155 C CB . ILE A 1 39 ? 8.541 -15.422 26.990 1.00 10.87 ? 39 ILE A CB 1 ATOM 156 C CG1 . ILE A 1 39 ? 9.527 -15.403 25.835 1.00 11.21 ? 39 ILE A CG1 1 ATOM 157 C CG2 . ILE A 1 39 ? 7.230 -14.723 26.723 1.00 12.47 ? 39 ILE A CG2 1 ATOM 158 C CD1 . ILE A 1 39 ? 9.090 -16.207 24.612 1.00 14.35 ? 39 ILE A CD1 1 ATOM 159 N N . GLY A 1 40 ? 7.970 -13.695 29.981 1.00 8.60 ? 40 GLY A N 1 ATOM 160 C CA . GLY A 1 40 ? 6.979 -13.489 31.023 1.00 8.86 ? 40 GLY A CA 1 ATOM 161 C C . GLY A 1 40 ? 5.740 -12.841 30.432 1.00 8.39 ? 40 GLY A C 1 ATOM 162 O O . GLY A 1 40 ? 5.840 -11.803 29.778 1.00 11.13 ? 40 GLY A O 1 ATOM 163 N N . VAL A 1 41 ? 4.595 -13.471 30.652 1.00 9.51 ? 41 VAL A N 1 ATOM 164 C CA . VAL A 1 41 ? 3.325 -12.961 30.153 1.00 9.05 ? 41 VAL A CA 1 ATOM 165 C C . VAL A 1 41 ? 2.246 -13.059 31.234 1.00 8.77 ? 41 VAL A C 1 ATOM 166 O O . VAL A 1 41 ? 2.209 -14.056 31.930 1.00 10.47 ? 41 VAL A O 1 ATOM 167 C CB . VAL A 1 41 ? 2.841 -13.754 28.901 1.00 11.50 ? 41 VAL A CB 1 ATOM 168 C CG1 . VAL A 1 41 ? 1.538 -13.168 28.368 1.00 12.57 ? 41 VAL A CG1 1 ATOM 169 C CG2 . VAL A 1 41 ? 3.905 -13.847 27.837 1.00 13.51 ? 41 VAL A CG2 1 ATOM 170 N N . ALA A 1 42 ? 1.390 -12.042 31.321 1.00 8.49 ? 42 ALA A N 1 ATOM 171 C CA . ALA A 1 42 ? 0.159 -12.161 32.048 1.00 9.09 ? 42 ALA A CA 1 ATOM 172 C C . ALA A 1 42 ? -0.899 -11.433 31.229 1.00 9.45 ? 42 ALA A C 1 ATOM 173 O O . ALA A 1 42 ? -0.655 -10.315 30.766 1.00 9.68 ? 42 ALA A O 1 ATOM 174 C CB . ALA A 1 42 ? 0.276 -11.604 33.448 1.00 10.77 ? 42 ALA A CB 1 ATOM 175 N N . ILE A 1 43 ? -2.023 -12.090 31.109 1.00 9.37 ? 43 ILE A N 1 ATOM 176 C CA . ILE A 1 43 ? -3.231 -11.506 30.549 1.00 9.82 ? 43 ILE A CA 1 ATOM 177 C C . ILE A 1 43 ? -4.314 -11.537 31.648 1.00 10.21 ? 43 ILE A C 1 ATOM 178 O O . ILE A 1 43 ? -4.505 -12.628 32.171 1.00 11.21 ? 43 ILE A O 1 ATOM 179 C CB . ILE A 1 43 ? -3.774 -12.264 29.315 1.00 11.53 ? 43 ILE A CB 1 ATOM 180 C CG1 . ILE A 1 43 ? -2.713 -12.571 28.253 1.00 14.45 ? 43 ILE A CG1 1 ATOM 181 C CG2 . ILE A 1 43 ? -4.905 -11.521 28.654 1.00 13.76 ? 43 ILE A CG2 1 ATOM 182 C CD1 . ILE A 1 43 ? -3.200 -13.598 27.245 1.00 22.57 ? 43 ILE A CD1 1 ATOM 183 N N . VAL A 1 44 ? -4.912 -10.410 31.912 1.00 10.75 ? 44 VAL A N 1 ATOM 184 C CA . VAL A 1 44 ? -6.016 -10.377 32.856 1.00 12.00 ? 44 VAL A CA 1 ATOM 185 C C . VAL A 1 44 ? -7.224 -9.707 32.256 1.00 12.98 ? 44 VAL A C 1 ATOM 186 O O . VAL A 1 44 ? -7.140 -8.958 31.270 1.00 12.72 ? 44 VAL A O 1 ATOM 187 C CB . VAL A 1 44 ? -5.635 -9.683 34.173 1.00 12.67 ? 44 VAL A CB 1 ATOM 188 C CG1 . VAL A 1 44 ? -4.433 -10.385 34.787 1.00 14.42 ? 44 VAL A CG1 1 ATOM 189 C CG2 . VAL A 1 44 ? -5.358 -8.204 33.933 1.00 14.60 ? 44 VAL A CG2 1 ATOM 190 N N . ASP A 1 45 ? -8.391 -10.000 32.845 1.00 13.30 ? 45 ASP A N 1 ATOM 191 C CA . ASP A 1 45 ? -9.643 -9.369 32.480 1.00 15.14 ? 45 ASP A CA 1 ATOM 192 C C . ASP A 1 45 ? -9.734 -8.000 33.147 1.00 14.18 ? 45 ASP A C 1 ATOM 193 O O . ASP A 1 45 ? -8.831 -7.622 33.917 1.00 15.80 ? 45 ASP A O 1 ATOM 194 C CB . ASP A 1 45 ? -10.782 -10.348 32.793 1.00 15.77 ? 45 ASP A CB 1 ATOM 195 C CG . ASP A 1 45 ? -11.349 -10.261 34.166 1.00 16.85 ? 45 ASP A CG 1 ATOM 196 O OD1 . ASP A 1 45 ? -10.767 -9.670 35.072 1.00 20.40 ? 45 ASP A OD1 1 ATOM 197 O OD2 . ASP A 1 45 ? -12.412 -10.870 34.322 1.00 23.21 ? 45 ASP A OD2 1 ATOM 198 N N . PRO A 1 46 ? -10.759 -7.226 32.865 1.00 15.17 ? 46 PRO A N 1 ATOM 199 C CA . PRO A 1 46 ? -10.795 -5.877 33.429 1.00 14.99 ? 46 PRO A CA 1 ATOM 200 C C . PRO A 1 46 ? -10.725 -5.807 34.940 1.00 15.76 ? 46 PRO A C 1 ATOM 201 O O . PRO A 1 46 ? -10.318 -4.765 35.443 1.00 16.46 ? 46 PRO A O 1 ATOM 202 C CB . PRO A 1 46 ? -12.148 -5.355 32.918 1.00 17.11 ? 46 PRO A CB 1 ATOM 203 C CG . PRO A 1 46 ? -12.288 -6.019 31.575 1.00 16.99 ? 46 PRO A CG 1 ATOM 204 C CD . PRO A 1 46 ? -11.893 -7.436 31.906 1.00 15.03 ? 46 PRO A CD 1 ATOM 205 N N . GLN A 1 47 ? -11.137 -6.824 35.666 1.00 17.88 ? 47 GLN A N 1 ATOM 206 C CA . GLN A 1 47 ? -11.067 -6.860 37.118 1.00 19.62 ? 47 GLN A CA 1 ATOM 207 C C . GLN A 1 47 ? -9.801 -7.535 37.635 1.00 19.04 ? 47 GLN A C 1 ATOM 208 O O . GLN A 1 47 ? -9.616 -7.739 38.848 1.00 23.21 ? 47 GLN A O 1 ATOM 209 C CB . GLN A 1 47 ? -12.298 -7.553 37.709 1.00 21.83 ? 47 GLN A CB 1 ATOM 210 C CG . GLN A 1 47 ? -13.605 -6.810 37.533 1.00 26.78 ? 47 GLN A CG 1 ATOM 211 C CD . GLN A 1 47 ? -14.142 -6.951 36.115 1.00 31.27 ? 47 GLN A CD 1 ATOM 212 O OE1 . GLN A 1 47 ? -13.863 -7.967 35.482 1.00 40.76 ? 47 GLN A OE1 1 ATOM 213 N NE2 . GLN A 1 47 ? -14.920 -5.969 35.686 1.00 48.15 ? 47 GLN A NE2 1 ATOM 214 N N . GLY A 1 48 ? -8.868 -7.831 36.733 1.00 17.61 ? 48 GLY A N 1 ATOM 215 C CA . GLY A 1 48 ? -7.643 -8.469 37.134 1.00 17.72 ? 48 GLY A CA 1 ATOM 216 C C . GLY A 1 48 ? -7.616 -9.960 37.294 1.00 19.72 ? 48 GLY A C 1 ATOM 217 O O . GLY A 1 48 ? -6.627 -10.525 37.783 1.00 21.71 ? 48 GLY A O 1 ATOM 218 N N . GLU A 1 49 ? -8.704 -10.624 36.936 1.00 19.16 ? 49 GLU A N 1 ATOM 219 C CA . GLU A 1 49 ? -8.718 -12.074 36.967 1.00 20.56 ? 49 GLU A CA 1 ATOM 220 C C . GLU A 1 49 ? -7.878 -12.645 35.844 1.00 18.90 ? 49 GLU A C 1 ATOM 221 O O . GLU A 1 49 ? -7.875 -12.166 34.727 1.00 17.77 ? 49 GLU A O 1 ATOM 222 C CB . GLU A 1 49 ? -10.177 -12.553 36.900 1.00 22.96 ? 49 GLU A CB 1 ATOM 223 C CG . GLU A 1 49 ? -10.996 -11.959 38.041 1.00 28.51 ? 49 GLU A CG 1 ATOM 224 C CD . GLU A 1 49 ? -12.482 -12.124 38.028 0.65 27.12 ? 49 GLU A CD 1 ATOM 225 O OE1 . GLU A 1 49 ? -13.028 -12.643 37.032 0.65 41.35 ? 49 GLU A OE1 1 ATOM 226 O OE2 . GLU A 1 49 ? -13.236 -11.770 38.961 0.65 28.08 ? 49 GLU A OE2 1 ATOM 227 N N . ILE A 1 50 ? -7.146 -13.697 36.171 1.00 19.27 ? 50 ILE A N 1 ATOM 228 C CA . ILE A 1 50 ? -6.165 -14.265 35.279 1.00 16.74 ? 50 ILE A CA 1 ATOM 229 C C . ILE A 1 50 ? -6.807 -14.989 34.087 1.00 16.24 ? 50 ILE A C 1 ATOM 230 O O . ILE A 1 50 ? -7.608 -15.912 34.241 1.00 20.15 ? 50 ILE A O 1 ATOM 231 C CB . ILE A 1 50 ? -5.189 -15.165 36.052 1.00 17.47 ? 50 ILE A CB 1 ATOM 232 C CG1 . ILE A 1 50 ? -4.329 -14.400 37.033 1.00 20.18 ? 50 ILE A CG1 1 ATOM 233 C CG2 . ILE A 1 50 ? -4.304 -15.930 35.068 1.00 18.19 ? 50 ILE A CG2 1 ATOM 234 C CD1 . ILE A 1 50 ? -3.553 -15.220 38.040 1.00 26.95 ? 50 ILE A CD1 1 ATOM 235 N N . VAL A 1 51 ? -6.407 -14.594 32.889 1.00 14.73 ? 51 VAL A N 1 ATOM 236 C CA . VAL A 1 51 ? -6.807 -15.261 31.644 1.00 15.29 ? 51 VAL A CA 1 ATOM 237 C C . VAL A 1 51 ? -5.737 -16.242 31.201 1.00 15.35 ? 51 VAL A C 1 ATOM 238 O O . VAL A 1 51 ? -6.049 -17.366 30.820 1.00 20.34 ? 51 VAL A O 1 ATOM 239 C CB . VAL A 1 51 ? -7.116 -14.182 30.568 1.00 15.45 ? 51 VAL A CB 1 ATOM 240 C CG1 . VAL A 1 51 ? -7.290 -14.841 29.190 1.00 16.19 ? 51 VAL A CG1 1 ATOM 241 C CG2 . VAL A 1 51 ? -8.325 -13.351 30.952 1.00 15.62 ? 51 VAL A CG2 1 ATOM 242 N N . ALA A 1 52 ? -4.467 -15.844 31.249 1.00 13.35 ? 52 ALA A N 1 ATOM 243 C CA . ALA A 1 52 ? -3.322 -16.660 30.915 1.00 12.87 ? 52 ALA A CA 1 ATOM 244 C C . ALA A 1 52 ? -2.051 -16.075 31.487 1.00 12.36 ? 52 ALA A C 1 ATOM 245 O O . ALA A 1 52 ? -1.948 -14.876 31.804 1.00 12.99 ? 52 ALA A O 1 ATOM 246 C CB . ALA A 1 52 ? -3.160 -16.833 29.422 1.00 18.99 ? 52 ALA A CB 1 ATOM 247 N N . GLY A 1 53 ? -1.065 -16.933 31.659 1.00 12.44 ? 53 GLY A N 1 ATOM 248 C CA . GLY A 1 53 ? 0.236 -16.403 31.922 1.00 15.29 ? 53 GLY A CA 1 ATOM 249 C C . GLY A 1 53 ? 1.319 -17.429 31.773 1.00 11.42 ? 53 GLY A C 1 ATOM 250 O O . GLY A 1 53 ? 1.040 -18.611 31.617 1.00 13.32 ? 53 GLY A O 1 ATOM 251 N N . HIS A 1 54 ? 2.531 -16.893 31.844 1.00 10.30 ? 54 HIS A N 1 ATOM 252 C CA . HIS A 1 54 ? 3.730 -17.704 31.688 1.00 10.86 ? 54 HIS A CA 1 ATOM 253 C C . HIS A 1 54 ? 4.867 -16.974 32.448 1.00 9.44 ? 54 HIS A C 1 ATOM 254 O O . HIS A 1 54 ? 5.010 -15.762 32.239 1.00 10.31 ? 54 HIS A O 1 ATOM 255 C CB . HIS A 1 54 ? 4.112 -17.864 30.240 1.00 12.06 ? 54 HIS A CB 1 ATOM 256 C CG . HIS A 1 54 ? 5.228 -18.824 29.977 1.00 11.74 ? 54 HIS A CG 1 ATOM 257 N ND1 . HIS A 1 54 ? 5.088 -20.182 30.041 1.00 14.97 ? 54 HIS A ND1 1 ATOM 258 C CD2 . HIS A 1 54 ? 6.502 -18.558 29.666 1.00 13.13 ? 54 HIS A CD2 1 ATOM 259 C CE1 . HIS A 1 54 ? 6.274 -20.720 29.751 1.00 15.66 ? 54 HIS A CE1 1 ATOM 260 N NE2 . HIS A 1 54 ? 7.154 -19.774 29.529 1.00 17.95 ? 54 HIS A NE2 1 ATOM 261 N N . ARG A 1 55 ? 5.556 -17.653 33.327 1.00 10.29 ? 55 ARG A N 1 ATOM 262 C CA . ARG A 1 55 ? 6.524 -17.004 34.205 1.00 10.46 ? 55 ARG A CA 1 ATOM 263 C C . ARG A 1 55 ? 5.911 -15.759 34.829 1.00 9.59 ? 55 ARG A C 1 ATOM 264 O O . ARG A 1 55 ? 6.550 -14.718 34.970 1.00 10.06 ? 55 ARG A O 1 ATOM 265 C CB . ARG A 1 55 ? 7.823 -16.640 33.525 1.00 10.87 ? 55 ARG A CB 1 ATOM 266 C CG . ARG A 1 55 ? 8.535 -17.833 32.902 1.00 12.96 ? 55 ARG A CG 1 ATOM 267 C CD . ARG A 1 55 ? 9.755 -17.264 32.181 1.00 14.11 ? 55 ARG A CD 1 ATOM 268 N NE . ARG A 1 55 ? 10.562 -18.295 31.583 1.00 16.49 ? 55 ARG A NE 1 ATOM 269 C CZ . ARG A 1 55 ? 11.669 -18.796 32.088 1.00 16.13 ? 55 ARG A CZ 1 ATOM 270 N NH1 . ARG A 1 55 ? 12.214 -18.388 33.210 1.00 26.06 ? 55 ARG A NH1 1 ATOM 271 N NH2 . ARG A 1 55 ? 12.285 -19.745 31.424 1.00 18.75 ? 55 ARG A NH2 1 ATOM 272 N N . MET A 1 56 ? 4.643 -15.861 35.238 1.00 9.94 ? 56 MET A N 1 ATOM 273 C CA . MET A 1 56 ? 3.899 -14.613 35.463 1.00 10.53 ? 56 MET A CA 1 ATOM 274 C C . MET A 1 56 ? 4.334 -13.895 36.724 1.00 9.93 ? 56 MET A C 1 ATOM 275 O O . MET A 1 56 ? 4.041 -12.700 36.844 1.00 11.19 ? 56 MET A O 1 ATOM 276 C CB . MET A 1 56 ? 2.393 -14.906 35.482 1.00 12.37 ? 56 MET A CB 1 ATOM 277 C CG . MET A 1 56 ? 1.895 -15.598 36.711 1.00 14.23 ? 56 MET A CG 1 ATOM 278 S SD . MET A 1 56 ? 0.171 -16.074 36.570 1.00 22.13 ? 56 MET A SD 1 ATOM 279 C CE . MET A 1 56 ? 0.336 -17.348 35.369 1.00 22.91 ? 56 MET A CE 1 ATOM 280 N N . ALA A 1 57 ? 4.990 -14.584 37.648 1.00 10.25 ? 57 ALA A N 1 ATOM 281 C CA . ALA A 1 57 ? 5.423 -14.012 38.923 1.00 10.85 ? 57 ALA A CA 1 ATOM 282 C C . ALA A 1 57 ? 6.951 -13.927 38.991 1.00 10.88 ? 57 ALA A C 1 ATOM 283 O O . ALA A 1 57 ? 7.514 -13.682 40.049 1.00 11.24 ? 57 ALA A O 1 ATOM 284 C CB . ALA A 1 57 ? 4.745 -14.751 40.053 1.00 12.38 ? 57 ALA A CB 1 ATOM 285 N N . GLN A 1 58 ? 7.638 -14.069 37.872 1.00 10.04 ? 58 GLN A N 1 ATOM 286 C CA . GLN A 1 58 ? 9.085 -13.840 37.801 1.00 10.28 ? 58 GLN A CA 1 ATOM 287 C C . GLN A 1 58 ? 9.353 -12.369 37.630 1.00 10.37 ? 58 GLN A C 1 ATOM 288 O O . GLN A 1 58 ? 8.650 -11.678 36.897 1.00 10.18 ? 58 GLN A O 1 ATOM 289 C CB . GLN A 1 58 ? 9.675 -14.643 36.667 1.00 10.74 ? 58 GLN A CB 1 ATOM 290 C CG . GLN A 1 58 ? 11.158 -14.451 36.460 1.00 12.78 ? 58 GLN A CG 1 ATOM 291 C CD . GLN A 1 58 ? 11.782 -15.330 35.412 1.00 12.93 ? 58 GLN A CD 1 ATOM 292 O OE1 . GLN A 1 58 ? 11.282 -16.394 35.071 1.00 15.55 ? 58 GLN A OE1 1 ATOM 293 N NE2 . GLN A 1 58 ? 12.929 -14.891 34.906 1.00 16.91 ? 58 GLN A NE2 1 ATOM 294 N N . ARG A 1 59 ? 10.363 -11.848 38.322 1.00 9.18 ? 59 ARG A N 1 ATOM 295 C CA . ARG A 1 59 ? 10.713 -10.454 38.185 1.00 9.56 ? 59 ARG A CA 1 ATOM 296 C C . ARG A 1 59 ? 11.490 -10.203 36.895 1.00 9.32 ? 59 ARG A C 1 ATOM 297 O O . ARG A 1 59 ? 12.386 -10.980 36.567 1.00 11.11 ? 59 ARG A O 1 ATOM 298 C CB . ARG A 1 59 ? 11.464 -9.947 39.422 1.00 10.78 ? 59 ARG A CB 1 ATOM 299 C CG A ARG A 1 59 ? 10.437 -9.574 40.498 0.42 14.12 ? 59 ARG A CG 1 ATOM 300 C CG B ARG A 1 59 ? 10.771 -9.517 40.683 0.58 11.91 ? 59 ARG A CG 1 ATOM 301 C CD A ARG A 1 59 ? 10.860 -9.958 41.883 0.42 19.46 ? 59 ARG A CD 1 ATOM 302 C CD B ARG A 1 59 ? 10.010 -10.658 41.309 0.58 10.48 ? 59 ARG A CD 1 ATOM 303 N NE A ARG A 1 59 ? 9.804 -10.042 42.869 0.42 17.84 ? 59 ARG A NE 1 ATOM 304 N NE B ARG A 1 59 ? 10.938 -11.652 41.857 0.58 9.72 ? 59 ARG A NE 1 ATOM 305 C CZ A ARG A 1 59 ? 9.263 -9.183 43.715 0.42 21.01 ? 59 ARG A CZ 1 ATOM 306 C CZ B ARG A 1 59 ? 11.507 -11.525 43.059 0.58 9.18 ? 59 ARG A CZ 1 ATOM 307 N NH1 A ARG A 1 59 ? 9.796 -7.949 43.650 0.42 10.45 ? 59 ARG A NH1 1 ATOM 308 N NH1 B ARG A 1 59 ? 11.295 -10.496 43.843 0.58 10.15 ? 59 ARG A NH1 1 ATOM 309 N NH2 A ARG A 1 59 ? 8.270 -9.491 44.574 0.42 12.06 ? 59 ARG A NH2 1 ATOM 310 N NH2 B ARG A 1 59 ? 12.330 -12.507 43.449 0.58 9.29 ? 59 ARG A NH2 1 ATOM 311 N N . PHE A 1 60 ? 11.176 -9.114 36.232 1.00 8.67 ? 60 PHE A N 1 ATOM 312 C CA . PHE A 1 60 ? 11.855 -8.628 35.063 1.00 9.70 ? 60 PHE A CA 1 ATOM 313 C C . PHE A 1 60 ? 12.057 -7.118 35.255 1.00 9.65 ? 60 PHE A C 1 ATOM 314 O O . PHE A 1 60 ? 11.218 -6.448 35.847 1.00 10.59 ? 60 PHE A O 1 ATOM 315 C CB . PHE A 1 60 ? 11.105 -8.861 33.757 1.00 9.62 ? 60 PHE A CB 1 ATOM 316 C CG . PHE A 1 60 ? 10.905 -10.303 33.352 1.00 9.80 ? 60 PHE A CG 1 ATOM 317 C CD1 . PHE A 1 60 ? 9.915 -11.105 33.916 1.00 9.65 ? 60 PHE A CD1 1 ATOM 318 C CD2 . PHE A 1 60 ? 11.719 -10.843 32.383 1.00 10.77 ? 60 PHE A CD2 1 ATOM 319 C CE1 . PHE A 1 60 ? 9.718 -12.395 33.533 1.00 10.94 ? 60 PHE A CE1 1 ATOM 320 C CE2 . PHE A 1 60 ? 11.466 -12.148 31.981 1.00 11.87 ? 60 PHE A CE2 1 ATOM 321 C CZ . PHE A 1 60 ? 10.490 -12.938 32.516 1.00 12.33 ? 60 PHE A CZ 1 ATOM 322 N N . ALA A 1 61 ? 13.152 -6.628 34.662 1.00 9.84 ? 61 ALA A N 1 ATOM 323 C CA . ALA A 1 61 ? 13.337 -5.173 34.613 1.00 9.69 ? 61 ALA A CA 1 ATOM 324 C C . ALA A 1 61 ? 12.157 -4.508 33.887 1.00 9.76 ? 61 ALA A C 1 ATOM 325 O O . ALA A 1 61 ? 11.746 -4.952 32.788 1.00 11.49 ? 61 ALA A O 1 ATOM 326 C CB . ALA A 1 61 ? 14.663 -4.849 33.915 1.00 12.02 ? 61 ALA A CB 1 ATOM 327 N N . MET A 1 62 ? 11.596 -3.463 34.451 1.00 11.11 ? 62 MET A N 1 ATOM 328 C CA . MET A 1 62 ? 10.492 -2.746 33.832 1.00 12.46 ? 62 MET A CA 1 ATOM 329 C C . MET A 1 62 ? 10.898 -1.982 32.567 1.00 12.81 ? 62 MET A C 1 ATOM 330 O O . MET A 1 62 ? 10.132 -1.868 31.625 1.00 14.25 ? 62 MET A O 1 ATOM 331 C CB . MET A 1 62 ? 9.948 -1.639 34.732 1.00 15.49 ? 62 MET A CB 1 ATOM 332 C CG . MET A 1 62 ? 9.086 -2.204 35.826 1.00 16.02 ? 62 MET A CG 1 ATOM 333 S SD . MET A 1 62 ? 8.085 -0.998 36.734 1.00 13.99 ? 62 MET A SD 1 ATOM 334 C CE . MET A 1 62 ? 9.370 -0.095 37.560 1.00 20.76 ? 62 MET A CE 1 ATOM 335 N N A CYS A 1 63 ? 12.140 -1.471 32.597 0.48 14.46 ? 63 CYS A N 1 ATOM 336 N N B CYS A 1 63 ? 12.073 -1.356 32.697 0.52 14.15 ? 63 CYS A N 1 ATOM 337 C CA A CYS A 1 63 ? 12.624 -0.653 31.480 0.48 13.34 ? 63 CYS A CA 1 ATOM 338 C CA B CYS A 1 63 ? 12.590 -0.261 31.884 0.52 13.51 ? 63 CYS A CA 1 ATOM 339 C C A CYS A 1 63 ? 11.599 0.487 31.315 0.48 13.32 ? 63 CYS A C 1 ATOM 340 C C B CYS A 1 63 ? 11.424 0.604 31.402 0.52 10.40 ? 63 CYS A C 1 ATOM 341 O O A CYS A 1 63 ? 11.080 0.912 32.360 0.48 14.10 ? 63 CYS A O 1 ATOM 342 O O B CYS A 1 63 ? 10.608 0.954 32.267 0.52 10.30 ? 63 CYS A O 1 ATOM 343 C CB A CYS A 1 63 ? 12.910 -1.462 30.236 0.48 15.62 ? 63 CYS A CB 1 ATOM 344 C CB B CYS A 1 63 ? 13.515 -0.787 30.805 0.52 17.07 ? 63 CYS A CB 1 ATOM 345 S SG A CYS A 1 63 ? 13.710 -3.090 30.426 0.48 18.45 ? 63 CYS A SG 1 ATOM 346 S SG B CYS A 1 63 ? 12.735 -1.709 29.497 0.52 20.23 ? 63 CYS A SG 1 ATOM 347 N N . SER A 1 64 ? 11.277 0.960 30.147 1.00 11.59 ? 64 SER A N 1 ATOM 348 C CA . SER A 1 64 ? 10.412 2.068 29.854 1.00 10.80 ? 64 SER A CA 1 ATOM 349 C C . SER A 1 64 ? 8.940 1.772 30.068 1.00 10.15 ? 64 SER A C 1 ATOM 350 O O . SER A 1 64 ? 8.151 2.702 29.979 1.00 10.60 ? 64 SER A O 1 ATOM 351 C CB . SER A 1 64 ? 10.627 2.575 28.432 1.00 12.08 ? 64 SER A CB 1 ATOM 352 O OG . SER A 1 64 ? 11.959 3.048 28.322 1.00 14.44 ? 64 SER A OG 1 ATOM 353 N N . THR A 1 65 ? 8.602 0.520 30.334 1.00 9.75 ? 65 THR A N 1 ATOM 354 C CA . THR A 1 65 ? 7.168 0.283 30.564 1.00 9.18 ? 65 THR A CA 1 ATOM 355 C C . THR A 1 65 ? 6.639 1.068 31.741 1.00 9.58 ? 65 THR A C 1 ATOM 356 O O . THR A 1 65 ? 5.422 1.341 31.770 1.00 10.23 ? 65 THR A O 1 ATOM 357 C CB . THR A 1 65 ? 6.855 -1.222 30.714 1.00 9.13 ? 65 THR A CB 1 ATOM 358 O OG1 . THR A 1 65 ? 7.479 -1.710 31.899 1.00 10.70 ? 65 THR A OG1 1 ATOM 359 C CG2 . THR A 1 65 ? 7.313 -2.033 29.526 1.00 9.68 ? 65 THR A CG2 1 ATOM 360 N N . PHE A 1 66 ? 7.460 1.463 32.686 1.00 10.24 ? 66 PHE A N 1 ATOM 361 C CA . PHE A 1 66 ? 7.002 2.204 33.841 1.00 11.12 ? 66 PHE A CA 1 ATOM 362 C C . PHE A 1 66 ? 6.481 3.586 33.451 1.00 10.83 ? 66 PHE A C 1 ATOM 363 O O . PHE A 1 66 ? 5.763 4.193 34.242 1.00 11.06 ? 66 PHE A O 1 ATOM 364 C CB . PHE A 1 66 ? 8.062 2.357 34.929 1.00 11.82 ? 66 PHE A CB 1 ATOM 365 C CG . PHE A 1 66 ? 8.895 3.591 34.869 1.00 13.27 ? 66 PHE A CG 1 ATOM 366 C CD1 . PHE A 1 66 ? 10.007 3.700 34.050 1.00 13.70 ? 66 PHE A CD1 1 ATOM 367 C CD2 . PHE A 1 66 ? 8.577 4.709 35.663 1.00 16.86 ? 66 PHE A CD2 1 ATOM 368 C CE1 . PHE A 1 66 ? 10.802 4.831 33.987 1.00 20.36 ? 66 PHE A CE1 1 ATOM 369 C CE2 . PHE A 1 66 ? 9.345 5.824 35.566 1.00 22.23 ? 66 PHE A CE2 1 ATOM 370 C CZ . PHE A 1 66 ? 10.433 5.903 34.756 1.00 22.55 ? 66 PHE A CZ 1 ATOM 371 N N . LYS A 1 67 ? 6.862 4.075 32.275 1.00 9.30 ? 67 LYS A N 1 ATOM 372 C CA . LYS A 1 67 ? 6.365 5.400 31.885 1.00 9.41 ? 67 LYS A CA 1 ATOM 373 C C . LYS A 1 67 ? 4.856 5.485 31.747 1.00 10.39 ? 67 LYS A C 1 ATOM 374 O O . LYS A 1 67 ? 4.266 6.568 31.870 1.00 9.84 ? 67 LYS A O 1 ATOM 375 C CB . LYS A 1 67 ? 7.095 5.814 30.602 1.00 9.74 ? 67 LYS A CB 1 ATOM 376 C CG . LYS A 1 67 ? 8.586 6.011 30.771 1.00 9.64 ? 67 LYS A CG 1 ATOM 377 C CD . LYS A 1 67 ? 9.419 6.058 29.507 1.00 10.49 ? 67 LYS A CD 1 ATOM 378 C CE . LYS A 1 67 ? 10.890 6.123 29.858 1.00 11.59 ? 67 LYS A CE 1 ATOM 379 N NZ . LYS A 1 67 ? 11.746 6.076 28.677 1.00 11.85 ? 67 LYS A NZ 1 ATOM 380 N N . PHE A 1 68 ? 4.193 4.342 31.474 1.00 10.10 ? 68 PHE A N 1 ATOM 381 C CA . PHE A 1 68 ? 2.731 4.329 31.492 1.00 9.63 ? 68 PHE A CA 1 ATOM 382 C C . PHE A 1 68 ? 2.224 4.550 32.930 1.00 9.03 ? 68 PHE A C 1 ATOM 383 O O . PHE A 1 68 ? 1.471 5.522 33.132 1.00 10.06 ? 68 PHE A O 1 ATOM 384 C CB . PHE A 1 68 ? 2.254 3.088 30.777 1.00 9.55 ? 68 PHE A CB 1 ATOM 385 C CG . PHE A 1 68 ? 0.802 2.701 30.891 1.00 11.15 ? 68 PHE A CG 1 ATOM 386 C CD1 . PHE A 1 68 ? 0.532 1.361 30.590 1.00 17.43 ? 68 PHE A CD1 1 ATOM 387 C CD2 . PHE A 1 68 ? -0.246 3.523 31.103 1.00 17.26 ? 68 PHE A CD2 1 ATOM 388 C CE1 . PHE A 1 68 ? -0.767 0.906 30.584 1.00 17.77 ? 68 PHE A CE1 1 ATOM 389 C CE2 . PHE A 1 68 ? -1.552 3.092 31.254 1.00 20.64 ? 68 PHE A CE2 1 ATOM 390 C CZ . PHE A 1 68 ? -1.772 1.762 30.987 1.00 21.61 ? 68 PHE A CZ 1 ATOM 391 N N . PRO A 1 69 ? 2.548 3.751 33.929 1.00 10.51 ? 69 PRO A N 1 ATOM 392 C CA . PRO A 1 69 ? 2.122 4.081 35.278 1.00 11.46 ? 69 PRO A CA 1 ATOM 393 C C . PRO A 1 69 ? 2.577 5.452 35.766 1.00 10.90 ? 69 PRO A C 1 ATOM 394 O O . PRO A 1 69 ? 1.826 6.058 36.544 1.00 12.59 ? 69 PRO A O 1 ATOM 395 C CB . PRO A 1 69 ? 2.764 2.981 36.113 1.00 16.08 ? 69 PRO A CB 1 ATOM 396 C CG . PRO A 1 69 ? 3.006 1.835 35.215 1.00 16.70 ? 69 PRO A CG 1 ATOM 397 C CD . PRO A 1 69 ? 3.148 2.394 33.852 1.00 11.81 ? 69 PRO A CD 1 ATOM 398 N N . LEU A 1 70 ? 3.714 5.946 35.311 1.00 10.53 ? 70 LEU A N 1 ATOM 399 C CA . LEU A 1 70 ? 4.085 7.331 35.650 1.00 11.13 ? 70 LEU A CA 1 ATOM 400 C C . LEU A 1 70 ? 3.052 8.323 35.138 1.00 10.17 ? 70 LEU A C 1 ATOM 401 O O . LEU A 1 70 ? 2.659 9.250 35.856 1.00 11.22 ? 70 LEU A O 1 ATOM 402 C CB . LEU A 1 70 ? 5.469 7.633 35.100 1.00 10.97 ? 70 LEU A CB 1 ATOM 403 C CG . LEU A 1 70 ? 5.973 9.069 35.291 1.00 11.92 ? 70 LEU A CG 1 ATOM 404 C CD1 . LEU A 1 70 ? 6.120 9.454 36.749 1.00 13.61 ? 70 LEU A CD1 1 ATOM 405 C CD2 . LEU A 1 70 ? 7.312 9.232 34.562 1.00 13.36 ? 70 LEU A CD2 1 ATOM 406 N N . ALA A 1 71 ? 2.635 8.167 33.867 1.00 10.23 ? 71 ALA A N 1 ATOM 407 C CA . ALA A 1 71 ? 1.587 9.016 33.348 1.00 10.26 ? 71 ALA A CA 1 ATOM 408 C C . ALA A 1 71 ? 0.279 8.894 34.124 1.00 10.00 ? 71 ALA A C 1 ATOM 409 O O . ALA A 1 71 ? -0.413 9.861 34.343 1.00 10.32 ? 71 ALA A O 1 ATOM 410 C CB . ALA A 1 71 ? 1.433 8.790 31.860 1.00 10.92 ? 71 ALA A CB 1 ATOM 411 N N . ALA A 1 72 ? -0.020 7.651 34.554 1.00 10.33 ? 72 ALA A N 1 ATOM 412 C CA . ALA A 1 72 ? -1.201 7.468 35.388 1.00 10.53 ? 72 ALA A CA 1 ATOM 413 C C . ALA A 1 72 ? -1.094 8.250 36.717 1.00 10.68 ? 72 ALA A C 1 ATOM 414 O O . ALA A 1 72 ? -2.086 8.887 37.129 1.00 12.65 ? 72 ALA A O 1 ATOM 415 C CB . ALA A 1 72 ? -1.483 6.008 35.653 1.00 11.00 ? 72 ALA A CB 1 ATOM 416 N N . LEU A 1 73 ? 0.054 8.211 37.352 1.00 11.14 ? 73 LEU A N 1 ATOM 417 C CA . LEU A 1 73 ? 0.330 8.972 38.560 1.00 12.21 ? 73 LEU A CA 1 ATOM 418 C C . LEU A 1 73 ? 0.051 10.465 38.308 1.00 11.56 ? 73 LEU A C 1 ATOM 419 O O . LEU A 1 73 ? -0.592 11.173 39.095 1.00 12.70 ? 73 LEU A O 1 ATOM 420 C CB . LEU A 1 73 ? 1.722 8.669 39.079 1.00 13.18 ? 73 LEU A CB 1 ATOM 421 C CG A LEU A 1 73 ? 2.339 9.266 40.319 0.41 13.21 ? 73 LEU A CG 1 ATOM 422 C CG B LEU A 1 73 ? 2.170 9.593 40.223 0.59 15.43 ? 73 LEU A CG 1 ATOM 423 C CD1 A LEU A 1 73 ? 3.627 8.527 40.671 0.41 11.10 ? 73 LEU A CD1 1 ATOM 424 C CD1 B LEU A 1 73 ? 1.243 9.633 41.436 0.59 15.96 ? 73 LEU A CD1 1 ATOM 425 C CD2 A LEU A 1 73 ? 2.714 10.741 40.193 0.41 13.88 ? 73 LEU A CD2 1 ATOM 426 C CD2 B LEU A 1 73 ? 3.574 9.197 40.653 0.59 15.72 ? 73 LEU A CD2 1 ATOM 427 N N . VAL A 1 74 ? 0.593 10.942 37.168 1.00 11.17 ? 74 VAL A N 1 ATOM 428 C CA . VAL A 1 74 ? 0.422 12.361 36.829 1.00 11.42 ? 74 VAL A CA 1 ATOM 429 C C . VAL A 1 74 ? -1.057 12.669 36.662 1.00 10.48 ? 74 VAL A C 1 ATOM 430 O O . VAL A 1 74 ? -1.524 13.677 37.172 1.00 12.32 ? 74 VAL A O 1 ATOM 431 C CB . VAL A 1 74 ? 1.265 12.676 35.587 1.00 11.46 ? 74 VAL A CB 1 ATOM 432 C CG1 . VAL A 1 74 ? 0.924 14.076 35.092 1.00 14.16 ? 74 VAL A CG1 1 ATOM 433 C CG2 . VAL A 1 74 ? 2.757 12.553 35.808 1.00 14.48 ? 74 VAL A CG2 1 ATOM 434 N N . PHE A 1 75 ? -1.785 11.796 35.930 1.00 10.79 ? 75 PHE A N 1 ATOM 435 C CA . PHE A 1 75 ? -3.223 12.049 35.805 1.00 10.65 ? 75 PHE A CA 1 ATOM 436 C C . PHE A 1 75 ? -3.998 11.989 37.115 1.00 11.44 ? 75 PHE A C 1 ATOM 437 O O . PHE A 1 75 ? -4.940 12.755 37.312 1.00 13.61 ? 75 PHE A O 1 ATOM 438 C CB . PHE A 1 75 ? -3.914 11.132 34.795 1.00 11.38 ? 75 PHE A CB 1 ATOM 439 C CG . PHE A 1 75 ? -3.685 11.529 33.352 1.00 11.61 ? 75 PHE A CG 1 ATOM 440 C CD1 . PHE A 1 75 ? -2.885 10.762 32.544 1.00 15.35 ? 75 PHE A CD1 1 ATOM 441 C CD2 . PHE A 1 75 ? -4.309 12.649 32.864 1.00 13.67 ? 75 PHE A CD2 1 ATOM 442 C CE1 . PHE A 1 75 ? -2.710 11.143 31.220 1.00 17.40 ? 75 PHE A CE1 1 ATOM 443 C CE2 . PHE A 1 75 ? -4.098 13.056 31.553 1.00 14.72 ? 75 PHE A CE2 1 ATOM 444 C CZ . PHE A 1 75 ? -3.300 12.284 30.766 1.00 17.36 ? 75 PHE A CZ 1 ATOM 445 N N . GLU A 1 76 ? -3.578 11.119 38.038 1.00 12.75 ? 76 GLU A N 1 ATOM 446 C CA . GLU A 1 76 ? -4.195 11.109 39.351 1.00 12.89 ? 76 GLU A CA 1 ATOM 447 C C . GLU A 1 76 ? -3.994 12.452 40.065 1.00 12.71 ? 76 GLU A C 1 ATOM 448 O O . GLU A 1 76 ? -4.949 12.963 40.714 1.00 15.28 ? 76 GLU A O 1 ATOM 449 C CB . GLU A 1 76 ? -3.702 9.921 40.176 1.00 16.84 ? 76 GLU A CB 1 ATOM 450 C CG . GLU A 1 76 ? -4.595 9.769 41.415 1.00 24.81 ? 76 GLU A CG 1 ATOM 451 C CD . GLU A 1 76 ? -3.779 9.432 42.640 1.00 33.56 ? 76 GLU A CD 1 ATOM 452 O OE1 . GLU A 1 76 ? -4.176 8.544 43.416 1.00 47.32 ? 76 GLU A OE1 1 ATOM 453 O OE2 . GLU A 1 76 ? -2.727 10.106 42.748 1.00 53.03 ? 76 GLU A OE2 1 ATOM 454 N N . ARG A 1 77 ? -2.813 13.022 39.928 1.00 11.95 ? 77 ARG A N 1 ATOM 455 C CA . ARG A 1 77 ? -2.564 14.323 40.543 1.00 13.29 ? 77 ARG A CA 1 ATOM 456 C C . ARG A 1 77 ? -3.366 15.394 39.865 1.00 13.20 ? 77 ARG A C 1 ATOM 457 O O . ARG A 1 77 ? -3.960 16.286 40.485 1.00 15.70 ? 77 ARG A O 1 ATOM 458 C CB . ARG A 1 77 ? -1.065 14.587 40.551 1.00 14.26 ? 77 ARG A CB 1 ATOM 459 C CG . ARG A 1 77 ? -0.265 13.616 41.439 1.00 18.85 ? 77 ARG A CG 1 ATOM 460 C CD . ARG A 1 77 ? 1.227 13.861 41.115 1.00 29.99 ? 77 ARG A CD 1 ATOM 461 N NE . ARG A 1 77 ? 1.539 15.198 41.617 1.00 38.17 ? 77 ARG A NE 1 ATOM 462 C CZ . ARG A 1 77 ? 1.891 15.494 42.866 1.00 46.93 ? 77 ARG A CZ 1 ATOM 463 N NH1 . ARG A 1 77 ? 1.983 14.534 43.779 1.00 57.96 ? 77 ARG A NH1 1 ATOM 464 N NH2 . ARG A 1 77 ? 2.162 16.745 43.253 1.00 44.03 ? 77 ARG A NH2 1 ATOM 465 N N . ILE A 1 78 ? -3.453 15.329 38.546 1.00 13.04 ? 78 ILE A N 1 ATOM 466 C CA . ILE A 1 78 ? -4.320 16.257 37.816 1.00 13.12 ? 78 ILE A CA 1 ATOM 467 C C . ILE A 1 78 ? -5.777 16.134 38.245 1.00 13.27 ? 78 ILE A C 1 ATOM 468 O O . ILE A 1 78 ? -6.415 17.140 38.523 1.00 15.14 ? 78 ILE A O 1 ATOM 469 C CB . ILE A 1 78 ? -4.155 16.064 36.304 1.00 14.15 ? 78 ILE A CB 1 ATOM 470 C CG1 . ILE A 1 78 ? -2.782 16.568 35.819 1.00 14.08 ? 78 ILE A CG1 1 ATOM 471 C CG2 . ILE A 1 78 ? -5.280 16.660 35.495 1.00 16.39 ? 78 ILE A CG2 1 ATOM 472 C CD1 . ILE A 1 78 ? -2.385 16.219 34.411 1.00 14.80 ? 78 ILE A CD1 1 ATOM 473 N N . ASP A 1 79 ? -6.275 14.896 38.335 1.00 14.84 ? 79 ASP A N 1 ATOM 474 C CA . ASP A 1 79 ? -7.657 14.654 38.789 1.00 15.15 ? 79 ASP A CA 1 ATOM 475 C C . ASP A 1 79 ? -7.908 15.248 40.159 1.00 15.46 ? 79 ASP A C 1 ATOM 476 O O . ASP A 1 79 ? -8.977 15.764 40.462 1.00 17.74 ? 79 ASP A O 1 ATOM 477 C CB . ASP A 1 79 ? -7.920 13.134 38.803 1.00 14.04 ? 79 ASP A CB 1 ATOM 478 C CG . ASP A 1 79 ? -8.060 12.463 37.450 1.00 15.02 ? 79 ASP A CG 1 ATOM 479 O OD1 . ASP A 1 79 ? -8.255 13.160 36.439 1.00 16.55 ? 79 ASP A OD1 1 ATOM 480 O OD2 . ASP A 1 79 ? -7.981 11.200 37.368 1.00 13.77 ? 79 ASP A OD2 1 ATOM 481 N N . SER A 1 80 ? -6.929 15.043 41.052 1.00 17.88 ? 80 SER A N 1 ATOM 482 C CA . SER A 1 80 ? -7.095 15.487 42.414 1.00 18.55 ? 80 SER A CA 1 ATOM 483 C C . SER A 1 80 ? -6.865 16.973 42.629 1.00 20.46 ? 80 SER A C 1 ATOM 484 O O . SER A 1 80 ? -7.153 17.527 43.663 1.00 23.06 ? 80 SER A O 1 ATOM 485 C CB . SER A 1 80 ? -6.104 14.748 43.347 1.00 27.59 ? 80 SER A CB 1 ATOM 486 O OG . SER A 1 80 ? -6.323 13.357 43.135 1.00 36.58 ? 80 SER A OG 1 ATOM 487 N N . GLY A 1 81 ? -6.331 17.681 41.629 1.00 19.66 ? 81 GLY A N 1 ATOM 488 C CA . GLY A 1 81 ? -5.979 19.075 41.830 1.00 23.59 ? 81 GLY A CA 1 ATOM 489 C C . GLY A 1 81 ? -4.577 19.328 42.342 1.00 22.26 ? 81 GLY A C 1 ATOM 490 O O . GLY A 1 81 ? -4.259 20.489 42.538 1.00 31.12 ? 81 GLY A O 1 ATOM 491 N N . THR A 1 82 ? -3.709 18.332 42.531 1.00 20.78 ? 82 THR A N 1 ATOM 492 C CA . THR A 1 82 ? -2.379 18.591 43.084 1.00 21.35 ? 82 THR A CA 1 ATOM 493 C C . THR A 1 82 ? -1.335 18.772 41.981 1.00 21.24 ? 82 THR A C 1 ATOM 494 O O . THR A 1 82 ? -0.170 19.041 42.268 1.00 22.67 ? 82 THR A O 1 ATOM 495 C CB . THR A 1 82 ? -1.922 17.484 44.054 1.00 23.42 ? 82 THR A CB 1 ATOM 496 O OG1 . THR A 1 82 ? -1.987 16.233 43.361 1.00 22.85 ? 82 THR A OG1 1 ATOM 497 C CG2 . THR A 1 82 ? -2.827 17.366 45.274 1.00 25.07 ? 82 THR A CG2 1 ATOM 498 N N . GLU A 1 83 ? -1.773 18.641 40.726 1.00 21.07 ? 83 GLU A N 1 ATOM 499 C CA . GLU A 1 83 ? -0.932 19.040 39.609 1.00 17.59 ? 83 GLU A CA 1 ATOM 500 C C . GLU A 1 83 ? -1.835 19.688 38.554 1.00 15.83 ? 83 GLU A C 1 ATOM 501 O O . GLU A 1 83 ? -3.022 19.378 38.540 1.00 17.44 ? 83 GLU A O 1 ATOM 502 C CB . GLU A 1 83 ? -0.173 17.855 39.051 1.00 18.17 ? 83 GLU A CB 1 ATOM 503 C CG . GLU A 1 83 ? 0.836 18.149 37.958 1.00 16.70 ? 83 GLU A CG 1 ATOM 504 C CD . GLU A 1 83 ? 1.820 19.239 38.356 1.00 19.71 ? 83 GLU A CD 1 ATOM 505 O OE1 . GLU A 1 83 ? 1.520 20.444 38.117 1.00 17.62 ? 83 GLU A OE1 1 ATOM 506 O OE2 . GLU A 1 83 ? 2.874 18.886 38.941 1.00 22.62 ? 83 GLU A OE2 1 ATOM 507 N N . ARG A 1 84 ? -1.300 20.519 37.706 1.00 16.80 ? 84 ARG A N 1 ATOM 508 C CA . ARG A 1 84 ? -2.013 21.105 36.580 1.00 15.90 ? 84 ARG A CA 1 ATOM 509 C C . ARG A 1 84 ? -1.357 20.705 35.272 1.00 12.13 ? 84 ARG A C 1 ATOM 510 O O . ARG A 1 84 ? -0.126 20.779 35.124 1.00 14.18 ? 84 ARG A O 1 ATOM 511 C CB . ARG A 1 84 ? -1.991 22.606 36.719 1.00 19.62 ? 84 ARG A CB 1 ATOM 512 C CG . ARG A 1 84 ? -2.977 23.443 35.997 1.00 28.46 ? 84 ARG A CG 1 ATOM 513 C CD . ARG A 1 84 ? -3.109 24.871 36.548 1.00 30.56 ? 84 ARG A CD 1 ATOM 514 N NE A ARG A 1 84 ? -1.815 25.552 36.478 0.65 28.81 ? 84 ARG A NE 1 ATOM 515 N NE B ARG A 1 84 ? -1.930 25.692 36.407 0.35 29.81 ? 84 ARG A NE 1 ATOM 516 C CZ A ARG A 1 84 ? -1.065 25.870 35.445 0.65 32.38 ? 84 ARG A CZ 1 ATOM 517 C CZ B ARG A 1 84 ? -1.074 26.112 37.319 0.35 30.47 ? 84 ARG A CZ 1 ATOM 518 N NH1 A ARG A 1 84 ? -1.393 25.601 34.193 0.65 39.64 ? 84 ARG A NH1 1 ATOM 519 N NH1 B ARG A 1 84 ? -1.161 25.822 38.608 0.35 32.53 ? 84 ARG A NH1 1 ATOM 520 N NH2 A ARG A 1 84 ? 0.104 26.501 35.574 0.65 32.31 ? 84 ARG A NH2 1 ATOM 521 N NH2 B ARG A 1 84 ? -0.058 26.871 36.921 0.35 32.46 ? 84 ARG A NH2 1 ATOM 522 N N . GLY A 1 85 ? -2.147 20.204 34.328 1.00 13.98 ? 85 GLY A N 1 ATOM 523 C CA . GLY A 1 85 ? -1.556 19.667 33.106 1.00 13.25 ? 85 GLY A CA 1 ATOM 524 C C . GLY A 1 85 ? -0.813 20.661 32.236 1.00 11.80 ? 85 GLY A C 1 ATOM 525 O O . GLY A 1 85 ? 0.129 20.263 31.575 1.00 12.06 ? 85 GLY A O 1 ATOM 526 N N . ASP A 1 86 ? -1.225 21.938 32.254 1.00 12.76 ? 86 ASP A N 1 ATOM 527 C CA . ASP A 1 86 ? -0.603 22.948 31.425 1.00 12.88 ? 86 ASP A CA 1 ATOM 528 C C . ASP A 1 86 ? 0.541 23.629 32.166 1.00 12.93 ? 86 ASP A C 1 ATOM 529 O O . ASP A 1 86 ? 1.191 24.537 31.677 1.00 14.75 ? 86 ASP A O 1 ATOM 530 C CB A ASP A 1 86 ? -1.581 24.005 30.897 0.43 16.71 ? 86 ASP A CB 1 ATOM 531 C CB B ASP A 1 86 ? -1.678 23.838 30.805 0.57 16.96 ? 86 ASP A CB 1 ATOM 532 C CG A ASP A 1 86 ? -2.798 24.458 31.651 0.43 17.72 ? 86 ASP A CG 1 ATOM 533 C CG B ASP A 1 86 ? -2.492 23.031 29.791 0.57 21.51 ? 86 ASP A CG 1 ATOM 534 O OD1 A ASP A 1 86 ? -2.886 24.130 32.859 0.43 16.83 ? 86 ASP A OD1 1 ATOM 535 O OD1 B ASP A 1 86 ? -2.072 21.973 29.276 0.57 25.57 ? 86 ASP A OD1 1 ATOM 536 O OD2 A ASP A 1 86 ? -3.719 25.183 31.139 0.43 15.76 ? 86 ASP A OD2 1 ATOM 537 O OD2 B ASP A 1 86 ? -3.605 23.510 29.482 0.57 25.74 ? 86 ASP A OD2 1 ATOM 538 N N . ARG A 1 87 ? 0.908 23.223 33.396 1.00 11.67 ? 87 ARG A N 1 ATOM 539 C CA . ARG A 1 87 ? 2.024 23.841 34.119 1.00 11.86 ? 87 ARG A CA 1 ATOM 540 C C . ARG A 1 87 ? 3.347 23.607 33.368 1.00 9.88 ? 87 ARG A C 1 ATOM 541 O O . ARG A 1 87 ? 3.602 22.478 32.972 1.00 10.97 ? 87 ARG A O 1 ATOM 542 C CB . ARG A 1 87 ? 2.147 23.311 35.532 1.00 13.87 ? 87 ARG A CB 1 ATOM 543 C CG . ARG A 1 87 ? 3.185 24.093 36.314 1.00 16.03 ? 87 ARG A CG 1 ATOM 544 C CD . ARG A 1 87 ? 3.052 23.793 37.804 1.00 15.21 ? 87 ARG A CD 1 ATOM 545 N NE . ARG A 1 87 ? 3.532 22.465 38.139 1.00 15.95 ? 87 ARG A NE 1 ATOM 546 C CZ . ARG A 1 87 ? 4.780 22.101 38.379 1.00 14.97 ? 87 ARG A CZ 1 ATOM 547 N NH1 . ARG A 1 87 ? 5.781 22.969 38.349 1.00 19.06 ? 87 ARG A NH1 1 ATOM 548 N NH2 . ARG A 1 87 ? 5.039 20.831 38.671 1.00 19.64 ? 87 ARG A NH2 1 ATOM 549 N N . LYS A 1 88 ? 4.089 24.667 33.203 1.00 10.98 ? 88 LYS A N 1 ATOM 550 C CA . LYS A 1 88 ? 5.344 24.655 32.475 1.00 10.55 ? 88 LYS A CA 1 ATOM 551 C C . LYS A 1 88 ? 6.512 24.181 33.352 1.00 11.18 ? 88 LYS A C 1 ATOM 552 O O . LYS A 1 88 ? 6.772 24.739 34.394 1.00 14.27 ? 88 LYS A O 1 ATOM 553 C CB . LYS A 1 88 ? 5.661 26.025 31.893 1.00 11.21 ? 88 LYS A CB 1 ATOM 554 C CG . LYS A 1 88 ? 4.573 26.497 30.918 1.00 13.05 ? 88 LYS A CG 1 ATOM 555 C CD . LYS A 1 88 ? 4.945 27.841 30.328 1.00 14.35 ? 88 LYS A CD 1 ATOM 556 C CE . LYS A 1 88 ? 4.038 28.384 29.281 1.00 15.73 ? 88 LYS A CE 1 ATOM 557 N NZ . LYS A 1 88 ? 2.668 28.658 29.758 1.00 19.29 ? 88 LYS A NZ 1 ATOM 558 N N . LEU A 1 89 ? 7.182 23.144 32.916 1.00 10.72 ? 89 LEU A N 1 ATOM 559 C CA . LEU A 1 89 ? 8.366 22.577 33.557 1.00 10.63 ? 89 LEU A CA 1 ATOM 560 C C . LEU A 1 89 ? 9.664 22.983 32.853 1.00 10.64 ? 89 LEU A C 1 ATOM 561 O O . LEU A 1 89 ? 9.901 22.541 31.720 1.00 10.65 ? 89 LEU A O 1 ATOM 562 C CB . LEU A 1 89 ? 8.275 21.027 33.610 1.00 10.98 ? 89 LEU A CB 1 ATOM 563 C CG . LEU A 1 89 ? 6.965 20.467 34.118 1.00 11.82 ? 89 LEU A CG 1 ATOM 564 C CD1 . LEU A 1 89 ? 7.057 18.942 34.071 1.00 13.16 ? 89 LEU A CD1 1 ATOM 565 C CD2 . LEU A 1 89 ? 6.686 21.046 35.501 1.00 15.37 ? 89 LEU A CD2 1 ATOM 566 N N . SER A 1 90 ? 10.438 23.842 33.477 1.00 11.57 ? 90 SER A N 1 ATOM 567 C CA . SER A 1 90 ? 11.578 24.457 32.863 1.00 11.87 ? 90 SER A CA 1 ATOM 568 C C . SER A 1 90 ? 12.777 23.530 32.988 1.00 10.76 ? 90 SER A C 1 ATOM 569 O O . SER A 1 90 ? 12.930 22.824 34.004 1.00 12.93 ? 90 SER A O 1 ATOM 570 C CB . SER A 1 90 ? 11.890 25.781 33.528 1.00 13.84 ? 90 SER A CB 1 ATOM 571 O OG . SER A 1 90 ? 10.882 26.743 33.208 1.00 23.31 ? 90 SER A OG 1 ATOM 572 N N . TYR A 1 91 ? 13.674 23.536 32.027 1.00 9.88 ? 91 TYR A N 1 ATOM 573 C CA . TYR A 1 91 ? 14.869 22.760 32.023 1.00 10.19 ? 91 TYR A CA 1 ATOM 574 C C . TYR A 1 91 ? 15.900 23.343 31.076 1.00 9.54 ? 91 TYR A C 1 ATOM 575 O O . TYR A 1 91 ? 15.599 24.161 30.199 1.00 11.13 ? 91 TYR A O 1 ATOM 576 C CB . TYR A 1 91 ? 14.590 21.308 31.654 1.00 10.35 ? 91 TYR A CB 1 ATOM 577 C CG . TYR A 1 91 ? 14.074 21.074 30.261 1.00 9.58 ? 91 TYR A CG 1 ATOM 578 C CD1 . TYR A 1 91 ? 12.698 21.164 30.011 1.00 9.38 ? 91 TYR A CD1 1 ATOM 579 C CD2 . TYR A 1 91 ? 14.920 20.772 29.203 1.00 9.31 ? 91 TYR A CD2 1 ATOM 580 C CE1 . TYR A 1 91 ? 12.219 20.947 28.727 1.00 9.52 ? 91 TYR A CE1 1 ATOM 581 C CE2 . TYR A 1 91 ? 14.399 20.546 27.932 1.00 9.16 ? 91 TYR A CE2 1 ATOM 582 C CZ . TYR A 1 91 ? 13.044 20.652 27.677 1.00 8.81 ? 91 TYR A CZ 1 ATOM 583 O OH . TYR A 1 91 ? 12.503 20.412 26.444 1.00 9.55 ? 91 TYR A OH 1 ATOM 584 N N . GLY A 1 92 ? 17.132 22.881 31.251 1.00 9.68 ? 92 GLY A N 1 ATOM 585 C CA . GLY A 1 92 ? 18.245 23.192 30.398 1.00 10.98 ? 92 GLY A CA 1 ATOM 586 C C . GLY A 1 92 ? 18.848 21.940 29.820 1.00 9.90 ? 92 GLY A C 1 ATOM 587 O O . GLY A 1 92 ? 18.342 20.819 29.968 1.00 10.16 ? 92 GLY A O 1 ATOM 588 N N . PRO A 1 93 ? 19.967 22.142 29.123 1.00 9.76 ? 93 PRO A N 1 ATOM 589 C CA . PRO A 1 93 ? 20.634 21.032 28.413 1.00 11.17 ? 93 PRO A CA 1 ATOM 590 C C . PRO A 1 93 ? 21.012 19.854 29.295 1.00 10.97 ? 93 PRO A C 1 ATOM 591 O O . PRO A 1 93 ? 21.083 18.728 28.752 1.00 13.06 ? 93 PRO A O 1 ATOM 592 C CB . PRO A 1 93 ? 21.854 21.682 27.800 1.00 14.72 ? 93 PRO A CB 1 ATOM 593 C CG . PRO A 1 93 ? 21.601 23.147 27.804 1.00 16.30 ? 93 PRO A CG 1 ATOM 594 C CD . PRO A 1 93 ? 20.626 23.432 28.869 1.00 12.32 ? 93 PRO A CD 1 ATOM 595 N N . ASP A 1 94 ? 21.235 20.040 30.591 1.00 12.52 ? 94 ASP A N 1 ATOM 596 C CA . ASP A 1 94 ? 21.588 18.948 31.524 1.00 13.56 ? 94 ASP A CA 1 ATOM 597 C C . ASP A 1 94 ? 20.466 17.926 31.594 1.00 12.89 ? 94 ASP A C 1 ATOM 598 O O . ASP A 1 94 ? 20.734 16.798 32.016 1.00 17.78 ? 94 ASP A O 1 ATOM 599 C CB A ASP A 1 94 ? 22.029 19.416 32.905 0.49 15.32 ? 94 ASP A CB 1 ATOM 600 C CB B ASP A 1 94 ? 21.781 19.574 32.921 0.51 18.35 ? 94 ASP A CB 1 ATOM 601 C CG A ASP A 1 94 ? 23.524 19.705 32.940 0.49 15.65 ? 94 ASP A CG 1 ATOM 602 C CG B ASP A 1 94 ? 20.588 20.323 33.507 0.51 18.73 ? 94 ASP A CG 1 ATOM 603 O OD1 A ASP A 1 94 ? 24.164 19.704 31.870 0.49 20.82 ? 94 ASP A OD1 1 ATOM 604 O OD1 B ASP A 1 94 ? 19.882 19.781 34.399 0.51 28.74 ? 94 ASP A OD1 1 ATOM 605 O OD2 A ASP A 1 94 ? 23.975 19.960 34.065 0.49 21.63 ? 94 ASP A OD2 1 ATOM 606 O OD2 B ASP A 1 94 ? 20.255 21.472 33.127 0.51 21.67 ? 94 ASP A OD2 1 ATOM 607 N N . MET A 1 95 ? 19.257 18.270 31.201 1.00 11.86 ? 95 MET A N 1 ATOM 608 C CA . MET A 1 95 ? 18.182 17.299 31.310 1.00 14.15 ? 95 MET A CA 1 ATOM 609 C C . MET A 1 95 ? 18.108 16.379 30.107 1.00 13.72 ? 95 MET A C 1 ATOM 610 O O . MET A 1 95 ? 17.348 15.411 30.090 1.00 15.94 ? 95 MET A O 1 ATOM 611 C CB . MET A 1 95 ? 16.896 18.118 31.445 1.00 18.28 ? 95 MET A CB 1 ATOM 612 C CG . MET A 1 95 ? 16.844 18.624 32.900 0.60 24.28 ? 95 MET A CG 1 ATOM 613 S SD . MET A 1 95 ? 16.523 17.341 34.070 0.60 33.30 ? 95 MET A SD 1 ATOM 614 C CE . MET A 1 95 ? 15.209 16.369 33.338 0.60 30.90 ? 95 MET A CE 1 ATOM 615 N N . ILE A 1 96 ? 18.835 16.666 29.053 1.00 12.75 ? 96 ILE A N 1 ATOM 616 C CA . ILE A 1 96 ? 18.856 15.832 27.869 1.00 12.85 ? 96 ILE A CA 1 ATOM 617 C C . ILE A 1 96 ? 19.721 14.611 28.178 1.00 15.16 ? 96 ILE A C 1 ATOM 618 O O . ILE A 1 96 ? 20.910 14.713 28.476 1.00 19.25 ? 96 ILE A O 1 ATOM 619 C CB . ILE A 1 96 ? 19.392 16.569 26.637 1.00 14.06 ? 96 ILE A CB 1 ATOM 620 C CG1 . ILE A 1 96 ? 18.650 17.868 26.347 1.00 14.71 ? 96 ILE A CG1 1 ATOM 621 C CG2 . ILE A 1 96 ? 19.439 15.638 25.434 1.00 18.38 ? 96 ILE A CG2 1 ATOM 622 C CD1 . ILE A 1 96 ? 17.166 17.716 26.180 1.00 16.20 ? 96 ILE A CD1 1 ATOM 623 N N . VAL A 1 97 ? 19.092 13.447 28.099 1.00 13.80 ? 97 VAL A N 1 ATOM 624 C CA . VAL A 1 97 ? 19.820 12.192 28.210 1.00 14.23 ? 97 VAL A CA 1 ATOM 625 C C . VAL A 1 97 ? 19.506 11.363 26.969 1.00 12.70 ? 97 VAL A C 1 ATOM 626 O O . VAL A 1 97 ? 18.686 11.752 26.126 1.00 15.30 ? 97 VAL A O 1 ATOM 627 C CB . VAL A 1 97 ? 19.471 11.495 29.528 1.00 15.28 ? 97 VAL A CB 1 ATOM 628 C CG1 . VAL A 1 97 ? 19.840 12.307 30.774 1.00 19.26 ? 97 VAL A CG1 1 ATOM 629 C CG2 . VAL A 1 97 ? 17.999 11.178 29.539 1.00 15.55 ? 97 VAL A CG2 1 ATOM 630 N N . GLU A 1 98 ? 20.164 10.243 26.799 1.00 13.57 ? 98 GLU A N 1 ATOM 631 C CA . GLU A 1 98 ? 19.965 9.404 25.640 1.00 16.18 ? 98 GLU A CA 1 ATOM 632 C C . GLU A 1 98 ? 18.470 9.133 25.408 1.00 13.94 ? 98 GLU A C 1 ATOM 633 O O . GLU A 1 98 ? 17.754 8.951 26.373 1.00 16.41 ? 98 GLU A O 1 ATOM 634 C CB . GLU A 1 98 ? 20.695 8.096 25.848 1.00 18.51 ? 98 GLU A CB 1 ATOM 635 C CG . GLU A 1 98 ? 20.346 7.212 27.021 1.00 25.97 ? 98 GLU A CG 1 ATOM 636 C CD . GLU A 1 98 ? 20.837 5.782 26.850 0.37 28.14 ? 98 GLU A CD 1 ATOM 637 O OE1 . GLU A 1 98 ? 20.459 4.910 27.661 0.37 29.54 ? 98 GLU A OE1 1 ATOM 638 O OE2 . GLU A 1 98 ? 21.609 5.494 25.905 0.37 35.05 ? 98 GLU A OE2 1 ATOM 639 N N . TRP A 1 99 ? 18.083 9.269 24.170 1.00 13.55 ? 99 TRP A N 1 ATOM 640 C CA . TRP A 1 99 ? 16.751 9.126 23.635 1.00 12.73 ? 99 TRP A CA 1 ATOM 641 C C . TRP A 1 99 ? 15.760 10.039 24.345 1.00 10.91 ? 99 TRP A C 1 ATOM 642 O O . TRP A 1 99 ? 14.906 9.725 25.139 1.00 13.83 ? 99 TRP A O 1 ATOM 643 C CB . TRP A 1 99 ? 16.286 7.686 23.739 1.00 15.44 ? 99 TRP A CB 1 ATOM 644 C CG . TRP A 1 99 ? 15.058 7.628 22.865 1.00 14.96 ? 99 TRP A CG 1 ATOM 645 C CD1 . TRP A 1 99 ? 13.772 7.566 23.337 1.00 16.54 ? 99 TRP A CD1 1 ATOM 646 C CD2 . TRP A 1 99 ? 14.966 7.652 21.441 1.00 21.89 ? 99 TRP A CD2 1 ATOM 647 N NE1 . TRP A 1 99 ? 12.898 7.534 22.287 1.00 18.69 ? 99 TRP A NE1 1 ATOM 648 C CE2 . TRP A 1 99 ? 13.602 7.588 21.118 1.00 22.31 ? 99 TRP A CE2 1 ATOM 649 C CE3 . TRP A 1 99 ? 15.922 7.718 20.416 1.00 26.61 ? 99 TRP A CE3 1 ATOM 650 C CZ2 . TRP A 1 99 ? 13.123 7.582 19.802 1.00 32.30 ? 99 TRP A CZ2 1 ATOM 651 C CZ3 . TRP A 1 99 ? 15.462 7.713 19.124 1.00 35.15 ? 99 TRP A CZ3 1 ATOM 652 C CH2 . TRP A 1 99 ? 14.094 7.648 18.849 1.00 37.59 ? 99 TRP A CH2 1 ATOM 653 N N . SER A 1 100 ? 15.877 11.312 24.007 1.00 10.89 ? 100 SER A N 1 ATOM 654 C CA . SER A 1 100 ? 15.033 12.401 24.425 1.00 11.21 ? 100 SER A CA 1 ATOM 655 C C . SER A 1 100 ? 14.568 13.256 23.256 1.00 10.11 ? 100 SER A C 1 ATOM 656 O O . SER A 1 100 ? 14.840 14.462 23.244 1.00 12.72 ? 100 SER A O 1 ATOM 657 C CB . SER A 1 100 ? 15.860 13.320 25.317 1.00 11.08 ? 100 SER A CB 1 ATOM 658 O OG . SER A 1 100 ? 16.373 12.651 26.428 1.00 15.54 ? 100 SER A OG 1 ATOM 659 N N . PRO A 1 101 ? 13.889 12.647 22.270 1.00 11.29 ? 101 PRO A N 1 ATOM 660 C CA . PRO A 1 101 ? 13.593 13.374 21.022 1.00 11.82 ? 101 PRO A CA 1 ATOM 661 C C . PRO A 1 101 ? 12.725 14.614 21.212 1.00 9.97 ? 101 PRO A C 1 ATOM 662 O O . PRO A 1 101 ? 13.017 15.663 20.620 1.00 12.51 ? 101 PRO A O 1 ATOM 663 C CB . PRO A 1 101 ? 12.885 12.298 20.182 1.00 12.95 ? 101 PRO A CB 1 ATOM 664 C CG . PRO A 1 101 ? 12.379 11.320 21.180 1.00 13.16 ? 101 PRO A CG 1 ATOM 665 C CD . PRO A 1 101 ? 13.416 11.247 22.268 1.00 10.53 ? 101 PRO A CD 1 ATOM 666 N N . ALA A 1 102 ? 11.662 14.534 22.013 1.00 9.32 ? 102 ALA A N 1 ATOM 667 C CA . ALA A 1 102 ? 10.797 15.717 22.235 1.00 9.62 ? 102 ALA A CA 1 ATOM 668 C C . ALA A 1 102 ? 11.518 16.747 23.122 1.00 8.28 ? 102 ALA A C 1 ATOM 669 O O . ALA A 1 102 ? 11.500 17.929 22.847 1.00 10.15 ? 102 ALA A O 1 ATOM 670 C CB . ALA A 1 102 ? 9.500 15.293 22.826 1.00 9.85 ? 102 ALA A CB 1 ATOM 671 N N . THR A 1 103 ? 12.149 16.269 24.191 1.00 8.76 ? 103 THR A N 1 ATOM 672 C CA A THR A 1 103 ? 12.836 17.176 25.101 0.69 9.74 ? 103 THR A CA 1 ATOM 673 C CA B THR A 1 103 ? 12.764 17.256 25.085 0.31 8.50 ? 103 THR A CA 1 ATOM 674 C C . THR A 1 103 ? 13.890 17.958 24.341 1.00 8.71 ? 103 THR A C 1 ATOM 675 O O . THR A 1 103 ? 14.075 19.167 24.618 1.00 9.19 ? 103 THR A O 1 ATOM 676 C CB A THR A 1 103 ? 13.444 16.346 26.242 0.69 11.57 ? 103 THR A CB 1 ATOM 677 C CB B THR A 1 103 ? 13.269 16.690 26.418 0.31 10.66 ? 103 THR A CB 1 ATOM 678 O OG1 A THR A 1 103 ? 12.514 15.494 26.897 0.69 12.12 ? 103 THR A OG1 1 ATOM 679 O OG1 B THR A 1 103 ? 13.727 15.343 26.279 0.31 11.10 ? 103 THR A OG1 1 ATOM 680 C CG2 A THR A 1 103 ? 13.966 17.314 27.291 0.69 12.92 ? 103 THR A CG2 1 ATOM 681 C CG2 B THR A 1 103 ? 12.141 16.708 27.449 0.31 11.30 ? 103 THR A CG2 1 ATOM 682 N N . GLU A 1 104 ? 14.605 17.345 23.409 1.00 9.07 ? 104 GLU A N 1 ATOM 683 C CA . GLU A 1 104 ? 15.573 18.046 22.619 1.00 9.46 ? 104 GLU A CA 1 ATOM 684 C C . GLU A 1 104 ? 14.954 19.116 21.728 1.00 8.85 ? 104 GLU A C 1 ATOM 685 O O . GLU A 1 104 ? 15.479 20.207 21.615 1.00 11.81 ? 104 GLU A O 1 ATOM 686 C CB . GLU A 1 104 ? 16.351 17.046 21.735 1.00 12.26 ? 104 GLU A CB 1 ATOM 687 C CG . GLU A 1 104 ? 17.412 16.201 22.375 1.00 17.66 ? 104 GLU A CG 1 ATOM 688 C CD . GLU A 1 104 ? 17.917 14.994 21.601 0.47 22.68 ? 104 GLU A CD 1 ATOM 689 O OE1 . GLU A 1 104 ? 18.874 14.422 22.169 0.47 30.78 ? 104 GLU A OE1 1 ATOM 690 O OE2 . GLU A 1 104 ? 17.417 14.602 20.510 0.47 18.84 ? 104 GLU A OE2 1 ATOM 691 N N . ARG A 1 105 ? 13.771 18.822 21.155 1.00 8.99 ? 105 ARG A N 1 ATOM 692 C CA . ARG A 1 105 ? 13.107 19.799 20.295 1.00 9.01 ? 105 ARG A CA 1 ATOM 693 C C . ARG A 1 105 ? 12.600 20.972 21.108 1.00 8.76 ? 105 ARG A C 1 ATOM 694 O O . ARG A 1 105 ? 12.643 22.101 20.594 1.00 9.62 ? 105 ARG A O 1 ATOM 695 C CB . ARG A 1 105 ? 12.011 19.145 19.491 1.00 10.30 ? 105 ARG A CB 1 ATOM 696 C CG . ARG A 1 105 ? 12.521 18.210 18.427 1.00 10.78 ? 105 ARG A CG 1 ATOM 697 C CD . ARG A 1 105 ? 11.405 17.474 17.727 1.00 14.30 ? 105 ARG A CD 1 ATOM 698 N NE . ARG A 1 105 ? 11.975 16.392 16.877 1.00 13.16 ? 105 ARG A NE 1 ATOM 699 C CZ . ARG A 1 105 ? 11.673 15.109 16.923 1.00 12.58 ? 105 ARG A CZ 1 ATOM 700 N NH1 . ARG A 1 105 ? 10.754 14.615 17.735 1.00 14.93 ? 105 ARG A NH1 1 ATOM 701 N NH2 . ARG A 1 105 ? 12.295 14.278 16.105 1.00 16.87 ? 105 ARG A NH2 1 ATOM 702 N N . PHE A 1 106 ? 12.116 20.736 22.321 1.00 8.85 ? 106 PHE A N 1 ATOM 703 C CA . PHE A 1 106 ? 11.587 21.789 23.129 1.00 8.30 ? 106 PHE A CA 1 ATOM 704 C C . PHE A 1 106 ? 12.619 22.552 23.960 1.00 7.61 ? 106 PHE A C 1 ATOM 705 O O . PHE A 1 106 ? 12.325 23.534 24.616 1.00 8.72 ? 106 PHE A O 1 ATOM 706 C CB . PHE A 1 106 ? 10.464 21.281 24.067 1.00 8.58 ? 106 PHE A CB 1 ATOM 707 C CG . PHE A 1 106 ? 9.176 21.022 23.281 1.00 8.41 ? 106 PHE A CG 1 ATOM 708 C CD1 . PHE A 1 106 ? 8.750 19.754 23.038 1.00 12.99 ? 106 PHE A CD1 1 ATOM 709 C CD2 . PHE A 1 106 ? 8.435 22.068 22.797 1.00 8.70 ? 106 PHE A CD2 1 ATOM 710 C CE1 . PHE A 1 106 ? 7.593 19.511 22.329 1.00 15.62 ? 106 PHE A CE1 1 ATOM 711 C CE2 . PHE A 1 106 ? 7.275 21.854 22.106 1.00 9.45 ? 106 PHE A CE2 1 ATOM 712 C CZ . PHE A 1 106 ? 6.869 20.579 21.879 1.00 11.99 ? 106 PHE A CZ 1 ATOM 713 N N . LEU A 1 107 ? 13.885 22.135 23.874 1.00 8.13 ? 107 LEU A N 1 ATOM 714 C CA . LEU A 1 107 ? 14.961 22.662 24.701 1.00 8.30 ? 107 LEU A CA 1 ATOM 715 C C . LEU A 1 107 ? 15.122 24.151 24.509 1.00 9.09 ? 107 LEU A C 1 ATOM 716 O O . LEU A 1 107 ? 15.218 24.915 25.494 1.00 9.97 ? 107 LEU A O 1 ATOM 717 C CB . LEU A 1 107 ? 16.285 21.920 24.446 1.00 9.38 ? 107 LEU A CB 1 ATOM 718 C CG . LEU A 1 107 ? 17.495 22.427 25.203 1.00 11.35 ? 107 LEU A CG 1 ATOM 719 C CD1 . LEU A 1 107 ? 17.398 22.200 26.696 1.00 13.80 ? 107 LEU A CD1 1 ATOM 720 C CD2 . LEU A 1 107 ? 18.708 21.706 24.611 1.00 14.02 ? 107 LEU A CD2 1 ATOM 721 N N . ALA A 1 108 ? 15.172 24.649 23.273 1.00 8.58 ? 108 ALA A N 1 ATOM 722 C CA . ALA A 1 108 ? 15.378 26.082 23.094 1.00 9.45 ? 108 ALA A CA 1 ATOM 723 C C . ALA A 1 108 ? 14.265 26.879 23.708 1.00 8.86 ? 108 ALA A C 1 ATOM 724 O O . ALA A 1 108 ? 14.478 27.970 24.213 1.00 9.98 ? 108 ALA A O 1 ATOM 725 C CB . ALA A 1 108 ? 15.542 26.358 21.604 1.00 10.19 ? 108 ALA A CB 1 ATOM 726 N N . SER A 1 109 ? 13.025 26.391 23.651 1.00 8.99 ? 109 SER A N 1 ATOM 727 C CA . SER A 1 109 ? 11.900 27.093 24.243 1.00 10.36 ? 109 SER A CA 1 ATOM 728 C C . SER A 1 109 ? 12.036 27.146 25.743 1.00 10.18 ? 109 SER A C 1 ATOM 729 O O . SER A 1 109 ? 11.473 28.062 26.336 1.00 13.05 ? 109 SER A O 1 ATOM 730 C CB . SER A 1 109 ? 10.550 26.442 23.859 1.00 10.47 ? 109 SER A CB 1 ATOM 731 O OG . SER A 1 109 ? 10.247 25.319 24.672 1.00 9.58 ? 109 SER A OG 1 ATOM 732 N N . GLY A 1 110 ? 12.756 26.190 26.335 1.00 10.18 ? 110 GLY A N 1 ATOM 733 C CA . GLY A 1 110 ? 13.089 26.158 27.737 1.00 10.35 ? 110 GLY A CA 1 ATOM 734 C C . GLY A 1 110 ? 12.137 25.424 28.640 1.00 9.93 ? 110 GLY A C 1 ATOM 735 O O . GLY A 1 110 ? 12.371 25.347 29.855 1.00 10.65 ? 110 GLY A O 1 ATOM 736 N N . HIS A 1 111 ? 11.067 24.798 28.108 1.00 9.67 ? 111 HIS A N 1 ATOM 737 C CA . HIS A 1 111 ? 10.144 24.106 28.971 1.00 9.07 ? 111 HIS A CA 1 ATOM 738 C C . HIS A 1 111 ? 9.361 23.079 28.136 1.00 8.22 ? 111 HIS A C 1 ATOM 739 O O . HIS A 1 111 ? 9.267 23.190 26.935 1.00 8.69 ? 111 HIS A O 1 ATOM 740 C CB . HIS A 1 111 ? 9.124 24.979 29.669 1.00 10.45 ? 111 HIS A CB 1 ATOM 741 C CG . HIS A 1 111 ? 8.081 25.578 28.805 1.00 12.24 ? 111 HIS A CG 1 ATOM 742 N ND1 . HIS A 1 111 ? 8.221 26.704 28.060 1.00 15.58 ? 111 HIS A ND1 1 ATOM 743 C CD2 . HIS A 1 111 ? 6.833 25.080 28.539 1.00 13.12 ? 111 HIS A CD2 1 ATOM 744 C CE1 . HIS A 1 111 ? 7.104 26.902 27.408 1.00 15.70 ? 111 HIS A CE1 1 ATOM 745 N NE2 . HIS A 1 111 ? 6.244 25.925 27.672 1.00 15.26 ? 111 HIS A NE2 1 ATOM 746 N N . MET A 1 112 ? 8.736 22.141 28.854 1.00 8.50 ? 112 MET A N 1 ATOM 747 C CA . MET A 1 112 ? 7.596 21.361 28.396 1.00 8.59 ? 112 MET A CA 1 ATOM 748 C C . MET A 1 112 ? 6.525 21.405 29.439 1.00 8.75 ? 112 MET A C 1 ATOM 749 O O . MET A 1 112 ? 6.820 21.506 30.656 1.00 9.68 ? 112 MET A O 1 ATOM 750 C CB . MET A 1 112 ? 7.985 19.894 28.081 1.00 9.51 ? 112 MET A CB 1 ATOM 751 C CG . MET A 1 112 ? 8.811 19.736 26.820 1.00 10.57 ? 112 MET A CG 1 ATOM 752 S SD . MET A 1 112 ? 9.216 18.031 26.443 1.00 13.77 ? 112 MET A SD 1 ATOM 753 C CE . MET A 1 112 ? 7.676 17.419 25.846 1.00 24.46 ? 112 MET A CE 1 ATOM 754 N N . THR A 1 113 ? 5.266 21.374 29.091 1.00 8.26 ? 113 THR A N 1 ATOM 755 C CA . THR A 1 113 ? 4.259 21.252 30.116 1.00 8.90 ? 113 THR A CA 1 ATOM 756 C C . THR A 1 113 ? 4.232 19.861 30.678 1.00 8.79 ? 113 THR A C 1 ATOM 757 O O . THR A 1 113 ? 4.724 18.903 30.098 1.00 8.73 ? 113 THR A O 1 ATOM 758 C CB . THR A 1 113 ? 2.848 21.630 29.627 1.00 9.29 ? 113 THR A CB 1 ATOM 759 O OG1 . THR A 1 113 ? 2.450 20.664 28.699 1.00 10.12 ? 113 THR A OG1 1 ATOM 760 C CG2 . THR A 1 113 ? 2.784 23.000 28.948 1.00 10.74 ? 113 THR A CG2 1 ATOM 761 N N . VAL A 1 114 ? 3.541 19.755 31.829 1.00 9.52 ? 114 VAL A N 1 ATOM 762 C CA . VAL A 1 114 ? 3.303 18.436 32.437 1.00 9.70 ? 114 VAL A CA 1 ATOM 763 C C . VAL A 1 114 ? 2.718 17.479 31.431 1.00 9.36 ? 114 VAL A C 1 ATOM 764 O O . VAL A 1 114 ? 3.163 16.347 31.269 1.00 9.61 ? 114 VAL A O 1 ATOM 765 C CB . VAL A 1 114 ? 2.404 18.598 33.685 1.00 10.50 ? 114 VAL A CB 1 ATOM 766 C CG1 . VAL A 1 114 ? 1.933 17.243 34.191 1.00 10.91 ? 114 VAL A CG1 1 ATOM 767 C CG2 . VAL A 1 114 ? 3.154 19.339 34.760 1.00 11.69 ? 114 VAL A CG2 1 ATOM 768 N N . LEU A 1 115 ? 1.671 17.910 30.733 1.00 9.65 ? 115 LEU A N 1 ATOM 769 C CA . LEU A 1 115 ? 1.031 17.013 29.776 1.00 9.48 ? 115 LEU A CA 1 ATOM 770 C C . LEU A 1 115 ? 1.873 16.735 28.559 1.00 9.03 ? 115 LEU A C 1 ATOM 771 O O . LEU A 1 115 ? 1.839 15.604 28.053 1.00 10.25 ? 115 LEU A O 1 ATOM 772 C CB . LEU A 1 115 ? -0.311 17.584 29.366 1.00 10.99 ? 115 LEU A CB 1 ATOM 773 C CG . LEU A 1 115 ? -1.456 17.390 30.316 1.00 12.59 ? 115 LEU A CG 1 ATOM 774 C CD1 . LEU A 1 115 ? -2.612 18.261 29.866 1.00 16.17 ? 115 LEU A CD1 1 ATOM 775 C CD2 . LEU A 1 115 ? -1.882 15.938 30.413 1.00 16.55 ? 115 LEU A CD2 1 ATOM 776 N N . GLU A 1 116 ? 2.655 17.612 28.007 1.00 9.57 ? 116 GLU A N 1 ATOM 777 C CA . GLU A 1 116 ? 3.523 17.471 26.893 1.00 9.54 ? 116 GLU A CA 1 ATOM 778 C C . GLU A 1 116 ? 4.538 16.416 27.303 1.00 8.90 ? 116 GLU A C 1 ATOM 779 O O . GLU A 1 116 ? 4.817 15.489 26.560 1.00 9.43 ? 116 GLU A O 1 ATOM 780 C CB . GLU A 1 116 ? 4.249 18.739 26.453 1.00 8.82 ? 116 GLU A CB 1 ATOM 781 C CG . GLU A 1 116 ? 3.415 19.714 25.658 1.00 10.70 ? 116 GLU A CG 1 ATOM 782 C CD . GLU A 1 116 ? 4.107 21.050 25.464 1.00 9.54 ? 116 GLU A CD 1 ATOM 783 O OE1 . GLU A 1 116 ? 5.021 21.422 26.237 1.00 9.44 ? 116 GLU A OE1 1 ATOM 784 O OE2 . GLU A 1 116 ? 3.686 21.801 24.528 1.00 10.16 ? 116 GLU A OE2 1 ATOM 785 N N . ALA A 1 117 ? 5.100 16.587 28.504 1.00 9.09 ? 117 ALA A N 1 ATOM 786 C CA . ALA A 1 117 ? 6.137 15.653 28.961 1.00 9.32 ? 117 ALA A CA 1 ATOM 787 C C . ALA A 1 117 ? 5.547 14.245 29.109 1.00 8.86 ? 117 ALA A C 1 ATOM 788 O O . ALA A 1 117 ? 6.176 13.270 28.749 1.00 9.08 ? 117 ALA A O 1 ATOM 789 C CB . ALA A 1 117 ? 6.730 16.128 30.267 1.00 9.11 ? 117 ALA A CB 1 ATOM 790 N N . ALA A 1 118 ? 4.358 14.167 29.700 1.00 8.88 ? 118 ALA A N 1 ATOM 791 C CA . ALA A 1 118 ? 3.737 12.850 29.918 1.00 9.01 ? 118 ALA A CA 1 ATOM 792 C C . ALA A 1 118 ? 3.428 12.173 28.586 1.00 7.72 ? 118 ALA A C 1 ATOM 793 O O . ALA A 1 118 ? 3.670 10.974 28.428 1.00 8.81 ? 118 ALA A O 1 ATOM 794 C CB . ALA A 1 118 ? 2.517 12.985 30.798 1.00 10.58 ? 118 ALA A CB 1 ATOM 795 N N . GLN A 1 119 ? 2.928 12.933 27.620 1.00 8.03 ? 119 GLN A N 1 ATOM 796 C CA . GLN A 1 119 ? 2.609 12.338 26.342 1.00 8.48 ? 119 GLN A CA 1 ATOM 797 C C . GLN A 1 119 ? 3.893 11.895 25.636 1.00 7.67 ? 119 GLN A C 1 ATOM 798 O O . GLN A 1 119 ? 3.874 10.845 24.956 1.00 8.48 ? 119 GLN A O 1 ATOM 799 C CB . GLN A 1 119 ? 1.830 13.314 25.493 1.00 8.39 ? 119 GLN A CB 1 ATOM 800 C CG . GLN A 1 119 ? 1.209 12.626 24.258 1.00 9.51 ? 119 GLN A CG 1 ATOM 801 C CD . GLN A 1 119 ? 0.326 13.519 23.462 1.00 9.58 ? 119 GLN A CD 1 ATOM 802 O OE1 . GLN A 1 119 ? -0.098 14.601 23.887 1.00 10.84 ? 119 GLN A OE1 1 ATOM 803 N NE2 . GLN A 1 119 ? 0.012 13.065 22.239 1.00 11.75 ? 119 GLN A NE2 1 ATOM 804 N N . ALA A 1 120 ? 4.969 12.665 25.740 1.00 7.90 ? 120 ALA A N 1 ATOM 805 C CA . ALA A 1 120 ? 6.241 12.300 25.129 1.00 8.28 ? 120 ALA A CA 1 ATOM 806 C C . ALA A 1 120 ? 6.828 11.062 25.790 1.00 7.91 ? 120 ALA A C 1 ATOM 807 O O . ALA A 1 120 ? 7.373 10.180 25.137 1.00 8.46 ? 120 ALA A O 1 ATOM 808 C CB . ALA A 1 120 ? 7.231 13.431 25.155 1.00 9.59 ? 120 ALA A CB 1 ATOM 809 N N . ALA A 1 121 ? 6.700 10.963 27.098 1.00 8.00 ? 121 ALA A N 1 ATOM 810 C CA . ALA A 1 121 ? 7.159 9.803 27.828 1.00 8.64 ? 121 ALA A CA 1 ATOM 811 C C . ALA A 1 121 ? 6.442 8.525 27.348 1.00 7.85 ? 121 ALA A C 1 ATOM 812 O O . ALA A 1 121 ? 7.031 7.483 27.152 1.00 8.78 ? 121 ALA A O 1 ATOM 813 C CB . ALA A 1 121 ? 6.991 9.982 29.317 1.00 9.59 ? 121 ALA A CB 1 ATOM 814 N N . VAL A 1 122 ? 5.097 8.666 27.227 1.00 7.97 ? 122 VAL A N 1 ATOM 815 C CA . VAL A 1 122 ? 4.349 7.472 26.812 1.00 8.09 ? 122 VAL A CA 1 ATOM 816 C C . VAL A 1 122 ? 4.512 7.157 25.350 1.00 8.27 ? 122 VAL A C 1 ATOM 817 O O . VAL A 1 122 ? 4.658 5.961 25.047 1.00 10.21 ? 122 VAL A O 1 ATOM 818 C CB . VAL A 1 122 ? 2.853 7.683 27.170 1.00 8.96 ? 122 VAL A CB 1 ATOM 819 C CG1 . VAL A 1 122 ? 1.975 6.610 26.597 1.00 9.24 ? 122 VAL A CG1 1 ATOM 820 C CG2 . VAL A 1 122 ? 2.628 7.774 28.669 1.00 9.51 ? 122 VAL A CG2 1 ATOM 821 N N . GLN A 1 123 ? 4.418 8.119 24.442 1.00 7.26 ? 123 GLN A N 1 ATOM 822 C CA . GLN A 1 123 ? 4.338 7.837 23.021 1.00 7.72 ? 123 GLN A CA 1 ATOM 823 C C . GLN A 1 123 ? 5.674 7.797 22.319 1.00 7.54 ? 123 GLN A C 1 ATOM 824 O O . GLN A 1 123 ? 5.718 7.193 21.221 1.00 8.90 ? 123 GLN A O 1 ATOM 825 C CB . GLN A 1 123 ? 3.419 8.825 22.323 1.00 8.29 ? 123 GLN A CB 1 ATOM 826 C CG . GLN A 1 123 ? 1.992 8.795 22.815 1.00 7.76 ? 123 GLN A CG 1 ATOM 827 C CD . GLN A 1 123 ? 1.076 9.575 21.897 1.00 8.04 ? 123 GLN A CD 1 ATOM 828 O OE1 . GLN A 1 123 ? 1.399 10.687 21.465 1.00 9.28 ? 123 GLN A OE1 1 ATOM 829 N NE2 . GLN A 1 123 ? -0.055 9.003 21.587 1.00 9.66 ? 123 GLN A NE2 1 ATOM 830 N N . LEU A 1 124 ? 6.696 8.445 22.886 1.00 7.84 ? 124 LEU A N 1 ATOM 831 C CA . LEU A 1 124 ? 8.008 8.445 22.299 1.00 8.43 ? 124 LEU A CA 1 ATOM 832 C C . LEU A 1 124 ? 9.022 7.776 23.232 1.00 8.62 ? 124 LEU A C 1 ATOM 833 O O . LEU A 1 124 ? 10.160 7.653 22.864 1.00 10.99 ? 124 LEU A O 1 ATOM 834 C CB . LEU A 1 124 ? 8.533 9.862 21.939 1.00 9.54 ? 124 LEU A CB 1 ATOM 835 C CG . LEU A 1 124 ? 7.748 10.518 20.790 1.00 12.34 ? 124 LEU A CG 1 ATOM 836 C CD1 . LEU A 1 124 ? 8.124 11.983 20.686 1.00 14.06 ? 124 LEU A CD1 1 ATOM 837 C CD2 . LEU A 1 124 ? 7.996 9.774 19.488 1.00 19.38 ? 124 LEU A CD2 1 ATOM 838 N N . SER A 1 125 ? 8.641 7.400 24.426 1.00 8.83 ? 125 SER A N 1 ATOM 839 C CA . SER A 1 125 ? 9.558 6.839 25.393 1.00 9.23 ? 125 SER A CA 1 ATOM 840 C C . SER A 1 125 ? 10.631 7.854 25.792 1.00 9.40 ? 125 SER A C 1 ATOM 841 O O . SER A 1 125 ? 11.716 7.454 26.192 1.00 10.94 ? 125 SER A O 1 ATOM 842 C CB . SER A 1 125 ? 10.144 5.522 24.876 1.00 10.19 ? 125 SER A CB 1 ATOM 843 O OG . SER A 1 125 ? 10.294 4.676 25.957 1.00 12.25 ? 125 SER A OG 1 ATOM 844 N N . ASP A 1 126 ? 10.306 9.143 25.727 1.00 8.70 ? 126 ASP A N 1 ATOM 845 C CA . ASP A 1 126 ? 11.322 10.198 25.952 1.00 9.02 ? 126 ASP A CA 1 ATOM 846 C C . ASP A 1 126 ? 11.863 10.176 27.386 1.00 8.63 ? 126 ASP A C 1 ATOM 847 O O . ASP A 1 126 ? 11.117 10.346 28.361 1.00 9.68 ? 126 ASP A O 1 ATOM 848 C CB . ASP A 1 126 ? 10.676 11.510 25.534 1.00 9.76 ? 126 ASP A CB 1 ATOM 849 C CG . ASP A 1 126 ? 11.629 12.680 25.521 1.00 9.81 ? 126 ASP A CG 1 ATOM 850 O OD1 . ASP A 1 126 ? 12.351 12.883 26.510 1.00 10.50 ? 126 ASP A OD1 1 ATOM 851 O OD2 . ASP A 1 126 ? 11.577 13.446 24.536 1.00 12.43 ? 126 ASP A OD2 1 ATOM 852 N N . ASN A 1 127 ? 13.164 9.955 27.488 1.00 9.22 ? 127 ASN A N 1 ATOM 853 C CA . ASN A 1 127 ? 13.793 9.835 28.788 1.00 9.77 ? 127 ASN A CA 1 ATOM 854 C C . ASN A 1 127 ? 13.893 11.155 29.540 1.00 10.38 ? 127 ASN A C 1 ATOM 855 O O . ASN A 1 127 ? 13.718 11.202 30.757 1.00 11.37 ? 127 ASN A O 1 ATOM 856 C CB . ASN A 1 127 ? 15.194 9.188 28.659 1.00 11.60 ? 127 ASN A CB 1 ATOM 857 C CG . ASN A 1 127 ? 15.107 7.678 28.482 1.00 13.03 ? 127 ASN A CG 1 ATOM 858 O OD1 . ASN A 1 127 ? 14.269 7.020 29.079 1.00 13.46 ? 127 ASN A OD1 1 ATOM 859 N ND2 . ASN A 1 127 ? 15.987 7.183 27.649 1.00 24.05 ? 127 ASN A ND2 1 ATOM 860 N N . GLY A 1 128 ? 14.181 12.228 28.927 1.00 10.47 ? 128 GLY A N 1 ATOM 861 C CA . GLY A 1 128 ? 14.342 13.522 29.489 1.00 12.25 ? 128 GLY A CA 1 ATOM 862 C C . GLY A 1 128 ? 12.990 13.914 30.040 1.00 10.35 ? 128 GLY A C 1 ATOM 863 O O . GLY A 1 128 ? 12.915 14.483 31.128 1.00 11.41 ? 128 GLY A O 1 ATOM 864 N N . ALA A 1 129 ? 11.931 13.675 29.247 1.00 9.63 ? 129 ALA A N 1 ATOM 865 C CA . ALA A 1 129 ? 10.580 14.028 29.657 1.00 10.25 ? 129 ALA A CA 1 ATOM 866 C C . ALA A 1 129 ? 10.190 13.239 30.901 1.00 9.45 ? 129 ALA A C 1 ATOM 867 O O . ALA A 1 129 ? 9.583 13.752 31.863 1.00 10.26 ? 129 ALA A O 1 ATOM 868 C CB . ALA A 1 129 ? 9.622 13.793 28.522 1.00 9.73 ? 129 ALA A CB 1 ATOM 869 N N . THR A 1 130 ? 10.534 11.970 30.894 1.00 9.61 ? 130 THR A N 1 ATOM 870 C CA . THR A 1 130 ? 10.341 11.124 32.055 1.00 9.63 ? 130 THR A CA 1 ATOM 871 C C . THR A 1 130 ? 11.031 11.636 33.311 1.00 10.02 ? 130 THR A C 1 ATOM 872 O O . THR A 1 130 ? 10.451 11.736 34.357 1.00 11.36 ? 130 THR A O 1 ATOM 873 C CB . THR A 1 130 ? 10.835 9.699 31.705 1.00 11.19 ? 130 THR A CB 1 ATOM 874 O OG1 . THR A 1 130 ? 10.075 9.165 30.627 1.00 10.65 ? 130 THR A OG1 1 ATOM 875 C CG2 . THR A 1 130 ? 10.676 8.722 32.881 1.00 12.07 ? 130 THR A CG2 1 ATOM 876 N N . ASN A 1 131 ? 12.304 11.985 33.162 1.00 10.85 ? 131 ASN A N 1 ATOM 877 C CA . ASN A 1 131 ? 13.021 12.541 34.321 1.00 11.81 ? 131 ASN A CA 1 ATOM 878 C C . ASN A 1 131 ? 12.466 13.878 34.749 1.00 13.09 ? 131 ASN A C 1 ATOM 879 O O . ASN A 1 131 ? 12.477 14.180 35.952 1.00 14.21 ? 131 ASN A O 1 ATOM 880 C CB . ASN A 1 131 ? 14.502 12.663 33.966 1.00 13.13 ? 131 ASN A CB 1 ATOM 881 C CG . ASN A 1 131 ? 15.240 11.345 33.929 1.00 13.03 ? 131 ASN A CG 1 ATOM 882 O OD1 . ASN A 1 131 ? 14.726 10.287 34.374 1.00 13.57 ? 131 ASN A OD1 1 ATOM 883 N ND2 . ASN A 1 131 ? 16.463 11.362 33.436 1.00 16.16 ? 131 ASN A ND2 1 ATOM 884 N N . LEU A 1 132 ? 11.968 14.697 33.848 1.00 12.59 ? 132 LEU A N 1 ATOM 885 C CA . LEU A 1 132 ? 11.306 15.954 34.227 1.00 13.38 ? 132 LEU A CA 1 ATOM 886 C C . LEU A 1 132 ? 10.111 15.667 35.125 1.00 13.91 ? 132 LEU A C 1 ATOM 887 O O . LEU A 1 132 ? 9.916 16.304 36.161 1.00 15.81 ? 132 LEU A O 1 ATOM 888 C CB . LEU A 1 132 ? 10.901 16.709 32.992 1.00 16.19 ? 132 LEU A CB 1 ATOM 889 C CG . LEU A 1 132 ? 10.567 18.153 32.907 1.00 17.66 ? 132 LEU A CG 1 ATOM 890 C CD1 . LEU A 1 132 ? 11.762 18.958 33.381 1.00 19.66 ? 132 LEU A CD1 1 ATOM 891 C CD2 . LEU A 1 132 ? 10.241 18.487 31.458 1.00 21.86 ? 132 LEU A CD2 1 ATOM 892 N N . LEU A 1 133 ? 9.313 14.683 34.748 1.00 12.63 ? 133 LEU A N 1 ATOM 893 C CA . LEU A 1 133 ? 8.156 14.318 35.562 1.00 12.64 ? 133 LEU A CA 1 ATOM 894 C C . LEU A 1 133 ? 8.565 13.695 36.878 1.00 14.83 ? 133 LEU A C 1 ATOM 895 O O . LEU A 1 133 ? 8.002 14.036 37.927 1.00 16.05 ? 133 LEU A O 1 ATOM 896 C CB . LEU A 1 133 ? 7.211 13.375 34.804 1.00 12.89 ? 133 LEU A CB 1 ATOM 897 C CG . LEU A 1 133 ? 6.579 13.995 33.573 1.00 11.82 ? 133 LEU A CG 1 ATOM 898 C CD1 . LEU A 1 133 ? 5.981 12.897 32.724 1.00 14.33 ? 133 LEU A CD1 1 ATOM 899 C CD2 . LEU A 1 133 ? 5.518 15.018 33.978 1.00 11.86 ? 133 LEU A CD2 1 ATOM 900 N N . LEU A 1 134 ? 9.588 12.855 36.887 1.00 13.62 ? 134 LEU A N 1 ATOM 901 C CA . LEU A 1 134 ? 10.053 12.279 38.137 1.00 15.84 ? 134 LEU A CA 1 ATOM 902 C C . LEU A 1 134 ? 10.438 13.350 39.121 1.00 19.70 ? 134 LEU A C 1 ATOM 903 O O . LEU A 1 134 ? 10.156 13.268 40.292 1.00 28.87 ? 134 LEU A O 1 ATOM 904 C CB . LEU A 1 134 ? 11.205 11.326 37.925 1.00 15.84 ? 134 LEU A CB 1 ATOM 905 C CG . LEU A 1 134 ? 10.845 9.943 37.357 1.00 14.52 ? 134 LEU A CG 1 ATOM 906 C CD1 . LEU A 1 134 ? 12.111 9.192 37.018 1.00 15.45 ? 134 LEU A CD1 1 ATOM 907 C CD2 . LEU A 1 134 ? 9.912 9.185 38.315 1.00 19.19 ? 134 LEU A CD2 1 ATOM 908 N N . ARG A 1 135 ? 11.096 14.371 38.598 1.00 20.86 ? 135 ARG A N 1 ATOM 909 C CA . ARG A 1 135 ? 11.499 15.331 39.640 1.00 24.92 ? 135 ARG A CA 1 ATOM 910 C C . ARG A 1 135 ? 10.274 16.059 40.125 1.00 29.70 ? 135 ARG A C 1 ATOM 911 O O . ARG A 1 135 ? 10.267 16.387 41.302 1.00 37.37 ? 135 ARG A O 1 ATOM 912 C CB . ARG A 1 135 ? 12.623 16.134 39.109 1.00 26.65 ? 135 ARG A CB 1 ATOM 913 C CG . ARG A 1 135 ? 12.785 17.043 37.943 1.00 33.73 ? 135 ARG A CG 1 ATOM 914 C CD . ARG A 1 135 ? 13.942 18.036 38.255 1.00 45.39 ? 135 ARG A CD 1 ATOM 915 N NE . ARG A 1 135 ? 14.357 18.815 37.085 1.00 48.05 ? 135 ARG A NE 1 ATOM 916 C CZ . ARG A 1 135 ? 13.714 19.791 36.492 1.00 43.09 ? 135 ARG A CZ 1 ATOM 917 N NH1 . ARG A 1 135 ? 12.529 20.046 37.051 1.00 62.36 ? 135 ARG A NH1 1 ATOM 918 N NH2 . ARG A 1 135 ? 13.938 20.595 35.426 1.00 33.92 ? 135 ARG A NH2 1 ATOM 919 N N . GLU A 1 136 ? 9.270 16.265 39.330 1.00 22.49 ? 136 GLU A N 1 ATOM 920 C CA . GLU A 1 136 ? 8.089 16.961 39.837 1.00 23.78 ? 136 GLU A CA 1 ATOM 921 C C . GLU A 1 136 ? 7.274 16.143 40.833 1.00 27.32 ? 136 GLU A C 1 ATOM 922 O O . GLU A 1 136 ? 6.615 16.733 41.698 1.00 36.87 ? 136 GLU A O 1 ATOM 923 C CB . GLU A 1 136 ? 7.231 17.450 38.660 1.00 20.29 ? 136 GLU A CB 1 ATOM 924 C CG . GLU A 1 136 ? 7.976 18.512 37.860 1.00 21.69 ? 136 GLU A CG 1 ATOM 925 C CD . GLU A 1 136 ? 8.475 19.704 38.650 1.00 19.91 ? 136 GLU A CD 1 ATOM 926 O OE1 . GLU A 1 136 ? 7.668 20.231 39.451 1.00 22.96 ? 136 GLU A OE1 1 ATOM 927 O OE2 . GLU A 1 136 ? 9.627 20.161 38.515 1.00 32.35 ? 136 GLU A OE2 1 ATOM 928 N N . ILE A 1 137 ? 7.279 14.831 40.724 1.00 23.62 ? 137 ILE A N 1 ATOM 929 C CA . ILE A 1 137 ? 6.303 14.030 41.483 1.00 27.14 ? 137 ILE A CA 1 ATOM 930 C C . ILE A 1 137 ? 6.937 13.418 42.734 1.00 30.62 ? 137 ILE A C 1 ATOM 931 O O . ILE A 1 137 ? 6.257 12.732 43.500 1.00 33.50 ? 137 ILE A O 1 ATOM 932 C CB . ILE A 1 137 ? 5.595 12.952 40.644 1.00 33.50 ? 137 ILE A CB 1 ATOM 933 C CG1 . ILE A 1 137 ? 6.486 11.986 39.867 1.00 37.10 ? 137 ILE A CG1 1 ATOM 934 C CG2 . ILE A 1 137 ? 4.621 13.558 39.628 1.00 44.68 ? 137 ILE A CG2 1 ATOM 935 C CD1 . ILE A 1 137 ? 6.700 10.645 40.524 1.00 32.27 ? 137 ILE A CD1 1 ATOM 936 N N . GLY A 1 138 ? 8.227 13.691 42.995 1.00 30.09 ? 138 GLY A N 1 ATOM 937 C CA . GLY A 1 138 ? 8.805 13.066 44.142 1.00 31.62 ? 138 GLY A CA 1 ATOM 938 C C . GLY A 1 138 ? 9.772 11.933 43.925 1.00 28.71 ? 138 GLY A C 1 ATOM 939 O O . GLY A 1 138 ? 10.060 11.210 44.893 1.00 29.48 ? 138 GLY A O 1 ATOM 940 N N . GLY A 1 139 ? 10.286 11.775 42.714 1.00 25.31 ? 139 GLY A N 1 ATOM 941 C CA . GLY A 1 139 ? 11.315 10.801 42.459 1.00 25.24 ? 139 GLY A CA 1 ATOM 942 C C . GLY A 1 139 ? 10.854 9.369 42.407 1.00 20.93 ? 139 GLY A C 1 ATOM 943 O O . GLY A 1 139 ? 9.672 9.084 42.521 1.00 23.50 ? 139 GLY A O 1 ATOM 944 N N . PRO A 1 140 ? 11.804 8.447 42.240 1.00 20.41 ? 140 PRO A N 1 ATOM 945 C CA . PRO A 1 140 ? 11.485 7.019 42.330 1.00 18.95 ? 140 PRO A CA 1 ATOM 946 C C . PRO A 1 140 ? 10.664 6.585 43.544 1.00 18.56 ? 140 PRO A C 1 ATOM 947 O O . PRO A 1 140 ? 9.788 5.723 43.382 1.00 21.49 ? 140 PRO A O 1 ATOM 948 C CB . PRO A 1 140 ? 12.909 6.412 42.325 1.00 21.15 ? 140 PRO A CB 1 ATOM 949 C CG . PRO A 1 140 ? 13.680 7.348 41.438 1.00 19.28 ? 140 PRO A CG 1 ATOM 950 C CD . PRO A 1 140 ? 13.207 8.710 41.879 1.00 20.93 ? 140 PRO A CD 1 ATOM 951 N N . ALA A 1 141 ? 10.895 7.117 44.720 1.00 20.56 ? 141 ALA A N 1 ATOM 952 C CA . ALA A 1 141 ? 10.105 6.779 45.893 1.00 22.63 ? 141 ALA A CA 1 ATOM 953 C C . ALA A 1 141 ? 8.605 7.035 45.707 1.00 18.86 ? 141 ALA A C 1 ATOM 954 O O . ALA A 1 141 ? 7.772 6.224 46.112 1.00 20.88 ? 141 ALA A O 1 ATOM 955 C CB . ALA A 1 141 ? 10.605 7.545 47.113 1.00 24.22 ? 141 ALA A CB 1 ATOM 956 N N . ALA A 1 142 ? 8.229 8.179 45.136 1.00 21.48 ? 142 ALA A N 1 ATOM 957 C CA . ALA A 1 142 ? 6.825 8.528 44.894 1.00 21.21 ? 142 ALA A CA 1 ATOM 958 C C . ALA A 1 142 ? 6.168 7.655 43.819 1.00 17.46 ? 142 ALA A C 1 ATOM 959 O O . ALA A 1 142 ? 4.996 7.288 43.909 1.00 20.53 ? 142 ALA A O 1 ATOM 960 C CB . ALA A 1 142 ? 6.685 9.987 44.475 1.00 27.84 ? 142 ALA A CB 1 ATOM 961 N N . MET A 1 143 ? 6.928 7.225 42.801 1.00 17.37 ? 143 MET A N 1 ATOM 962 C CA . MET A 1 143 ? 6.464 6.289 41.790 1.00 16.05 ? 143 MET A CA 1 ATOM 963 C C . MET A 1 143 ? 6.161 5.005 42.541 1.00 16.38 ? 143 MET A C 1 ATOM 964 O O . MET A 1 143 ? 5.083 4.473 42.355 1.00 14.53 ? 143 MET A O 1 ATOM 965 C CB . MET A 1 143 ? 7.518 6.105 40.712 1.00 16.74 ? 143 MET A CB 1 ATOM 966 C CG . MET A 1 143 ? 7.037 5.159 39.597 1.00 15.23 ? 143 MET A CG 1 ATOM 967 S SD . MET A 1 143 ? 5.760 5.832 38.533 1.00 17.55 ? 143 MET A SD 1 ATOM 968 C CE . MET A 1 143 ? 4.265 4.988 39.030 1.00 17.84 ? 143 MET A CE 1 ATOM 969 N N . THR A 1 144 ? 7.101 4.541 43.371 1.00 15.02 ? 144 THR A N 1 ATOM 970 C CA . THR A 1 144 ? 6.818 3.279 44.073 1.00 16.50 ? 144 THR A CA 1 ATOM 971 C C . THR A 1 144 ? 5.612 3.421 45.007 1.00 16.94 ? 144 THR A C 1 ATOM 972 O O . THR A 1 144 ? 4.776 2.501 45.095 1.00 17.86 ? 144 THR A O 1 ATOM 973 C CB . THR A 1 144 ? 8.094 2.823 44.804 1.00 16.53 ? 144 THR A CB 1 ATOM 974 O OG1 . THR A 1 144 ? 9.106 2.696 43.799 1.00 15.71 ? 144 THR A OG1 1 ATOM 975 C CG2 . THR A 1 144 ? 7.894 1.474 45.483 1.00 19.35 ? 144 THR A CG2 1 ATOM 976 N N . GLN A 1 145 ? 5.511 4.552 45.708 1.00 18.03 ? 145 GLN A N 1 ATOM 977 C CA . GLN A 1 145 ? 4.327 4.782 46.553 1.00 19.24 ? 145 GLN A CA 1 ATOM 978 C C . GLN A 1 145 ? 3.022 4.735 45.781 1.00 18.64 ? 145 GLN A C 1 ATOM 979 O O . GLN A 1 145 ? 1.973 4.259 46.264 1.00 18.96 ? 145 GLN A O 1 ATOM 980 C CB . GLN A 1 145 ? 4.515 6.111 47.310 1.00 28.13 ? 145 GLN A CB 1 ATOM 981 C CG A GLN A 1 145 ? 5.785 6.378 48.074 0.49 29.67 ? 145 GLN A CG 1 ATOM 982 C CG B GLN A 1 145 ? 5.070 5.780 48.700 0.51 29.17 ? 145 GLN A CG 1 ATOM 983 C CD A GLN A 1 145 ? 6.023 7.783 48.575 0.49 37.31 ? 145 GLN A CD 1 ATOM 984 C CD B GLN A 1 145 ? 3.994 5.107 49.536 0.51 31.13 ? 145 GLN A CD 1 ATOM 985 O OE1 A GLN A 1 145 ? 5.582 8.813 48.057 0.49 45.74 ? 145 GLN A OE1 1 ATOM 986 O OE1 B GLN A 1 145 ? 2.931 5.709 49.673 0.51 36.32 ? 145 GLN A OE1 1 ATOM 987 N NE2 A GLN A 1 145 ? 6.789 7.867 49.669 0.49 45.20 ? 145 GLN A NE2 1 ATOM 988 N NE2 B GLN A 1 145 ? 4.245 3.925 50.068 0.51 27.27 ? 145 GLN A NE2 1 ATOM 989 N N . TYR A 1 146 ? 2.959 5.233 44.546 1.00 17.42 ? 146 TYR A N 1 ATOM 990 C CA . TYR A 1 146 ? 1.752 5.150 43.730 1.00 17.06 ? 146 TYR A CA 1 ATOM 991 C C . TYR A 1 146 ? 1.440 3.703 43.417 1.00 16.12 ? 146 TYR A C 1 ATOM 992 O O . TYR A 1 146 ? 0.257 3.324 43.536 1.00 16.39 ? 146 TYR A O 1 ATOM 993 C CB . TYR A 1 146 ? 1.924 5.972 42.447 1.00 17.07 ? 146 TYR A CB 1 ATOM 994 C CG . TYR A 1 146 ? 0.675 5.901 41.568 1.00 17.30 ? 146 TYR A CG 1 ATOM 995 C CD1 . TYR A 1 146 ? 0.612 5.151 40.403 1.00 19.28 ? 146 TYR A CD1 1 ATOM 996 C CD2 . TYR A 1 146 ? -0.487 6.582 41.924 1.00 21.18 ? 146 TYR A CD2 1 ATOM 997 C CE1 . TYR A 1 146 ? -0.515 5.063 39.598 1.00 21.34 ? 146 TYR A CE1 1 ATOM 998 C CE2 . TYR A 1 146 ? -1.628 6.498 41.137 1.00 23.38 ? 146 TYR A CE2 1 ATOM 999 C CZ . TYR A 1 146 ? -1.650 5.755 39.979 1.00 24.16 ? 146 TYR A CZ 1 ATOM 1000 O OH . TYR A 1 146 ? -2.780 5.684 39.196 1.00 26.38 ? 146 TYR A OH 1 ATOM 1001 N N . PHE A 1 147 ? 2.443 2.916 43.065 1.00 16.04 ? 147 PHE A N 1 ATOM 1002 C CA . PHE A 1 147 ? 2.155 1.490 42.822 1.00 16.48 ? 147 PHE A CA 1 ATOM 1003 C C . PHE A 1 147 ? 1.482 0.871 44.064 1.00 15.58 ? 147 PHE A C 1 ATOM 1004 O O . PHE A 1 147 ? 0.496 0.139 43.988 1.00 18.07 ? 147 PHE A O 1 ATOM 1005 C CB . PHE A 1 147 ? 3.442 0.746 42.501 1.00 15.41 ? 147 PHE A CB 1 ATOM 1006 C CG . PHE A 1 147 ? 4.020 0.864 41.114 1.00 13.78 ? 147 PHE A CG 1 ATOM 1007 C CD1 . PHE A 1 147 ? 5.344 1.257 40.941 1.00 16.29 ? 147 PHE A CD1 1 ATOM 1008 C CD2 . PHE A 1 147 ? 3.271 0.559 40.005 1.00 14.38 ? 147 PHE A CD2 1 ATOM 1009 C CE1 . PHE A 1 147 ? 5.865 1.320 39.640 1.00 14.42 ? 147 PHE A CE1 1 ATOM 1010 C CE2 . PHE A 1 147 ? 3.779 0.649 38.744 1.00 14.18 ? 147 PHE A CE2 1 ATOM 1011 C CZ . PHE A 1 147 ? 5.083 1.038 38.537 1.00 14.28 ? 147 PHE A CZ 1 ATOM 1012 N N . ARG A 1 148 ? 2.044 1.180 45.243 1.00 18.27 ? 148 ARG A N 1 ATOM 1013 C CA . ARG A 1 148 ? 1.469 0.563 46.440 1.00 19.63 ? 148 ARG A CA 1 ATOM 1014 C C . ARG A 1 148 ? 0.051 1.039 46.717 1.00 20.59 ? 148 ARG A C 1 ATOM 1015 O O . ARG A 1 148 ? -0.800 0.256 47.129 1.00 21.54 ? 148 ARG A O 1 ATOM 1016 C CB . ARG A 1 148 ? 2.316 0.905 47.657 1.00 20.03 ? 148 ARG A CB 1 ATOM 1017 C CG . ARG A 1 148 ? 3.749 0.415 47.626 1.00 21.37 ? 148 ARG A CG 1 ATOM 1018 C CD . ARG A 1 148 ? 3.840 -1.107 47.608 1.00 24.61 ? 148 ARG A CD 1 ATOM 1019 N NE . ARG A 1 148 ? 5.254 -1.477 47.373 1.00 22.62 ? 148 ARG A NE 1 ATOM 1020 C CZ . ARG A 1 148 ? 5.811 -1.615 46.188 1.00 21.67 ? 148 ARG A CZ 1 ATOM 1021 N NH1 . ARG A 1 148 ? 5.140 -1.456 45.079 1.00 21.19 ? 148 ARG A NH1 1 ATOM 1022 N NH2 . ARG A 1 148 ? 7.090 -1.935 46.073 1.00 24.63 ? 148 ARG A NH2 1 ATOM 1023 N N . LYS A 1 149 ? -0.244 2.313 46.439 1.00 20.26 ? 149 LYS A N 1 ATOM 1024 C CA . LYS A 1 149 ? -1.553 2.910 46.639 1.00 21.98 ? 149 LYS A CA 1 ATOM 1025 C C . LYS A 1 149 ? -2.610 2.242 45.767 1.00 23.81 ? 149 LYS A C 1 ATOM 1026 O O . LYS A 1 149 ? -3.779 2.116 46.183 1.00 25.25 ? 149 LYS A O 1 ATOM 1027 C CB . LYS A 1 149 ? -1.424 4.414 46.364 1.00 26.34 ? 149 LYS A CB 1 ATOM 1028 C CG . LYS A 1 149 ? -2.655 5.269 46.598 1.00 30.12 ? 149 LYS A CG 1 ATOM 1029 C CD . LYS A 1 149 ? -2.611 6.568 45.819 1.00 38.10 ? 149 LYS A CD 1 ATOM 1030 C CE . LYS A 1 149 ? -3.882 7.393 45.951 1.00 44.01 ? 149 LYS A CE 1 ATOM 1031 N NZ . LYS A 1 149 ? -3.552 8.840 46.153 1.00 59.23 ? 149 LYS A NZ 1 ATOM 1032 N N . ILE A 1 150 ? -2.226 1.814 44.567 1.00 20.66 ? 150 ILE A N 1 ATOM 1033 C CA . ILE A 1 150 ? -3.233 1.186 43.703 1.00 20.04 ? 150 ILE A CA 1 ATOM 1034 C C . ILE A 1 150 ? -3.175 -0.337 43.790 1.00 22.23 ? 150 ILE A C 1 ATOM 1035 O O . ILE A 1 150 ? -3.638 -1.075 42.925 1.00 27.26 ? 150 ILE A O 1 ATOM 1036 C CB . ILE A 1 150 ? -3.147 1.675 42.261 1.00 20.08 ? 150 ILE A CB 1 ATOM 1037 C CG1 . ILE A 1 150 ? -1.877 1.267 41.528 1.00 21.96 ? 150 ILE A CG1 1 ATOM 1038 C CG2 . ILE A 1 150 ? -3.367 3.190 42.184 1.00 29.39 ? 150 ILE A CG2 1 ATOM 1039 C CD1 . ILE A 1 150 ? -1.894 1.564 40.049 1.00 24.94 ? 150 ILE A CD1 1 ATOM 1040 N N . GLY A 1 151 ? -2.635 -0.871 44.867 1.00 20.95 ? 151 GLY A N 1 ATOM 1041 C CA . GLY A 1 151 ? -2.690 -2.286 45.196 1.00 21.01 ? 151 GLY A CA 1 ATOM 1042 C C . GLY A 1 151 ? -1.581 -3.104 44.579 1.00 21.15 ? 151 GLY A C 1 ATOM 1043 O O . GLY A 1 151 ? -1.607 -4.330 44.639 1.00 24.47 ? 151 GLY A O 1 ATOM 1044 N N . ASP A 1 152 ? -0.576 -2.498 43.987 1.00 19.55 ? 152 ASP A N 1 ATOM 1045 C CA . ASP A 1 152 ? 0.563 -3.207 43.450 1.00 19.09 ? 152 ASP A CA 1 ATOM 1046 C C . ASP A 1 152 ? 1.713 -3.201 44.439 1.00 20.14 ? 152 ASP A C 1 ATOM 1047 O O . ASP A 1 152 ? 2.393 -2.182 44.616 1.00 19.16 ? 152 ASP A O 1 ATOM 1048 C CB . ASP A 1 152 ? 0.975 -2.604 42.101 1.00 17.93 ? 152 ASP A CB 1 ATOM 1049 C CG . ASP A 1 152 ? 2.175 -3.245 41.442 1.00 14.80 ? 152 ASP A CG 1 ATOM 1050 O OD1 . ASP A 1 152 ? 2.932 -4.041 42.050 1.00 16.45 ? 152 ASP A OD1 1 ATOM 1051 O OD2 . ASP A 1 152 ? 2.368 -2.914 40.211 1.00 16.68 ? 152 ASP A OD2 1 ATOM 1052 N N . SER A 1 153 ? 1.932 -4.341 45.087 1.00 22.18 ? 153 SER A N 1 ATOM 1053 C CA . SER A 1 153 ? 2.936 -4.470 46.123 1.00 24.29 ? 153 SER A CA 1 ATOM 1054 C C . SER A 1 153 ? 4.292 -4.879 45.600 1.00 21.17 ? 153 SER A C 1 ATOM 1055 O O . SER A 1 153 ? 5.262 -5.068 46.324 1.00 23.24 ? 153 SER A O 1 ATOM 1056 C CB . SER A 1 153 ? 2.502 -5.496 47.184 1.00 28.95 ? 153 SER A CB 1 ATOM 1057 O OG . SER A 1 153 ? 2.356 -6.786 46.583 1.00 32.62 ? 153 SER A OG 1 ATOM 1058 N N . VAL A 1 154 ? 4.408 -5.083 44.302 1.00 15.78 ? 154 VAL A N 1 ATOM 1059 C CA . VAL A 1 154 ? 5.568 -5.674 43.652 1.00 14.93 ? 154 VAL A CA 1 ATOM 1060 C C . VAL A 1 154 ? 6.434 -4.717 42.845 1.00 13.68 ? 154 VAL A C 1 ATOM 1061 O O . VAL A 1 154 ? 7.678 -4.736 42.985 1.00 15.26 ? 154 VAL A O 1 ATOM 1062 C CB . VAL A 1 154 ? 5.065 -6.839 42.753 1.00 14.02 ? 154 VAL A CB 1 ATOM 1063 C CG1 . VAL A 1 154 ? 6.200 -7.383 41.904 1.00 13.93 ? 154 VAL A CG1 1 ATOM 1064 C CG2 . VAL A 1 154 ? 4.441 -7.927 43.614 1.00 18.07 ? 154 VAL A CG2 1 ATOM 1065 N N . SER A 1 155 ? 5.811 -3.960 41.972 1.00 13.38 ? 155 SER A N 1 ATOM 1066 C CA . SER A 1 155 ? 6.539 -3.053 41.080 1.00 12.64 ? 155 SER A CA 1 ATOM 1067 C C . SER A 1 155 ? 7.327 -2.044 41.895 1.00 11.82 ? 155 SER A C 1 ATOM 1068 O O . SER A 1 155 ? 6.819 -1.490 42.891 1.00 13.72 ? 155 SER A O 1 ATOM 1069 C CB . SER A 1 155 ? 5.595 -2.296 40.168 1.00 12.76 ? 155 SER A CB 1 ATOM 1070 O OG . SER A 1 155 ? 4.686 -3.091 39.458 1.00 13.63 ? 155 SER A OG 1 ATOM 1071 N N . ARG A 1 156 ? 8.582 -1.768 41.482 1.00 11.79 ? 156 ARG A N 1 ATOM 1072 C CA . ARG A 1 156 ? 9.399 -0.816 42.247 1.00 12.36 ? 156 ARG A CA 1 ATOM 1073 C C . ARG A 1 156 ? 10.232 0.001 41.267 1.00 12.29 ? 156 ARG A C 1 ATOM 1074 O O . ARG A 1 156 ? 10.868 -0.518 40.387 1.00 14.02 ? 156 ARG A O 1 ATOM 1075 C CB . ARG A 1 156 ? 10.281 -1.518 43.264 1.00 12.23 ? 156 ARG A CB 1 ATOM 1076 C CG . ARG A 1 156 ? 11.078 -2.646 42.683 1.00 13.26 ? 156 ARG A CG 1 ATOM 1077 C CD . ARG A 1 156 ? 11.912 -3.353 43.734 1.00 13.46 ? 156 ARG A CD 1 ATOM 1078 N NE . ARG A 1 156 ? 13.028 -2.549 44.236 1.00 16.08 ? 156 ARG A NE 1 ATOM 1079 C CZ . ARG A 1 156 ? 13.908 -2.996 45.118 1.00 15.24 ? 156 ARG A CZ 1 ATOM 1080 N NH1 . ARG A 1 156 ? 13.822 -4.235 45.583 1.00 18.30 ? 156 ARG A NH1 1 ATOM 1081 N NH2 . ARG A 1 156 ? 14.883 -2.165 45.511 1.00 16.28 ? 156 ARG A NH2 1 ATOM 1082 N N . LEU A 1 157 ? 10.237 1.322 41.422 1.00 13.54 ? 157 LEU A N 1 ATOM 1083 C CA . LEU A 1 157 ? 11.150 2.201 40.730 1.00 13.77 ? 157 LEU A CA 1 ATOM 1084 C C . LEU A 1 157 ? 12.183 2.659 41.755 1.00 13.75 ? 157 LEU A C 1 ATOM 1085 O O . LEU A 1 157 ? 11.791 3.186 42.800 1.00 17.06 ? 157 LEU A O 1 ATOM 1086 C CB . LEU A 1 157 ? 10.479 3.413 40.072 1.00 14.01 ? 157 LEU A CB 1 ATOM 1087 C CG . LEU A 1 157 ? 11.399 4.201 39.140 1.00 15.44 ? 157 LEU A CG 1 ATOM 1088 C CD1 . LEU A 1 157 ? 11.712 3.406 37.899 1.00 16.43 ? 157 LEU A CD1 1 ATOM 1089 C CD2 . LEU A 1 157 ? 10.785 5.537 38.736 1.00 15.38 ? 157 LEU A CD2 1 ATOM 1090 N N . ASP A 1 158 ? 13.448 2.410 41.383 1.00 15.40 ? 158 ASP A N 1 ATOM 1091 C CA . ASP A 1 158 ? 14.578 2.764 42.264 1.00 15.10 ? 158 ASP A CA 1 ATOM 1092 C C . ASP A 1 158 ? 15.435 3.891 41.722 1.00 16.99 ? 158 ASP A C 1 ATOM 1093 O O . ASP A 1 158 ? 16.007 4.634 42.516 1.00 20.19 ? 158 ASP A O 1 ATOM 1094 C CB . ASP A 1 158 ? 15.446 1.527 42.524 1.00 15.36 ? 158 ASP A CB 1 ATOM 1095 C CG . ASP A 1 158 ? 14.672 0.486 43.273 1.00 15.79 ? 158 ASP A CG 1 ATOM 1096 O OD1 . ASP A 1 158 ? 14.730 0.497 44.536 1.00 21.16 ? 158 ASP A OD1 1 ATOM 1097 O OD2 . ASP A 1 158 ? 13.936 -0.330 42.694 1.00 15.13 ? 158 ASP A OD2 1 ATOM 1098 N N . ARG A 1 159 ? 15.492 4.027 40.398 1.00 15.61 ? 159 ARG A N 1 ATOM 1099 C CA . ARG A 1 159 ? 16.370 5.006 39.752 1.00 15.96 ? 159 ARG A CA 1 ATOM 1100 C C . ARG A 1 159 ? 15.678 5.766 38.643 1.00 13.61 ? 159 ARG A C 1 ATOM 1101 O O . ARG A 1 159 ? 14.671 5.301 38.115 1.00 16.42 ? 159 ARG A O 1 ATOM 1102 C CB . ARG A 1 159 ? 17.604 4.277 39.156 1.00 16.16 ? 159 ARG A CB 1 ATOM 1103 C CG . ARG A 1 159 ? 18.466 3.632 40.248 1.00 19.06 ? 159 ARG A CG 1 ATOM 1104 C CD . ARG A 1 159 ? 19.566 2.763 39.675 1.00 19.56 ? 159 ARG A CD 1 ATOM 1105 N NE . ARG A 1 159 ? 18.930 1.531 39.176 1.00 15.65 ? 159 ARG A NE 1 ATOM 1106 C CZ . ARG A 1 159 ? 19.601 0.549 38.600 1.00 17.53 ? 159 ARG A CZ 1 ATOM 1107 N NH1 . ARG A 1 159 ? 20.919 0.605 38.404 1.00 20.95 ? 159 ARG A NH1 1 ATOM 1108 N NH2 . ARG A 1 159 ? 18.905 -0.513 38.190 1.00 18.60 ? 159 ARG A NH2 1 ATOM 1109 N N . LYS A 1 160 ? 16.244 6.906 38.272 1.00 16.12 ? 160 LYS A N 1 ATOM 1110 C CA . LYS A 1 160 ? 15.792 7.636 37.086 1.00 13.97 ? 160 LYS A CA 1 ATOM 1111 C C . LYS A 1 160 ? 16.443 7.083 35.826 1.00 12.89 ? 160 LYS A C 1 ATOM 1112 O O . LYS A 1 160 ? 17.227 6.123 35.815 1.00 13.67 ? 160 LYS A O 1 ATOM 1113 C CB . LYS A 1 160 ? 16.055 9.115 37.325 1.00 15.58 ? 160 LYS A CB 1 ATOM 1114 C CG . LYS A 1 160 ? 17.542 9.432 37.329 1.00 18.72 ? 160 LYS A CG 1 ATOM 1115 C CD . LYS A 1 160 ? 17.779 10.927 37.415 1.00 24.58 ? 160 LYS A CD 1 ATOM 1116 C CE . LYS A 1 160 ? 19.204 11.059 37.936 1.00 27.34 ? 160 LYS A CE 1 ATOM 1117 N NZ . LYS A 1 160 ? 20.254 10.738 36.933 1.00 34.74 ? 160 LYS A NZ 1 ATOM 1118 N N . GLU A 1 161 ? 16.127 7.731 34.699 1.00 14.06 ? 161 GLU A N 1 ATOM 1119 C CA . GLU A 1 161 ? 16.679 7.311 33.419 1.00 13.52 ? 161 GLU A CA 1 ATOM 1120 C C . GLU A 1 161 ? 18.045 7.963 33.176 1.00 15.59 ? 161 GLU A C 1 ATOM 1121 O O . GLU A 1 161 ? 18.282 9.100 33.565 1.00 17.24 ? 161 GLU A O 1 ATOM 1122 C CB . GLU A 1 161 ? 15.766 7.696 32.248 1.00 17.15 ? 161 GLU A CB 1 ATOM 1123 C CG . GLU A 1 161 ? 14.389 7.054 32.257 1.00 18.94 ? 161 GLU A CG 1 ATOM 1124 C CD . GLU A 1 161 ? 14.454 5.620 31.749 1.00 19.21 ? 161 GLU A CD 1 ATOM 1125 O OE1 . GLU A 1 161 ? 13.404 4.983 31.455 1.00 25.12 ? 161 GLU A OE1 1 ATOM 1126 O OE2 . GLU A 1 161 ? 15.581 5.110 31.625 1.00 21.02 ? 161 GLU A OE2 1 ATOM 1127 N N . PRO A 1 162 ? 18.961 7.294 32.488 1.00 16.79 ? 162 PRO A N 1 ATOM 1128 C CA . PRO A 1 162 ? 18.773 5.964 31.960 1.00 15.94 ? 162 PRO A CA 1 ATOM 1129 C C . PRO A 1 162 ? 19.208 4.791 32.811 1.00 15.18 ? 162 PRO A C 1 ATOM 1130 O O . PRO A 1 162 ? 18.994 3.627 32.358 1.00 15.31 ? 162 PRO A O 1 ATOM 1131 C CB . PRO A 1 162 ? 19.757 6.001 30.759 1.00 20.76 ? 162 PRO A CB 1 ATOM 1132 C CG . PRO A 1 162 ? 20.873 6.887 31.247 1.00 23.68 ? 162 PRO A CG 1 ATOM 1133 C CD . PRO A 1 162 ? 20.239 7.926 32.145 1.00 22.75 ? 162 PRO A CD 1 ATOM 1134 N N . GLU A 1 163 ? 19.767 5.028 33.996 1.00 16.49 ? 163 GLU A N 1 ATOM 1135 C CA . GLU A 1 163 ? 20.334 3.957 34.826 1.00 16.69 ? 163 GLU A CA 1 ATOM 1136 C C . GLU A 1 163 ? 19.285 2.943 35.248 1.00 13.89 ? 163 GLU A C 1 ATOM 1137 O O . GLU A 1 163 ? 19.679 1.773 35.472 1.00 14.30 ? 163 GLU A O 1 ATOM 1138 C CB . GLU A 1 163 ? 21.058 4.467 36.080 1.00 26.50 ? 163 GLU A CB 1 ATOM 1139 C CG . GLU A 1 163 ? 21.859 5.696 36.245 1.00 34.81 ? 163 GLU A CG 1 ATOM 1140 C CD . GLU A 1 163 ? 21.014 6.956 36.192 1.00 34.79 ? 163 GLU A CD 1 ATOM 1141 O OE1 . GLU A 1 163 ? 20.837 7.310 35.023 1.00 29.30 ? 163 GLU A OE1 1 ATOM 1142 O OE2 . GLU A 1 163 ? 20.589 7.524 37.206 1.00 31.62 ? 163 GLU A OE2 1 ATOM 1143 N N . MET A 1 164 ? 18.022 3.345 35.354 1.00 14.50 ? 164 MET A N 1 ATOM 1144 C CA . MET A 1 164 ? 16.968 2.395 35.709 1.00 13.88 ? 164 MET A CA 1 ATOM 1145 C C . MET A 1 164 ? 16.938 1.225 34.732 1.00 13.47 ? 164 MET A C 1 ATOM 1146 O O . MET A 1 164 ? 16.419 0.161 35.101 1.00 14.83 ? 164 MET A O 1 ATOM 1147 C CB . MET A 1 164 ? 15.625 3.077 35.887 1.00 16.36 ? 164 MET A CB 1 ATOM 1148 C CG . MET A 1 164 ? 14.849 3.581 34.724 1.00 20.71 ? 164 MET A CG 1 ATOM 1149 S SD . MET A 1 164 ? 13.986 2.284 33.830 1.00 18.38 ? 164 MET A SD 1 ATOM 1150 C CE . MET A 1 164 ? 12.720 1.756 34.957 1.00 18.80 ? 164 MET A CE 1 ATOM 1151 N N . GLY A 1 165 ? 17.437 1.370 33.489 1.00 13.25 ? 165 GLY A N 1 ATOM 1152 C CA . GLY A 1 165 ? 17.385 0.316 32.479 1.00 14.88 ? 165 GLY A CA 1 ATOM 1153 C C . GLY A 1 165 ? 18.657 -0.523 32.376 1.00 13.76 ? 165 GLY A C 1 ATOM 1154 O O . GLY A 1 165 ? 18.811 -1.300 31.454 1.00 14.40 ? 165 GLY A O 1 ATOM 1155 N N . ASP A 1 166 ? 19.532 -0.406 33.380 1.00 14.20 ? 166 ASP A N 1 ATOM 1156 C CA . ASP A 1 166 ? 20.765 -1.196 33.346 1.00 15.13 ? 166 ASP A CA 1 ATOM 1157 C C . ASP A 1 166 ? 20.545 -2.692 33.290 1.00 13.87 ? 166 ASP A C 1 ATOM 1158 O O . ASP A 1 166 ? 21.331 -3.438 32.683 1.00 14.61 ? 166 ASP A O 1 ATOM 1159 C CB . ASP A 1 166 ? 21.608 -0.875 34.578 1.00 19.23 ? 166 ASP A CB 1 ATOM 1160 C CG . ASP A 1 166 ? 22.403 0.406 34.471 1.00 22.97 ? 166 ASP A CG 1 ATOM 1161 O OD1 . ASP A 1 166 ? 22.297 1.171 33.492 1.00 28.04 ? 166 ASP A OD1 1 ATOM 1162 O OD2 . ASP A 1 166 ? 23.179 0.660 35.424 1.00 36.93 ? 166 ASP A OD2 1 ATOM 1163 N N . ASN A 1 167 ? 19.499 -3.146 33.949 1.00 12.88 ? 167 ASN A N 1 ATOM 1164 C CA . ASN A 1 167 ? 19.152 -4.540 33.950 1.00 13.14 ? 167 ASN A CA 1 ATOM 1165 C C . ASN A 1 167 ? 20.302 -5.475 34.258 1.00 14.54 ? 167 ASN A C 1 ATOM 1166 O O . ASN A 1 167 ? 20.533 -6.487 33.585 1.00 16.51 ? 167 ASN A O 1 ATOM 1167 C CB . ASN A 1 167 ? 18.526 -4.918 32.592 1.00 13.74 ? 167 ASN A CB 1 ATOM 1168 C CG . ASN A 1 167 ? 17.850 -6.227 32.444 1.00 13.12 ? 167 ASN A CG 1 ATOM 1169 O OD1 . ASN A 1 167 ? 17.717 -6.821 31.344 1.00 16.22 ? 167 ASN A OD1 1 ATOM 1170 N ND2 . ASN A 1 167 ? 17.353 -6.781 33.566 1.00 13.41 ? 167 ASN A ND2 1 ATOM 1171 N N . THR A 1 168 ? 20.994 -5.159 35.363 1.00 14.85 ? 168 THR A N 1 ATOM 1172 C CA . THR A 1 168 ? 22.119 -6.025 35.705 1.00 15.89 ? 168 THR A CA 1 ATOM 1173 C C . THR A 1 168 ? 21.553 -7.370 36.180 1.00 16.71 ? 168 THR A C 1 ATOM 1174 O O . THR A 1 168 ? 20.582 -7.344 36.956 1.00 18.74 ? 168 THR A O 1 ATOM 1175 C CB . THR A 1 168 ? 22.937 -5.409 36.838 1.00 20.26 ? 168 THR A CB 1 ATOM 1176 O OG1 . THR A 1 168 ? 23.380 -4.114 36.403 1.00 21.78 ? 168 THR A OG1 1 ATOM 1177 C CG2 . THR A 1 168 ? 24.144 -6.285 37.142 1.00 29.22 ? 168 THR A CG2 1 ATOM 1178 N N . PRO A 1 169 ? 22.083 -8.490 35.724 1.00 21.54 ? 169 PRO A N 1 ATOM 1179 C CA . PRO A 1 169 ? 21.528 -9.797 36.091 1.00 25.59 ? 169 PRO A CA 1 ATOM 1180 C C . PRO A 1 169 ? 21.390 -9.905 37.612 1.00 26.00 ? 169 PRO A C 1 ATOM 1181 O O . PRO A 1 169 ? 22.336 -9.517 38.319 1.00 25.60 ? 169 PRO A O 1 ATOM 1182 C CB . PRO A 1 169 ? 22.585 -10.786 35.581 1.00 26.28 ? 169 PRO A CB 1 ATOM 1183 C CG . PRO A 1 169 ? 23.221 -10.051 34.440 1.00 25.82 ? 169 PRO A CG 1 ATOM 1184 C CD . PRO A 1 169 ? 23.262 -8.601 34.813 1.00 24.07 ? 169 PRO A CD 1 ATOM 1185 N N . GLY A 1 170 ? 20.235 -10.329 38.087 1.00 30.22 ? 170 GLY A N 1 ATOM 1186 C CA . GLY A 1 170 ? 20.043 -10.550 39.511 1.00 31.16 ? 170 GLY A CA 1 ATOM 1187 C C . GLY A 1 170 ? 19.559 -9.325 40.232 1.00 29.84 ? 170 GLY A C 1 ATOM 1188 O O . GLY A 1 170 ? 19.095 -9.446 41.365 1.00 35.26 ? 170 GLY A O 1 ATOM 1189 N N . ASP A 1 171 ? 19.634 -8.131 39.653 1.00 23.39 ? 171 ASP A N 1 ATOM 1190 C CA . ASP A 1 171 ? 19.261 -6.946 40.411 1.00 18.75 ? 171 ASP A CA 1 ATOM 1191 C C . ASP A 1 171 ? 17.762 -6.823 40.461 1.00 17.35 ? 171 ASP A C 1 ATOM 1192 O O . ASP A 1 171 ? 17.033 -6.874 39.489 1.00 19.11 ? 171 ASP A O 1 ATOM 1193 C CB . ASP A 1 171 ? 19.952 -5.760 39.750 1.00 20.65 ? 171 ASP A CB 1 ATOM 1194 C CG . ASP A 1 171 ? 19.892 -4.427 40.445 1.00 21.52 ? 171 ASP A CG 1 ATOM 1195 O OD1 . ASP A 1 171 ? 19.279 -4.340 41.524 1.00 19.73 ? 171 ASP A OD1 1 ATOM 1196 O OD2 . ASP A 1 171 ? 20.496 -3.475 39.888 1.00 22.46 ? 171 ASP A OD2 1 ATOM 1197 N N . LEU A 1 172 ? 17.261 -6.618 41.683 1.00 14.89 ? 172 LEU A N 1 ATOM 1198 C CA . LEU A 1 172 ? 15.800 -6.520 41.835 1.00 11.60 ? 172 LEU A CA 1 ATOM 1199 C C . LEU A 1 172 ? 15.329 -5.071 41.746 1.00 11.54 ? 172 LEU A C 1 ATOM 1200 O O . LEU A 1 172 ? 14.150 -4.800 41.732 1.00 11.32 ? 172 LEU A O 1 ATOM 1201 C CB . LEU A 1 172 ? 15.312 -7.177 43.128 1.00 13.34 ? 172 LEU A CB 1 ATOM 1202 C CG . LEU A 1 172 ? 15.495 -8.710 43.165 1.00 14.73 ? 172 LEU A CG 1 ATOM 1203 C CD1 . LEU A 1 172 ? 15.069 -9.221 44.533 1.00 15.10 ? 172 LEU A CD1 1 ATOM 1204 C CD2 . LEU A 1 172 ? 14.771 -9.428 42.038 1.00 16.69 ? 172 LEU A CD2 1 ATOM 1205 N N . ARG A 1 173 ? 16.259 -4.127 41.709 1.00 11.44 ? 173 ARG A N 1 ATOM 1206 C CA . ARG A 1 173 ? 15.873 -2.750 41.526 1.00 12.08 ? 173 ARG A CA 1 ATOM 1207 C C . ARG A 1 173 ? 15.141 -2.612 40.195 1.00 12.62 ? 173 ARG A C 1 ATOM 1208 O O . ARG A 1 173 ? 15.425 -3.255 39.210 1.00 12.15 ? 173 ARG A O 1 ATOM 1209 C CB . ARG A 1 173 ? 17.057 -1.790 41.540 1.00 13.74 ? 173 ARG A CB 1 ATOM 1210 C CG . ARG A 1 173 ? 17.708 -1.600 42.859 1.00 15.74 ? 173 ARG A CG 1 ATOM 1211 C CD . ARG A 1 173 ? 18.908 -0.715 42.771 1.00 17.85 ? 173 ARG A CD 1 ATOM 1212 N NE . ARG A 1 173 ? 19.971 -1.278 41.964 1.00 19.82 ? 173 ARG A NE 1 ATOM 1213 C CZ . ARG A 1 173 ? 21.127 -0.639 41.787 1.00 20.89 ? 173 ARG A CZ 1 ATOM 1214 N NH1 . ARG A 1 173 ? 21.340 0.545 42.336 1.00 23.13 ? 173 ARG A NH1 1 ATOM 1215 N NH2 . ARG A 1 173 ? 22.061 -1.212 41.046 1.00 24.37 ? 173 ARG A NH2 1 ATOM 1216 N N . ASP A 1 174 ? 14.164 -1.718 40.136 1.00 10.59 ? 174 ASP A N 1 ATOM 1217 C CA . ASP A 1 174 ? 13.500 -1.307 38.923 1.00 11.17 ? 174 ASP A CA 1 ATOM 1218 C C . ASP A 1 174 ? 12.828 -2.449 38.183 1.00 11.61 ? 174 ASP A C 1 ATOM 1219 O O . ASP A 1 174 ? 12.781 -2.520 36.949 1.00 11.74 ? 174 ASP A O 1 ATOM 1220 C CB . ASP A 1 174 ? 14.519 -0.599 38.020 1.00 13.09 ? 174 ASP A CB 1 ATOM 1221 C CG . ASP A 1 174 ? 15.121 0.594 38.732 1.00 13.38 ? 174 ASP A CG 1 ATOM 1222 O OD1 . ASP A 1 174 ? 14.368 1.547 39.043 1.00 14.30 ? 174 ASP A OD1 1 ATOM 1223 O OD2 . ASP A 1 174 ? 16.370 0.585 38.899 1.00 15.62 ? 174 ASP A OD2 1 ATOM 1224 N N . THR A 1 175 ? 12.256 -3.396 38.906 1.00 11.12 ? 175 THR A N 1 ATOM 1225 C CA . THR A 1 175 ? 11.559 -4.563 38.420 1.00 10.65 ? 175 THR A CA 1 ATOM 1226 C C . THR A 1 175 ? 10.069 -4.530 38.742 1.00 10.16 ? 175 THR A C 1 ATOM 1227 O O . THR A 1 175 ? 9.525 -3.827 39.599 1.00 11.39 ? 175 THR A O 1 ATOM 1228 C CB . THR A 1 175 ? 12.135 -5.866 38.999 1.00 12.23 ? 175 THR A CB 1 ATOM 1229 O OG1 . THR A 1 175 ? 12.083 -5.858 40.439 1.00 13.05 ? 175 THR A OG1 1 ATOM 1230 C CG2 . THR A 1 175 ? 13.578 -6.084 38.586 1.00 12.87 ? 175 THR A CG2 1 ATOM 1231 N N . THR A 1 176 ? 9.411 -5.436 37.964 1.00 10.19 ? 176 THR A N 1 ATOM 1232 C CA . THR A 1 176 ? 8.030 -5.780 38.193 1.00 9.79 ? 176 THR A CA 1 ATOM 1233 C C . THR A 1 176 ? 7.855 -7.270 37.877 1.00 9.44 ? 176 THR A C 1 ATOM 1234 O O . THR A 1 176 ? 8.858 -7.915 37.544 1.00 10.86 ? 176 THR A O 1 ATOM 1235 C CB . THR A 1 176 ? 7.059 -4.941 37.313 1.00 10.72 ? 176 THR A CB 1 ATOM 1236 O OG1 . THR A 1 176 ? 5.759 -5.264 37.696 1.00 11.62 ? 176 THR A OG1 1 ATOM 1237 C CG2 . THR A 1 176 ? 7.193 -5.277 35.847 1.00 11.43 ? 176 THR A CG2 1 ATOM 1238 N N . THR A 1 177 ? 6.650 -7.808 37.958 1.00 10.43 ? 177 THR A N 1 ATOM 1239 C CA . THR A 1 177 ? 6.327 -9.102 37.426 1.00 9.86 ? 177 THR A CA 1 ATOM 1240 C C . THR A 1 177 ? 5.214 -8.925 36.392 1.00 9.23 ? 177 THR A C 1 ATOM 1241 O O . THR A 1 177 ? 4.451 -7.951 36.451 1.00 9.79 ? 177 THR A O 1 ATOM 1242 C CB . THR A 1 177 ? 5.881 -10.130 38.469 1.00 10.12 ? 177 THR A CB 1 ATOM 1243 O OG1 . THR A 1 177 ? 4.711 -9.647 39.020 1.00 11.09 ? 177 THR A OG1 1 ATOM 1244 C CG2 . THR A 1 177 ? 6.888 -10.331 39.560 1.00 10.04 ? 177 THR A CG2 1 ATOM 1245 N N . PRO A 1 178 ? 5.107 -9.862 35.446 1.00 9.16 ? 178 PRO A N 1 ATOM 1246 C CA . PRO A 1 178 ? 4.013 -9.737 34.466 1.00 9.06 ? 178 PRO A CA 1 ATOM 1247 C C . PRO A 1 178 ? 2.653 -9.617 35.123 1.00 8.73 ? 178 PRO A C 1 ATOM 1248 O O . PRO A 1 178 ? 1.859 -8.786 34.714 1.00 9.39 ? 178 PRO A O 1 ATOM 1249 C CB . PRO A 1 178 ? 4.183 -11.008 33.624 1.00 9.22 ? 178 PRO A CB 1 ATOM 1250 C CG . PRO A 1 178 ? 5.663 -11.281 33.683 1.00 9.47 ? 178 PRO A CG 1 ATOM 1251 C CD . PRO A 1 178 ? 6.055 -10.908 35.083 1.00 9.04 ? 178 PRO A CD 1 ATOM 1252 N N . ILE A 1 179 ? 2.372 -10.430 36.147 1.00 9.66 ? 179 ILE A N 1 ATOM 1253 C CA . ILE A 1 179 ? 1.036 -10.396 36.745 1.00 9.73 ? 179 ILE A CA 1 ATOM 1254 C C . ILE A 1 179 ? 0.784 -9.097 37.482 1.00 9.44 ? 179 ILE A C 1 ATOM 1255 O O . ILE A 1 179 ? -0.292 -8.505 37.394 1.00 11.36 ? 179 ILE A O 1 ATOM 1256 C CB . ILE A 1 179 ? 0.740 -11.635 37.608 1.00 10.72 ? 179 ILE A CB 1 ATOM 1257 C CG1 . ILE A 1 179 ? -0.737 -11.644 38.035 1.00 13.28 ? 179 ILE A CG1 1 ATOM 1258 C CG2 . ILE A 1 179 ? 1.684 -11.754 38.765 1.00 12.65 ? 179 ILE A CG2 1 ATOM 1259 C CD1 . ILE A 1 179 ? -1.710 -11.741 36.888 1.00 14.66 ? 179 ILE A CD1 1 ATOM 1260 N N . ALA A 1 180 ? 1.677 -8.573 38.226 1.00 10.40 ? 180 ALA A N 1 ATOM 1261 C CA . ALA A 1 180 ? 1.608 -7.346 38.980 1.00 10.47 ? 180 ALA A CA 1 ATOM 1262 C C . ALA A 1 180 ? 1.371 -6.199 37.997 1.00 9.62 ? 180 ALA A C 1 ATOM 1263 O O . ALA A 1 180 ? 0.472 -5.377 38.180 1.00 11.63 ? 180 ALA A O 1 ATOM 1264 C CB . ALA A 1 180 ? 2.850 -7.026 39.780 1.00 12.45 ? 180 ALA A CB 1 ATOM 1265 N N . MET A 1 181 ? 2.176 -6.146 36.931 1.00 10.22 ? 181 MET A N 1 ATOM 1266 C CA . MET A 1 181 ? 2.027 -5.069 35.989 1.00 9.89 ? 181 MET A CA 1 ATOM 1267 C C . MET A 1 181 ? 0.718 -5.178 35.177 1.00 9.50 ? 181 MET A C 1 ATOM 1268 O O . MET A 1 181 ? 0.046 -4.168 34.944 1.00 10.87 ? 181 MET A O 1 ATOM 1269 C CB . MET A 1 181 ? 3.232 -4.927 35.051 1.00 9.88 ? 181 MET A CB 1 ATOM 1270 C CG . MET A 1 181 ? 3.180 -3.688 34.195 1.00 10.29 ? 181 MET A CG 1 ATOM 1271 S SD . MET A 1 181 ? 3.075 -2.123 35.098 1.00 11.64 ? 181 MET A SD 1 ATOM 1272 C CE . MET A 1 181 ? 4.788 -1.994 35.715 1.00 19.56 ? 181 MET A CE 1 ATOM 1273 N N . ALA A 1 182 ? 0.342 -6.401 34.774 1.00 10.58 ? 182 ALA A N 1 ATOM 1274 C CA . ALA A 1 182 ? -0.972 -6.530 34.096 1.00 9.33 ? 182 ALA A CA 1 ATOM 1275 C C . ALA A 1 182 ? -2.140 -6.060 34.954 1.00 9.86 ? 182 ALA A C 1 ATOM 1276 O O . ALA A 1 182 ? -3.063 -5.393 34.483 1.00 10.18 ? 182 ALA A O 1 ATOM 1277 C CB . ALA A 1 182 ? -1.220 -7.957 33.641 1.00 10.93 ? 182 ALA A CB 1 ATOM 1278 N N . ARG A 1 183 ? -2.072 -6.389 36.239 1.00 10.44 ? 183 ARG A N 1 ATOM 1279 C CA . ARG A 1 183 ? -3.091 -5.960 37.179 1.00 11.54 ? 183 ARG A CA 1 ATOM 1280 C C . ARG A 1 183 ? -3.081 -4.432 37.346 1.00 11.50 ? 183 ARG A C 1 ATOM 1281 O O . ARG A 1 183 ? -4.150 -3.855 37.471 1.00 12.33 ? 183 ARG A O 1 ATOM 1282 C CB . ARG A 1 183 ? -2.999 -6.727 38.501 1.00 13.15 ? 183 ARG A CB 1 ATOM 1283 C CG . ARG A 1 183 ? -3.606 -8.114 38.322 1.00 13.88 ? 183 ARG A CG 1 ATOM 1284 C CD . ARG A 1 183 ? -3.418 -9.008 39.525 1.00 17.25 ? 183 ARG A CD 1 ATOM 1285 N NE . ARG A 1 183 ? -4.247 -10.181 39.378 1.00 18.56 ? 183 ARG A NE 1 ATOM 1286 C CZ . ARG A 1 183 ? -4.113 -11.347 39.967 1.00 17.85 ? 183 ARG A CZ 1 ATOM 1287 N NH1 . ARG A 1 183 ? -3.119 -11.537 40.817 1.00 22.70 ? 183 ARG A NH1 1 ATOM 1288 N NH2 . ARG A 1 183 ? -4.990 -12.290 39.680 1.00 20.92 ? 183 ARG A NH2 1 ATOM 1289 N N . THR A 1 184 ? -1.896 -3.851 37.339 1.00 11.99 ? 184 THR A N 1 ATOM 1290 C CA . THR A 1 184 ? -1.783 -2.392 37.423 1.00 11.99 ? 184 THR A CA 1 ATOM 1291 C C . THR A 1 184 ? -2.400 -1.739 36.215 1.00 11.05 ? 184 THR A C 1 ATOM 1292 O O . THR A 1 184 ? -3.128 -0.744 36.313 1.00 11.62 ? 184 THR A O 1 ATOM 1293 C CB . THR A 1 184 ? -0.321 -1.971 37.651 1.00 12.59 ? 184 THR A CB 1 ATOM 1294 O OG1 . THR A 1 184 ? -0.029 -2.258 39.031 1.00 14.87 ? 184 THR A OG1 1 ATOM 1295 C CG2 . THR A 1 184 ? -0.056 -0.530 37.368 1.00 13.74 ? 184 THR A CG2 1 ATOM 1296 N N . VAL A 1 185 ? -2.077 -2.282 35.015 1.00 10.80 ? 185 VAL A N 1 ATOM 1297 C CA . VAL A 1 185 ? -2.720 -1.769 33.801 1.00 11.11 ? 185 VAL A CA 1 ATOM 1298 C C . VAL A 1 185 ? -4.223 -1.835 33.898 1.00 9.68 ? 185 VAL A C 1 ATOM 1299 O O . VAL A 1 185 ? -4.928 -0.869 33.584 1.00 11.41 ? 185 VAL A O 1 ATOM 1300 C CB . VAL A 1 185 ? -2.183 -2.514 32.566 1.00 10.87 ? 185 VAL A CB 1 ATOM 1301 C CG1 . VAL A 1 185 ? -3.003 -2.122 31.313 1.00 11.32 ? 185 VAL A CG1 1 ATOM 1302 C CG2 . VAL A 1 185 ? -0.704 -2.279 32.353 1.00 11.84 ? 185 VAL A CG2 1 ATOM 1303 N N . ALA A 1 186 ? -4.752 -2.994 34.338 1.00 11.03 ? 186 ALA A N 1 ATOM 1304 C CA . ALA A 1 186 ? -6.180 -3.104 34.401 1.00 11.26 ? 186 ALA A CA 1 ATOM 1305 C C . ALA A 1 186 ? -6.810 -2.110 35.389 1.00 11.87 ? 186 ALA A C 1 ATOM 1306 O O . ALA A 1 186 ? -7.881 -1.551 35.156 1.00 12.69 ? 186 ALA A O 1 ATOM 1307 C CB . ALA A 1 186 ? -6.624 -4.497 34.765 1.00 12.94 ? 186 ALA A CB 1 ATOM 1308 N N . LYS A 1 187 ? -6.155 -1.892 36.537 1.00 12.59 ? 187 LYS A N 1 ATOM 1309 C CA . LYS A 1 187 ? -6.665 -0.926 37.500 1.00 15.47 ? 187 LYS A CA 1 ATOM 1310 C C . LYS A 1 187 ? -6.764 0.479 36.905 1.00 14.58 ? 187 LYS A C 1 ATOM 1311 O O . LYS A 1 187 ? -7.707 1.241 37.094 1.00 14.82 ? 187 LYS A O 1 ATOM 1312 C CB A LYS A 1 187 ? -5.775 -0.914 38.738 0.50 19.05 ? 187 LYS A CB 1 ATOM 1313 C CB B LYS A 1 187 ? -5.771 -0.886 38.743 0.50 18.73 ? 187 LYS A CB 1 ATOM 1314 C CG A LYS A 1 187 ? -6.370 -1.801 39.824 0.50 22.25 ? 187 LYS A CG 1 ATOM 1315 C CG B LYS A 1 187 ? -5.827 -2.185 39.512 0.50 19.95 ? 187 LYS A CG 1 ATOM 1316 C CD A LYS A 1 187 ? -5.321 -1.986 40.894 0.50 24.38 ? 187 LYS A CD 1 ATOM 1317 C CD B LYS A 1 187 ? -4.878 -2.198 40.688 0.50 26.04 ? 187 LYS A CD 1 ATOM 1318 C CE A LYS A 1 187 ? -5.439 -3.295 41.640 0.50 26.25 ? 187 LYS A CE 1 ATOM 1319 C CE B LYS A 1 187 ? -3.892 -3.346 40.689 0.50 29.31 ? 187 LYS A CE 1 ATOM 1320 N NZ A LYS A 1 187 ? -4.155 -3.661 42.309 0.50 26.04 ? 187 LYS A NZ 1 ATOM 1321 N NZ B LYS A 1 187 ? -2.483 -2.908 40.920 0.50 21.32 ? 187 LYS A NZ 1 ATOM 1322 N N . VAL A 1 188 ? -5.707 0.846 36.195 1.00 13.57 ? 188 VAL A N 1 ATOM 1323 C CA . VAL A 1 188 ? -5.690 2.163 35.573 1.00 14.33 ? 188 VAL A CA 1 ATOM 1324 C C . VAL A 1 188 ? -6.666 2.351 34.427 1.00 13.78 ? 188 VAL A C 1 ATOM 1325 O O . VAL A 1 188 ? -7.263 3.418 34.353 1.00 15.85 ? 188 VAL A O 1 ATOM 1326 C CB . VAL A 1 188 ? -4.264 2.466 35.035 1.00 12.69 ? 188 VAL A CB 1 ATOM 1327 C CG1 . VAL A 1 188 ? -4.336 3.718 34.185 1.00 16.35 ? 188 VAL A CG1 1 ATOM 1328 C CG2 . VAL A 1 188 ? -3.319 2.542 36.209 1.00 15.83 ? 188 VAL A CG2 1 ATOM 1329 N N . LEU A 1 189 ? -6.832 1.333 33.605 1.00 13.08 ? 189 LEU A N 1 ATOM 1330 C CA . LEU A 1 189 ? -7.696 1.496 32.445 1.00 13.32 ? 189 LEU A CA 1 ATOM 1331 C C . LEU A 1 189 ? -9.142 1.132 32.689 1.00 13.64 ? 189 LEU A C 1 ATOM 1332 O O . LEU A 1 189 ? -10.031 1.648 32.088 1.00 17.24 ? 189 LEU A O 1 ATOM 1333 C CB . LEU A 1 189 ? -7.129 0.676 31.269 1.00 13.22 ? 189 LEU A CB 1 ATOM 1334 C CG . LEU A 1 189 ? -5.758 1.126 30.747 1.00 13.37 ? 189 LEU A CG 1 ATOM 1335 C CD1 . LEU A 1 189 ? -5.309 0.226 29.616 1.00 15.85 ? 189 LEU A CD1 1 ATOM 1336 C CD2 . LEU A 1 189 ? -5.777 2.600 30.330 1.00 20.34 ? 189 LEU A CD2 1 ATOM 1337 N N . TYR A 1 190 ? -9.339 0.138 33.570 1.00 13.72 ? 190 TYR A N 1 ATOM 1338 C CA . TYR A 1 190 ? -10.646 -0.436 33.772 1.00 14.23 ? 190 TYR A CA 1 ATOM 1339 C C . TYR A 1 190 ? -11.150 -0.418 35.221 1.00 15.57 ? 190 TYR A C 1 ATOM 1340 O O . TYR A 1 190 ? -12.353 -0.557 35.430 1.00 18.55 ? 190 TYR A O 1 ATOM 1341 C CB . TYR A 1 190 ? -10.620 -1.892 33.327 1.00 14.20 ? 190 TYR A CB 1 ATOM 1342 C CG . TYR A 1 190 ? -10.168 -2.203 31.915 1.00 14.53 ? 190 TYR A CG 1 ATOM 1343 C CD1 . TYR A 1 190 ? -9.087 -3.063 31.757 1.00 15.52 ? 190 TYR A CD1 1 ATOM 1344 C CD2 . TYR A 1 190 ? -10.821 -1.702 30.811 1.00 17.57 ? 190 TYR A CD2 1 ATOM 1345 C CE1 . TYR A 1 190 ? -8.625 -3.394 30.488 1.00 16.40 ? 190 TYR A CE1 1 ATOM 1346 C CE2 . TYR A 1 190 ? -10.354 -2.055 29.543 1.00 19.12 ? 190 TYR A CE2 1 ATOM 1347 C CZ . TYR A 1 190 ? -9.259 -2.892 29.375 1.00 17.34 ? 190 TYR A CZ 1 ATOM 1348 O OH . TYR A 1 190 ? -8.844 -3.235 28.116 1.00 19.73 ? 190 TYR A OH 1 ATOM 1349 N N . GLY A 1 191 ? -10.261 -0.232 36.189 1.00 16.47 ? 191 GLY A N 1 ATOM 1350 C CA . GLY A 1 191 ? -10.649 -0.356 37.561 1.00 16.33 ? 191 GLY A CA 1 ATOM 1351 C C . GLY A 1 191 ? -10.905 0.924 38.283 1.00 18.65 ? 191 GLY A C 1 ATOM 1352 O O . GLY A 1 191 ? -11.022 0.940 39.526 1.00 26.04 ? 191 GLY A O 1 ATOM 1353 N N . GLY A 1 192 ? -11.042 2.052 37.586 1.00 19.04 ? 192 GLY A N 1 ATOM 1354 C CA . GLY A 1 192 ? -11.523 3.283 38.235 1.00 20.41 ? 192 GLY A CA 1 ATOM 1355 C C . GLY A 1 192 ? -10.389 4.070 38.855 1.00 18.17 ? 192 GLY A C 1 ATOM 1356 O O . GLY A 1 192 ? -10.676 4.981 39.630 1.00 23.03 ? 192 GLY A O 1 ATOM 1357 N N . ALA A 1 193 ? -9.118 3.793 38.580 1.00 16.99 ? 193 ALA A N 1 ATOM 1358 C CA . ALA A 1 193 ? -8.073 4.571 39.206 1.00 16.26 ? 193 ALA A CA 1 ATOM 1359 C C . ALA A 1 193 ? -8.065 6.050 38.803 1.00 15.32 ? 193 ALA A C 1 ATOM 1360 O O . ALA A 1 193 ? -7.557 6.879 39.563 1.00 17.66 ? 193 ALA A O 1 ATOM 1361 C CB . ALA A 1 193 ? -6.689 4.020 38.859 1.00 16.41 ? 193 ALA A CB 1 ATOM 1362 N N . LEU A 1 194 ? -8.592 6.326 37.625 1.00 13.94 ? 194 LEU A N 1 ATOM 1363 C CA . LEU A 1 194 ? -8.564 7.663 37.046 1.00 12.62 ? 194 LEU A CA 1 ATOM 1364 C C . LEU A 1 194 ? -9.989 8.086 36.716 1.00 13.11 ? 194 LEU A C 1 ATOM 1365 O O . LEU A 1 194 ? -10.858 7.210 36.528 1.00 13.99 ? 194 LEU A O 1 ATOM 1366 C CB . LEU A 1 194 ? -7.667 7.725 35.815 1.00 12.60 ? 194 LEU A CB 1 ATOM 1367 C CG . LEU A 1 194 ? -6.163 7.413 35.994 1.00 12.96 ? 194 LEU A CG 1 ATOM 1368 C CD1 . LEU A 1 194 ? -5.511 7.438 34.621 1.00 12.81 ? 194 LEU A CD1 1 ATOM 1369 C CD2 . LEU A 1 194 ? -5.521 8.351 36.994 1.00 15.19 ? 194 LEU A CD2 1 ATOM 1370 N N . THR A 1 195 ? -10.241 9.359 36.587 1.00 13.60 ? 195 THR A N 1 ATOM 1371 C CA . THR A 1 195 ? -11.522 9.831 36.086 1.00 13.32 ? 195 THR A CA 1 ATOM 1372 C C . THR A 1 195 ? -11.768 9.267 34.705 1.00 12.96 ? 195 THR A C 1 ATOM 1373 O O . THR A 1 195 ? -10.858 8.896 33.976 1.00 11.99 ? 195 THR A O 1 ATOM 1374 C CB . THR A 1 195 ? -11.628 11.366 36.021 1.00 13.68 ? 195 THR A CB 1 ATOM 1375 O OG1 . THR A 1 195 ? -10.575 11.816 35.172 1.00 14.63 ? 195 THR A OG1 1 ATOM 1376 C CG2 . THR A 1 195 ? -11.413 12.005 37.382 1.00 16.92 ? 195 THR A CG2 1 ATOM 1377 N N . SER A 1 196 ? -13.001 9.288 34.271 1.00 14.92 ? 196 SER A N 1 ATOM 1378 C CA . SER A 1 196 ? -13.340 8.875 32.925 1.00 15.79 ? 196 SER A CA 1 ATOM 1379 C C . SER A 1 196 ? -12.567 9.666 31.890 1.00 13.92 ? 196 SER A C 1 ATOM 1380 O O . SER A 1 196 ? -12.060 9.090 30.926 1.00 13.84 ? 196 SER A O 1 ATOM 1381 C CB A SER A 1 196 ? -14.846 9.018 32.675 0.34 19.66 ? 196 SER A CB 1 ATOM 1382 C CB B SER A 1 196 ? -14.861 8.958 32.740 0.33 19.21 ? 196 SER A CB 1 ATOM 1383 C CB C SER A 1 196 ? -14.848 9.031 32.708 0.33 18.91 ? 196 SER A CB 1 ATOM 1384 O OG A SER A 1 196 ? -15.213 10.370 32.473 0.34 22.82 ? 196 SER A OG 1 ATOM 1385 O OG B SER A 1 196 ? -15.493 8.095 33.687 0.33 21.11 ? 196 SER A OG 1 ATOM 1386 O OG C SER A 1 196 ? -15.254 8.721 31.390 0.33 20.48 ? 196 SER A OG 1 ATOM 1387 N N . THR A 1 197 ? -12.484 10.983 32.045 1.00 14.32 ? 197 THR A N 1 ATOM 1388 C CA . THR A 1 197 ? -11.755 11.772 31.059 1.00 14.25 ? 197 THR A CA 1 ATOM 1389 C C . THR A 1 197 ? -10.271 11.413 31.018 1.00 13.03 ? 197 THR A C 1 ATOM 1390 O O . THR A 1 197 ? -9.648 11.275 29.957 1.00 13.72 ? 197 THR A O 1 ATOM 1391 C CB A THR A 1 197 ? -11.965 13.262 31.376 0.62 17.05 ? 197 THR A CB 1 ATOM 1392 C CB B THR A 1 197 ? -11.948 13.278 31.338 0.38 17.61 ? 197 THR A CB 1 ATOM 1393 O OG1 A THR A 1 197 ? -13.363 13.518 31.308 0.62 22.65 ? 197 THR A OG1 1 ATOM 1394 O OG1 B THR A 1 197 ? -11.457 13.666 32.635 0.38 20.10 ? 197 THR A OG1 1 ATOM 1395 C CG2 A THR A 1 197 ? -11.250 14.117 30.346 0.62 18.56 ? 197 THR A CG2 1 ATOM 1396 C CG2 B THR A 1 197 ? -13.429 13.628 31.346 0.38 19.92 ? 197 THR A CG2 1 ATOM 1397 N N . SER A 1 198 ? -9.640 11.299 32.186 1.00 11.95 ? 198 SER A N 1 ATOM 1398 C CA . SER A 1 198 ? -8.208 10.974 32.197 1.00 10.83 ? 198 SER A CA 1 ATOM 1399 C C . SER A 1 198 ? -7.947 9.549 31.683 1.00 9.53 ? 198 SER A C 1 ATOM 1400 O O . SER A 1 198 ? -6.942 9.312 30.996 1.00 10.06 ? 198 SER A O 1 ATOM 1401 C CB . SER A 1 198 ? -7.604 11.178 33.577 1.00 11.22 ? 198 SER A CB 1 ATOM 1402 O OG . SER A 1 198 ? -7.577 12.547 33.924 1.00 13.09 ? 198 SER A OG 1 ATOM 1403 N N . THR A 1 199 ? -8.844 8.650 32.001 1.00 11.07 ? 199 THR A N 1 ATOM 1404 C CA . THR A 1 199 ? -8.722 7.268 31.516 1.00 10.41 ? 199 THR A CA 1 ATOM 1405 C C . THR A 1 199 ? -8.768 7.229 29.986 1.00 12.48 ? 199 THR A C 1 ATOM 1406 O O . THR A 1 199 ? -7.957 6.578 29.321 1.00 10.86 ? 199 THR A O 1 ATOM 1407 C CB . THR A 1 199 ? -9.847 6.410 32.079 1.00 10.34 ? 199 THR A CB 1 ATOM 1408 O OG1 . THR A 1 199 ? -9.839 6.450 33.503 1.00 11.22 ? 199 THR A OG1 1 ATOM 1409 C CG2 . THR A 1 199 ? -9.711 4.941 31.661 1.00 11.79 ? 199 THR A CG2 1 ATOM 1410 N N . HIS A 1 200 ? -9.719 7.954 29.425 1.00 12.13 ? 200 HIS A N 1 ATOM 1411 C CA . HIS A 1 200 ? -9.840 8.012 27.980 1.00 12.27 ? 200 HIS A CA 1 ATOM 1412 C C . HIS A 1 200 ? -8.596 8.603 27.360 1.00 11.35 ? 200 HIS A C 1 ATOM 1413 O O . HIS A 1 200 ? -8.108 8.116 26.344 1.00 11.34 ? 200 HIS A O 1 ATOM 1414 C CB . HIS A 1 200 ? -11.089 8.819 27.618 1.00 13.93 ? 200 HIS A CB 1 ATOM 1415 C CG . HIS A 1 200 ? -11.348 8.732 26.148 1.00 19.03 ? 200 HIS A CG 1 ATOM 1416 N ND1 . HIS A 1 200 ? -11.754 7.581 25.499 1.00 28.86 ? 200 HIS A ND1 1 ATOM 1417 C CD2 . HIS A 1 200 ? -11.232 9.664 25.177 1.00 25.41 ? 200 HIS A CD2 1 ATOM 1418 C CE1 . HIS A 1 200 ? -11.885 7.824 24.206 1.00 32.56 ? 200 HIS A CE1 1 ATOM 1419 N NE2 . HIS A 1 200 ? -11.578 9.094 23.970 1.00 29.04 ? 200 HIS A NE2 1 ATOM 1420 N N . THR A 1 201 ? -8.067 9.691 27.922 1.00 10.40 ? 201 THR A N 1 ATOM 1421 C CA . THR A 1 201 ? -6.881 10.309 27.358 1.00 10.93 ? 201 THR A CA 1 ATOM 1422 C C . THR A 1 201 ? -5.711 9.359 27.356 1.00 9.57 ? 201 THR A C 1 ATOM 1423 O O . THR A 1 201 ? -5.024 9.235 26.335 1.00 10.56 ? 201 THR A O 1 ATOM 1424 C CB . THR A 1 201 ? -6.566 11.598 28.124 1.00 11.91 ? 201 THR A CB 1 ATOM 1425 O OG1 . THR A 1 201 ? -7.592 12.547 27.906 1.00 15.69 ? 201 THR A OG1 1 ATOM 1426 C CG2 . THR A 1 201 ? -5.260 12.182 27.598 1.00 13.64 ? 201 THR A CG2 1 ATOM 1427 N N . ILE A 1 202 ? -5.419 8.696 28.463 1.00 9.72 ? 202 ILE A N 1 ATOM 1428 C CA . ILE A 1 202 ? -4.276 7.803 28.501 1.00 9.91 ? 202 ILE A CA 1 ATOM 1429 C C . ILE A 1 202 ? -4.507 6.624 27.554 1.00 9.38 ? 202 ILE A C 1 ATOM 1430 O O . ILE A 1 202 ? -3.554 6.161 26.931 1.00 8.76 ? 202 ILE A O 1 ATOM 1431 C CB . ILE A 1 202 ? -3.940 7.390 29.957 1.00 11.04 ? 202 ILE A CB 1 ATOM 1432 C CG1 . ILE A 1 202 ? -2.456 7.074 30.080 1.00 13.73 ? 202 ILE A CG1 1 ATOM 1433 C CG2 . ILE A 1 202 ? -4.833 6.313 30.521 1.00 13.47 ? 202 ILE A CG2 1 ATOM 1434 C CD1 . ILE A 1 202 ? -1.958 6.861 31.504 1.00 14.66 ? 202 ILE A CD1 1 ATOM 1435 N N . GLU A 1 203 ? -5.727 6.132 27.436 1.00 9.22 ? 203 GLU A N 1 ATOM 1436 C CA . GLU A 1 203 ? -6.017 5.062 26.488 1.00 10.22 ? 203 GLU A CA 1 ATOM 1437 C C . GLU A 1 203 ? -5.658 5.490 25.052 1.00 8.77 ? 203 GLU A C 1 ATOM 1438 O O . GLU A 1 203 ? -5.027 4.767 24.297 1.00 9.54 ? 203 GLU A O 1 ATOM 1439 C CB . GLU A 1 203 ? -7.466 4.627 26.512 1.00 12.65 ? 203 GLU A CB 1 ATOM 1440 C CG A GLU A 1 203 ? -7.820 3.512 25.565 0.58 15.52 ? 203 GLU A CG 1 ATOM 1441 C CG B GLU A 1 203 ? -7.693 3.716 27.683 0.41 15.77 ? 203 GLU A CG 1 ATOM 1442 C CD A GLU A 1 203 ? -9.307 3.210 25.549 0.01 13.87 ? 203 GLU A CD 1 ATOM 1443 C CD B GLU A 1 203 ? -9.063 3.080 27.785 0.41 19.30 ? 203 GLU A CD 1 ATOM 1444 O OE1 A GLU A 1 203 ? -10.113 4.163 25.603 0.01 14.00 ? 203 GLU A OE1 1 ATOM 1445 O OE1 B GLU A 1 203 ? -9.843 3.376 26.859 0.41 24.76 ? 203 GLU A OE1 1 ATOM 1446 O OE2 A GLU A 1 203 ? -9.679 2.020 25.485 0.01 14.30 ? 203 GLU A OE2 1 ATOM 1447 O OE2 B GLU A 1 203 ? -9.238 2.317 28.759 0.41 21.89 ? 203 GLU A OE2 1 ATOM 1448 N N . ARG A 1 204 ? -6.070 6.706 24.661 1.00 8.79 ? 204 ARG A N 1 ATOM 1449 C CA . ARG A 1 204 ? -5.767 7.196 23.320 1.00 8.53 ? 204 ARG A CA 1 ATOM 1450 C C . ARG A 1 204 ? -4.272 7.347 23.139 1.00 7.99 ? 204 ARG A C 1 ATOM 1451 O O . ARG A 1 204 ? -3.737 7.073 22.061 1.00 7.98 ? 204 ARG A O 1 ATOM 1452 C CB . ARG A 1 204 ? -6.507 8.496 23.009 1.00 9.03 ? 204 ARG A CB 1 ATOM 1453 C CG . ARG A 1 204 ? -8.009 8.441 23.090 1.00 10.11 ? 204 ARG A CG 1 ATOM 1454 C CD . ARG A 1 204 ? -8.602 7.578 21.998 1.00 10.10 ? 204 ARG A CD 1 ATOM 1455 N NE . ARG A 1 204 ? -8.497 8.179 20.704 1.00 9.06 ? 204 ARG A NE 1 ATOM 1456 C CZ . ARG A 1 204 ? -8.863 7.598 19.570 1.00 9.15 ? 204 ARG A CZ 1 ATOM 1457 N NH1 . ARG A 1 204 ? -9.382 6.374 19.590 1.00 9.83 ? 204 ARG A NH1 1 ATOM 1458 N NH2 . ARG A 1 204 ? -8.740 8.245 18.418 1.00 9.91 ? 204 ARG A NH2 1 ATOM 1459 N N . TRP A 1 205 ? -3.554 7.809 24.185 1.00 8.35 ? 205 TRP A N 1 ATOM 1460 C CA . TRP A 1 205 ? -2.116 7.923 24.073 1.00 7.76 ? 205 TRP A CA 1 ATOM 1461 C C . TRP A 1 205 ? -1.487 6.549 23.786 1.00 7.74 ? 205 TRP A C 1 ATOM 1462 O O . TRP A 1 205 ? -0.557 6.456 22.982 1.00 8.83 ? 205 TRP A O 1 ATOM 1463 C CB . TRP A 1 205 ? -1.502 8.521 25.336 1.00 8.74 ? 205 TRP A CB 1 ATOM 1464 C CG . TRP A 1 205 ? -1.733 9.969 25.538 1.00 9.70 ? 205 TRP A CG 1 ATOM 1465 C CD1 . TRP A 1 205 ? -2.432 10.834 24.767 1.00 11.95 ? 205 TRP A CD1 1 ATOM 1466 C CD2 . TRP A 1 205 ? -1.208 10.720 26.647 1.00 8.86 ? 205 TRP A CD2 1 ATOM 1467 N NE1 . TRP A 1 205 ? -2.367 12.087 25.382 1.00 11.06 ? 205 TRP A NE1 1 ATOM 1468 C CE2 . TRP A 1 205 ? -1.632 12.050 26.520 1.00 9.73 ? 205 TRP A CE2 1 ATOM 1469 C CE3 . TRP A 1 205 ? -0.421 10.357 27.777 1.00 9.36 ? 205 TRP A CE3 1 ATOM 1470 C CZ2 . TRP A 1 205 ? -1.304 13.035 27.439 1.00 10.66 ? 205 TRP A CZ2 1 ATOM 1471 C CZ3 . TRP A 1 205 ? -0.109 11.375 28.659 1.00 11.14 ? 205 TRP A CZ3 1 ATOM 1472 C CH2 . TRP A 1 205 ? -0.529 12.690 28.507 1.00 11.57 ? 205 TRP A CH2 1 ATOM 1473 N N . LEU A 1 206 ? -1.960 5.521 24.462 1.00 7.87 ? 206 LEU A N 1 ATOM 1474 C CA . LEU A 1 206 ? -1.441 4.186 24.229 1.00 7.97 ? 206 LEU A CA 1 ATOM 1475 C C . LEU A 1 206 ? -1.715 3.683 22.820 1.00 7.98 ? 206 LEU A C 1 ATOM 1476 O O . LEU A 1 206 ? -0.890 3.045 22.209 1.00 7.76 ? 206 LEU A O 1 ATOM 1477 C CB . LEU A 1 206 ? -2.012 3.209 25.274 1.00 8.07 ? 206 LEU A CB 1 ATOM 1478 C CG . LEU A 1 206 ? -1.487 3.399 26.717 1.00 9.98 ? 206 LEU A CG 1 ATOM 1479 C CD1 . LEU A 1 206 ? -2.385 2.626 27.664 1.00 16.17 ? 206 LEU A CD1 1 ATOM 1480 C CD2 . LEU A 1 206 ? -0.022 3.043 26.834 1.00 10.60 ? 206 LEU A CD2 1 ATOM 1481 N N . ILE A 1 207 ? -2.948 3.950 22.352 1.00 7.75 ? 207 ILE A N 1 ATOM 1482 C CA . ILE A 1 207 ? -3.274 3.549 20.989 1.00 7.39 ? 207 ILE A CA 1 ATOM 1483 C C . ILE A 1 207 ? -2.325 4.217 20.002 1.00 7.70 ? 207 ILE A C 1 ATOM 1484 O O . ILE A 1 207 ? -1.863 3.624 19.052 1.00 8.48 ? 207 ILE A O 1 ATOM 1485 C CB . ILE A 1 207 ? -4.729 3.834 20.636 1.00 8.15 ? 207 ILE A CB 1 ATOM 1486 C CG1 . ILE A 1 207 ? -5.664 2.979 21.523 1.00 8.50 ? 207 ILE A CG1 1 ATOM 1487 C CG2 . ILE A 1 207 ? -4.987 3.604 19.164 1.00 9.26 ? 207 ILE A CG2 1 ATOM 1488 C CD1 . ILE A 1 207 ? -7.098 3.407 21.504 1.00 10.45 ? 207 ILE A CD1 1 ATOM 1489 N N . GLY A 1 208 ? -2.090 5.523 20.213 1.00 7.56 ? 208 GLY A N 1 ATOM 1490 C CA . GLY A 1 208 ? -1.268 6.311 19.339 1.00 8.22 ? 208 GLY A CA 1 ATOM 1491 C C . GLY A 1 208 ? 0.222 6.252 19.611 1.00 8.45 ? 208 GLY A C 1 ATOM 1492 O O . GLY A 1 208 ? 1.001 6.987 18.988 1.00 9.23 ? 208 GLY A O 1 ATOM 1493 N N . ASN A 1 209 ? 0.698 5.362 20.461 1.00 8.34 ? 209 ASN A N 1 ATOM 1494 C CA . ASN A 1 209 ? 2.079 5.176 20.771 1.00 8.70 ? 209 ASN A CA 1 ATOM 1495 C C . ASN A 1 209 ? 2.881 5.057 19.460 1.00 7.45 ? 209 ASN A C 1 ATOM 1496 O O . ASN A 1 209 ? 2.428 4.377 18.540 1.00 8.63 ? 209 ASN A O 1 ATOM 1497 C CB . ASN A 1 209 ? 2.303 3.908 21.606 1.00 12.23 ? 209 ASN A CB 1 ATOM 1498 C CG . ASN A 1 209 ? 3.737 3.562 21.798 1.00 13.31 ? 209 ASN A CG 1 ATOM 1499 O OD1 . ASN A 1 209 ? 4.535 4.497 21.999 1.00 13.00 ? 209 ASN A OD1 1 ATOM 1500 N ND2 . ASN A 1 209 ? 4.146 2.319 21.762 1.00 12.71 ? 209 ASN A ND2 1 ATOM 1501 N N . GLN A 1 210 ? 4.024 5.703 19.356 1.00 7.93 ? 210 GLN A N 1 ATOM 1502 C CA . GLN A 1 210 ? 4.793 5.677 18.125 1.00 8.46 ? 210 GLN A CA 1 ATOM 1503 C C . GLN A 1 210 ? 5.874 4.623 18.143 1.00 8.47 ? 210 GLN A C 1 ATOM 1504 O O . GLN A 1 210 ? 6.550 4.476 17.112 1.00 11.35 ? 210 GLN A O 1 ATOM 1505 C CB . GLN A 1 210 ? 5.411 7.034 17.893 1.00 8.70 ? 210 GLN A CB 1 ATOM 1506 C CG . GLN A 1 210 ? 4.371 8.094 17.775 1.00 9.77 ? 210 GLN A CG 1 ATOM 1507 C CD . GLN A 1 210 ? 5.018 9.453 17.438 1.00 11.96 ? 210 GLN A CD 1 ATOM 1508 O OE1 . GLN A 1 210 ? 5.850 9.526 16.537 1.00 13.43 ? 210 GLN A OE1 1 ATOM 1509 N NE2 . GLN A 1 210 ? 4.465 10.365 18.209 1.00 25.09 ? 210 GLN A NE2 1 ATOM 1510 N N . THR A 1 211 ? 6.104 3.891 19.228 1.00 8.85 ? 211 THR A N 1 ATOM 1511 C CA . THR A 1 211 ? 7.254 3.009 19.312 1.00 9.30 ? 211 THR A CA 1 ATOM 1512 C C . THR A 1 211 ? 6.926 1.536 19.222 1.00 9.05 ? 211 THR A C 1 ATOM 1513 O O . THR A 1 211 ? 7.865 0.721 19.303 1.00 11.62 ? 211 THR A O 1 ATOM 1514 C CB . THR A 1 211 ? 8.043 3.247 20.631 1.00 9.89 ? 211 THR A CB 1 ATOM 1515 O OG1 . THR A 1 211 ? 7.208 2.860 21.719 1.00 11.38 ? 211 THR A OG1 1 ATOM 1516 C CG2 . THR A 1 211 ? 8.395 4.717 20.791 1.00 12.50 ? 211 THR A CG2 1 ATOM 1517 N N . GLY A 1 212 ? 5.672 1.139 19.109 1.00 9.41 ? 212 GLY A N 1 ATOM 1518 C CA . GLY A 1 212 ? 5.283 -0.233 19.218 1.00 9.87 ? 212 GLY A CA 1 ATOM 1519 C C . GLY A 1 212 ? 4.866 -0.914 17.937 1.00 8.90 ? 212 GLY A C 1 ATOM 1520 O O . GLY A 1 212 ? 4.293 -1.992 17.984 1.00 11.01 ? 212 GLY A O 1 ATOM 1521 N N . ASP A 1 213 ? 5.129 -0.341 16.755 1.00 9.89 ? 213 ASP A N 1 ATOM 1522 C CA . ASP A 1 213 ? 4.563 -0.898 15.549 1.00 10.99 ? 213 ASP A CA 1 ATOM 1523 C C . ASP A 1 213 ? 5.087 -2.275 15.213 1.00 11.70 ? 213 ASP A C 1 ATOM 1524 O O . ASP A 1 213 ? 4.444 -3.024 14.494 1.00 13.02 ? 213 ASP A O 1 ATOM 1525 C CB . ASP A 1 213 ? 4.862 0.034 14.371 1.00 13.36 ? 213 ASP A CB 1 ATOM 1526 C CG . ASP A 1 213 ? 4.045 1.323 14.419 1.00 17.24 ? 213 ASP A CG 1 ATOM 1527 O OD1 . ASP A 1 213 ? 4.301 2.176 13.513 1.00 23.66 ? 213 ASP A OD1 1 ATOM 1528 O OD2 . ASP A 1 213 ? 3.118 1.556 15.242 1.00 14.83 ? 213 ASP A OD2 1 ATOM 1529 N N . ALA A 1 214 ? 6.249 -2.644 15.717 1.00 11.65 ? 214 ALA A N 1 ATOM 1530 C CA . ALA A 1 214 ? 6.856 -3.930 15.405 1.00 12.04 ? 214 ALA A CA 1 ATOM 1531 C C . ALA A 1 214 ? 6.779 -4.949 16.534 1.00 10.13 ? 214 ALA A C 1 ATOM 1532 O O . ALA A 1 214 ? 7.364 -6.027 16.407 1.00 14.00 ? 214 ALA A O 1 ATOM 1533 C CB . ALA A 1 214 ? 8.308 -3.728 15.060 1.00 13.24 ? 214 ALA A CB 1 ATOM 1534 N N . THR A 1 215 ? 6.200 -4.564 17.658 1.00 12.00 ? 215 THR A N 1 ATOM 1535 C CA . THR A 1 215 ? 6.182 -5.456 18.844 1.00 12.66 ? 215 THR A CA 1 ATOM 1536 C C . THR A 1 215 ? 4.807 -6.063 18.995 1.00 11.86 ? 215 THR A C 1 ATOM 1537 O O . THR A 1 215 ? 4.306 -6.639 18.019 1.00 12.02 ? 215 THR A O 1 ATOM 1538 C CB . THR A 1 215 ? 6.749 -4.734 20.080 1.00 15.36 ? 215 THR A CB 1 ATOM 1539 O OG1 . THR A 1 215 ? 6.118 -3.450 20.204 1.00 14.72 ? 215 THR A OG1 1 ATOM 1540 C CG2 . THR A 1 215 ? 8.231 -4.466 19.889 1.00 20.09 ? 215 THR A CG2 1 ATOM 1541 N N . LEU A 1 216 ? 4.188 -6.052 20.179 1.00 12.55 ? 216 LEU A N 1 ATOM 1542 C CA . LEU A 1 216 ? 2.963 -6.834 20.362 1.00 14.73 ? 216 LEU A CA 1 ATOM 1543 C C . LEU A 1 216 ? 1.871 -6.550 19.345 1.00 13.80 ? 216 LEU A C 1 ATOM 1544 O O . LEU A 1 216 ? 1.254 -7.477 18.798 1.00 15.94 ? 216 LEU A O 1 ATOM 1545 C CB . LEU A 1 216 ? 2.318 -6.557 21.704 1.00 17.42 ? 216 LEU A CB 1 ATOM 1546 C CG . LEU A 1 216 ? 2.737 -7.386 22.829 1.00 19.81 ? 216 LEU A CG 1 ATOM 1547 C CD1 . LEU A 1 216 ? 1.851 -6.980 24.017 1.00 16.18 ? 216 LEU A CD1 1 ATOM 1548 C CD2 . LEU A 1 216 ? 2.611 -8.886 22.641 1.00 15.15 ? 216 LEU A CD2 1 ATOM 1549 N N . ARG A 1 217 ? 1.623 -5.286 19.067 1.00 12.70 ? 217 ARG A N 1 ATOM 1550 C CA . ARG A 1 217 ? 0.471 -5.031 18.206 1.00 14.92 ? 217 ARG A CA 1 ATOM 1551 C C . ARG A 1 217 ? 0.715 -5.567 16.804 1.00 12.68 ? 217 ARG A C 1 ATOM 1552 O O . ARG A 1 217 ? -0.211 -5.781 16.088 1.00 17.07 ? 217 ARG A O 1 ATOM 1553 C CB . ARG A 1 217 ? 0.085 -3.551 18.197 1.00 14.88 ? 217 ARG A CB 1 ATOM 1554 C CG . ARG A 1 217 ? 1.071 -2.659 17.525 1.00 13.52 ? 217 ARG A CG 1 ATOM 1555 C CD . ARG A 1 217 ? 1.026 -1.231 18.067 1.00 15.00 ? 217 ARG A CD 1 ATOM 1556 N NE . ARG A 1 217 ? -0.203 -0.581 17.710 1.00 20.59 ? 217 ARG A NE 1 ATOM 1557 C CZ . ARG A 1 217 ? -0.713 0.498 18.343 1.00 15.88 ? 217 ARG A CZ 1 ATOM 1558 N NH1 . ARG A 1 217 ? -1.840 0.987 17.856 1.00 13.95 ? 217 ARG A NH1 1 ATOM 1559 N NH2 . ARG A 1 217 ? -0.167 1.052 19.417 1.00 17.98 ? 217 ARG A NH2 1 ATOM 1560 N N . ALA A 1 218 ? 1.959 -5.773 16.371 1.00 11.18 ? 218 ALA A N 1 ATOM 1561 C CA . ALA A 1 218 ? 2.224 -6.403 15.094 1.00 11.59 ? 218 ALA A CA 1 ATOM 1562 C C . ALA A 1 218 ? 1.766 -7.844 15.044 1.00 11.64 ? 218 ALA A C 1 ATOM 1563 O O . ALA A 1 218 ? 1.606 -8.413 13.976 1.00 15.96 ? 218 ALA A O 1 ATOM 1564 C CB . ALA A 1 218 ? 3.717 -6.354 14.808 1.00 12.51 ? 218 ALA A CB 1 ATOM 1565 N N . GLY A 1 219 ? 1.594 -8.480 16.202 1.00 11.01 ? 219 GLY A N 1 ATOM 1566 C CA . GLY A 1 219 ? 1.108 -9.831 16.283 1.00 10.34 ? 219 GLY A CA 1 ATOM 1567 C C . GLY A 1 219 ? -0.351 -9.984 16.630 1.00 10.91 ? 219 GLY A C 1 ATOM 1568 O O . GLY A 1 219 ? -0.761 -11.154 16.790 1.00 12.20 ? 219 GLY A O 1 ATOM 1569 N N . PHE A 1 220 ? -1.114 -8.913 16.758 1.00 10.79 ? 220 PHE A N 1 ATOM 1570 C CA . PHE A 1 220 ? -2.538 -9.007 17.026 1.00 10.37 ? 220 PHE A CA 1 ATOM 1571 C C . PHE A 1 220 ? -3.363 -8.788 15.758 1.00 10.55 ? 220 PHE A C 1 ATOM 1572 O O . PHE A 1 220 ? -2.935 -8.066 14.832 1.00 12.94 ? 220 PHE A O 1 ATOM 1573 C CB . PHE A 1 220 ? -2.938 -7.958 18.052 1.00 10.91 ? 220 PHE A CB 1 ATOM 1574 C CG . PHE A 1 220 ? -2.488 -8.162 19.475 1.00 11.56 ? 220 PHE A CG 1 ATOM 1575 C CD1 . PHE A 1 220 ? -2.334 -7.091 20.339 1.00 15.30 ? 220 PHE A CD1 1 ATOM 1576 C CD2 . PHE A 1 220 ? -2.213 -9.377 20.025 1.00 16.24 ? 220 PHE A CD2 1 ATOM 1577 C CE1 . PHE A 1 220 ? -1.925 -7.252 21.649 1.00 15.64 ? 220 PHE A CE1 1 ATOM 1578 C CE2 . PHE A 1 220 ? -1.825 -9.588 21.336 1.00 13.50 ? 220 PHE A CE2 1 ATOM 1579 C CZ . PHE A 1 220 ? -1.712 -8.521 22.156 1.00 12.65 ? 220 PHE A CZ 1 ATOM 1580 N N . PRO A 1 221 ? -4.563 -9.336 15.714 1.00 10.51 ? 221 PRO A N 1 ATOM 1581 C CA . PRO A 1 221 ? -5.494 -9.046 14.575 1.00 10.01 ? 221 PRO A CA 1 ATOM 1582 C C . PRO A 1 221 ? -5.700 -7.545 14.393 1.00 10.58 ? 221 PRO A C 1 ATOM 1583 O O . PRO A 1 221 ? -5.775 -6.788 15.353 1.00 11.07 ? 221 PRO A O 1 ATOM 1584 C CB . PRO A 1 221 ? -6.768 -9.748 14.961 1.00 11.56 ? 221 PRO A CB 1 ATOM 1585 C CG . PRO A 1 221 ? -6.310 -10.854 15.865 1.00 11.36 ? 221 PRO A CG 1 ATOM 1586 C CD . PRO A 1 221 ? -5.194 -10.248 16.673 1.00 10.41 ? 221 PRO A CD 1 ATOM 1587 N N . LYS A 1 222 ? -5.850 -7.138 13.115 1.00 11.66 ? 222 LYS A N 1 ATOM 1588 C CA . LYS A 1 222 ? -5.873 -5.706 12.837 1.00 10.51 ? 222 LYS A CA 1 ATOM 1589 C C . LYS A 1 222 ? -7.153 -5.047 13.215 1.00 10.66 ? 222 LYS A C 1 ATOM 1590 O O . LYS A 1 222 ? -7.182 -3.792 13.160 1.00 15.54 ? 222 LYS A O 1 ATOM 1591 C CB . LYS A 1 222 ? -5.497 -5.518 11.342 1.00 15.30 ? 222 LYS A CB 1 ATOM 1592 C CG A LYS A 1 222 ? -4.178 -6.159 10.975 0.59 20.67 ? 222 LYS A CG 1 ATOM 1593 C CG B LYS A 1 222 ? -4.020 -5.766 11.069 0.41 16.96 ? 222 LYS A CG 1 ATOM 1594 C CD A LYS A 1 222 ? -3.216 -5.207 10.313 0.59 22.24 ? 222 LYS A CD 1 ATOM 1595 C CD B LYS A 1 222 ? -3.016 -4.937 11.826 0.41 19.23 ? 222 LYS A CD 1 ATOM 1596 C CE A LYS A 1 222 ? -3.153 -5.301 8.812 0.59 25.97 ? 222 LYS A CE 1 ATOM 1597 C CE B LYS A 1 222 ? -1.560 -5.270 11.570 0.41 28.10 ? 222 LYS A CE 1 ATOM 1598 N NZ A LYS A 1 222 ? -3.462 -4.028 8.112 0.59 20.71 ? 222 LYS A NZ 1 ATOM 1599 N NZ B LYS A 1 222 ? -0.639 -4.559 12.512 0.41 26.63 ? 222 LYS A NZ 1 ATOM 1600 N N . ASP A 1 223 ? -8.192 -5.765 13.552 1.00 10.54 ? 223 ASP A N 1 ATOM 1601 C CA . ASP A 1 223 ? -9.436 -5.174 14.008 1.00 11.27 ? 223 ASP A CA 1 ATOM 1602 C C . ASP A 1 223 ? -9.465 -5.038 15.531 1.00 10.48 ? 223 ASP A C 1 ATOM 1603 O O . ASP A 1 223 ? -10.401 -4.457 16.053 1.00 12.58 ? 223 ASP A O 1 ATOM 1604 C CB . ASP A 1 223 ? -10.693 -5.871 13.548 1.00 13.91 ? 223 ASP A CB 1 ATOM 1605 C CG . ASP A 1 223 ? -10.771 -7.348 13.821 1.00 19.91 ? 223 ASP A CG 1 ATOM 1606 O OD1 . ASP A 1 223 ? -9.737 -7.995 14.038 1.00 19.79 ? 223 ASP A OD1 1 ATOM 1607 O OD2 . ASP A 1 223 ? -11.907 -7.865 13.733 1.00 34.25 ? 223 ASP A OD2 1 ATOM 1608 N N . TRP A 1 224 ? -8.498 -5.589 16.268 1.00 10.22 ? 224 TRP A N 1 ATOM 1609 C CA . TRP A 1 224 ? -8.506 -5.394 17.730 1.00 9.54 ? 224 TRP A CA 1 ATOM 1610 C C . TRP A 1 224 ? -8.062 -3.966 18.043 1.00 9.61 ? 224 TRP A C 1 ATOM 1611 O O . TRP A 1 224 ? -7.145 -3.465 17.383 1.00 10.64 ? 224 TRP A O 1 ATOM 1612 C CB . TRP A 1 224 ? -7.530 -6.345 18.415 1.00 11.28 ? 224 TRP A CB 1 ATOM 1613 C CG . TRP A 1 224 ? -7.968 -7.766 18.403 1.00 12.78 ? 224 TRP A CG 1 ATOM 1614 C CD1 . TRP A 1 224 ? -9.000 -8.370 17.772 1.00 12.98 ? 224 TRP A CD1 1 ATOM 1615 C CD2 . TRP A 1 224 ? -7.294 -8.787 19.149 1.00 12.97 ? 224 TRP A CD2 1 ATOM 1616 N NE1 . TRP A 1 224 ? -8.997 -9.703 18.067 1.00 16.08 ? 224 TRP A NE1 1 ATOM 1617 C CE2 . TRP A 1 224 ? -7.963 -10.001 18.914 1.00 15.12 ? 224 TRP A CE2 1 ATOM 1618 C CE3 . TRP A 1 224 ? -6.176 -8.800 19.998 1.00 14.09 ? 224 TRP A CE3 1 ATOM 1619 C CZ2 . TRP A 1 224 ? -7.521 -11.191 19.516 1.00 18.39 ? 224 TRP A CZ2 1 ATOM 1620 C CZ3 . TRP A 1 224 ? -5.753 -9.958 20.569 1.00 17.25 ? 224 TRP A CZ3 1 ATOM 1621 C CH2 . TRP A 1 224 ? -6.432 -11.153 20.324 1.00 19.32 ? 224 TRP A CH2 1 ATOM 1622 N N . VAL A 1 225 ? -8.680 -3.373 19.016 1.00 9.64 ? 225 VAL A N 1 ATOM 1623 C CA . VAL A 1 225 ? -8.227 -2.085 19.529 1.00 9.24 ? 225 VAL A CA 1 ATOM 1624 C C . VAL A 1 225 ? -7.115 -2.359 20.547 1.00 11.68 ? 225 VAL A C 1 ATOM 1625 O O . VAL A 1 225 ? -7.380 -3.012 21.529 1.00 16.34 ? 225 VAL A O 1 ATOM 1626 C CB . VAL A 1 225 ? -9.336 -1.240 20.105 1.00 11.49 ? 225 VAL A CB 1 ATOM 1627 C CG1 . VAL A 1 225 ? -8.713 0.084 20.542 1.00 14.17 ? 225 VAL A CG1 1 ATOM 1628 C CG2 . VAL A 1 225 ? -10.435 -1.041 19.099 1.00 13.13 ? 225 VAL A CG2 1 ATOM 1629 N N . VAL A 1 226 ? -5.945 -1.861 20.268 1.00 9.42 ? 226 VAL A N 1 ATOM 1630 C CA . VAL A 1 226 ? -4.739 -2.128 21.030 1.00 10.36 ? 226 VAL A CA 1 ATOM 1631 C C . VAL A 1 226 ? -3.999 -0.845 21.357 1.00 9.91 ? 226 VAL A C 1 ATOM 1632 O O . VAL A 1 226 ? -3.806 0.016 20.510 1.00 9.92 ? 226 VAL A O 1 ATOM 1633 C CB . VAL A 1 226 ? -3.774 -3.087 20.229 1.00 18.07 ? 226 VAL A CB 1 ATOM 1634 C CG1 . VAL A 1 226 ? -2.592 -3.437 21.148 1.00 14.46 ? 226 VAL A CG1 1 ATOM 1635 C CG2 . VAL A 1 226 ? -4.431 -4.305 19.693 1.00 22.08 ? 226 VAL A CG2 1 ATOM 1636 N N . GLY A 1 227 ? -3.556 -0.703 22.589 1.00 9.04 ? 227 GLY A N 1 ATOM 1637 C CA . GLY A 1 227 ? -2.661 0.375 23.005 1.00 9.75 ? 227 GLY A CA 1 ATOM 1638 C C . GLY A 1 227 ? -1.589 -0.212 23.870 1.00 8.12 ? 227 GLY A C 1 ATOM 1639 O O . GLY A 1 227 ? -1.868 -1.108 24.664 1.00 10.37 ? 227 GLY A O 1 ATOM 1640 N N . GLU A 1 228 ? -0.336 0.269 23.756 1.00 8.96 ? 228 GLU A N 1 ATOM 1641 C CA . GLU A 1 228 ? 0.700 -0.307 24.597 1.00 8.98 ? 228 GLU A CA 1 ATOM 1642 C C . GLU A 1 228 ? 1.838 0.686 24.770 1.00 8.17 ? 228 GLU A C 1 ATOM 1643 O O . GLU A 1 228 ? 1.954 1.680 24.058 1.00 9.22 ? 228 GLU A O 1 ATOM 1644 C CB . GLU A 1 228 ? 1.112 -1.645 24.024 1.00 10.77 ? 228 GLU A CB 1 ATOM 1645 C CG . GLU A 1 228 ? 1.280 -1.691 22.524 1.00 11.62 ? 228 GLU A CG 1 ATOM 1646 C CD . GLU A 1 228 ? 2.364 -0.789 21.986 0.67 10.02 ? 228 GLU A CD 1 ATOM 1647 O OE1 . GLU A 1 228 ? 3.519 -0.855 22.485 0.67 8.97 ? 228 GLU A OE1 1 ATOM 1648 O OE2 . GLU A 1 228 ? 2.098 0.102 21.159 0.67 9.69 ? 228 GLU A OE2 1 ATOM 1649 N N . LYS A 1 229 ? 2.666 0.287 25.718 1.00 8.52 ? 229 LYS A N 1 ATOM 1650 C CA . LYS A 1 229 ? 3.901 0.960 26.039 1.00 7.87 ? 229 LYS A CA 1 ATOM 1651 C C . LYS A 1 229 ? 5.035 -0.057 25.992 1.00 7.65 ? 229 LYS A C 1 ATOM 1652 O O . LYS A 1 229 ? 5.048 -1.028 26.746 1.00 8.02 ? 229 LYS A O 1 ATOM 1653 C CB . LYS A 1 229 ? 3.917 1.604 27.436 1.00 8.76 ? 229 LYS A CB 1 ATOM 1654 C CG . LYS A 1 229 ? 5.191 2.277 27.886 1.00 9.18 ? 229 LYS A CG 1 ATOM 1655 C CD . LYS A 1 229 ? 5.438 3.593 27.166 1.00 10.69 ? 229 LYS A CD 1 ATOM 1656 C CE . LYS A 1 229 ? 6.880 4.057 27.208 1.00 10.61 ? 229 LYS A CE 1 ATOM 1657 N NZ . LYS A 1 229 ? 7.699 3.379 26.164 1.00 10.39 ? 229 LYS A NZ 1 ATOM 1658 N N . THR A 1 230 ? 6.032 0.180 25.142 1.00 8.74 ? 230 THR A N 1 ATOM 1659 C CA . THR A 1 230 ? 7.215 -0.646 24.993 1.00 8.65 ? 230 THR A CA 1 ATOM 1660 C C . THR A 1 230 ? 8.300 -0.350 26.023 1.00 8.73 ? 230 THR A C 1 ATOM 1661 O O . THR A 1 230 ? 8.352 0.666 26.693 1.00 9.74 ? 230 THR A O 1 ATOM 1662 C CB . THR A 1 230 ? 7.807 -0.436 23.577 1.00 10.59 ? 230 THR A CB 1 ATOM 1663 O OG1 . THR A 1 230 ? 7.977 0.969 23.390 1.00 12.52 ? 230 THR A OG1 1 ATOM 1664 C CG2 . THR A 1 230 ? 6.908 -0.986 22.508 1.00 14.89 ? 230 THR A CG2 1 ATOM 1665 N N . GLY A 1 231 ? 9.254 -1.287 26.128 1.00 9.43 ? 231 GLY A N 1 ATOM 1666 C CA . GLY A 1 231 ? 10.508 -1.007 26.776 1.00 11.13 ? 231 GLY A CA 1 ATOM 1667 C C . GLY A 1 231 ? 11.624 -1.806 26.101 1.00 10.12 ? 231 GLY A C 1 ATOM 1668 O O . GLY A 1 231 ? 11.387 -2.897 25.546 1.00 10.64 ? 231 GLY A O 1 ATOM 1669 N N . THR A 1 232 ? 12.803 -1.234 26.169 1.00 12.20 ? 232 THR A N 1 ATOM 1670 C CA . THR A 1 232 ? 14.053 -1.858 25.714 1.00 14.52 ? 232 THR A CA 1 ATOM 1671 C C . THR A 1 232 ? 15.100 -1.608 26.776 1.00 16.36 ? 232 THR A C 1 ATOM 1672 O O . THR A 1 232 ? 15.295 -0.440 27.139 1.00 26.80 ? 232 THR A O 1 ATOM 1673 C CB . THR A 1 232 ? 14.559 -1.262 24.404 1.00 16.38 ? 232 THR A CB 1 ATOM 1674 O OG1 . THR A 1 232 ? 13.499 -1.405 23.441 1.00 16.94 ? 232 THR A OG1 1 ATOM 1675 C CG2 . THR A 1 232 ? 15.798 -1.964 23.892 1.00 25.97 ? 232 THR A CG2 1 ATOM 1676 N N . CYS A 1 233 ? 15.773 -2.604 27.296 1.00 17.63 ? 233 CYS A N 1 ATOM 1677 C CA . CYS A 1 233 ? 16.878 -2.276 28.171 1.00 17.28 ? 233 CYS A CA 1 ATOM 1678 C C . CYS A 1 233 ? 18.044 -3.191 27.859 1.00 15.84 ? 233 CYS A C 1 ATOM 1679 O O . CYS A 1 233 ? 17.946 -4.143 27.104 1.00 15.32 ? 233 CYS A O 1 ATOM 1680 C CB . CYS A 1 233 ? 16.477 -2.376 29.632 1.00 23.07 ? 233 CYS A CB 1 ATOM 1681 S SG . CYS A 1 233 ? 15.674 -3.929 30.044 0.60 18.52 ? 233 CYS A SG 1 ATOM 1682 N N . ALA A 1 234 ? 19.122 -2.831 28.555 1.00 16.23 ? 234 ALA A N 1 ATOM 1683 C CA . ALA A 1 234 ? 20.339 -3.568 28.377 1.00 16.80 ? 234 ALA A CA 1 ATOM 1684 C C . ALA A 1 234 ? 20.215 -5.025 28.785 1.00 14.71 ? 234 ALA A C 1 ATOM 1685 O O . ALA A 1 234 ? 19.287 -5.396 29.464 1.00 13.50 ? 234 ALA A O 1 ATOM 1686 C CB . ALA A 1 234 ? 21.421 -2.918 29.248 1.00 18.01 ? 234 ALA A CB 1 ATOM 1687 N N . ASN A 1 235 ? 21.189 -5.808 28.353 1.00 14.02 ? 235 ASN A N 1 ATOM 1688 C CA . ASN A 1 235 ? 21.220 -7.239 28.638 1.00 15.46 ? 235 ASN A CA 1 ATOM 1689 C C . ASN A 1 235 ? 20.005 -8.005 28.134 1.00 13.65 ? 235 ASN A C 1 ATOM 1690 O O . ASN A 1 235 ? 19.615 -9.023 28.689 1.00 16.70 ? 235 ASN A O 1 ATOM 1691 C CB . ASN A 1 235 ? 21.432 -7.465 30.151 1.00 14.56 ? 235 ASN A CB 1 ATOM 1692 C CG . ASN A 1 235 ? 22.771 -6.886 30.548 1.00 15.34 ? 235 ASN A CG 1 ATOM 1693 O OD1 . ASN A 1 235 ? 23.831 -7.021 29.902 1.00 19.81 ? 235 ASN A OD1 1 ATOM 1694 N ND2 . ASN A 1 235 ? 22.782 -6.166 31.663 1.00 19.33 ? 235 ASN A ND2 1 ATOM 1695 N N . GLY A 1 236 ? 19.444 -7.537 27.006 1.00 12.87 ? 236 GLY A N 1 ATOM 1696 C CA . GLY A 1 236 ? 18.464 -8.335 26.294 1.00 12.88 ? 236 GLY A CA 1 ATOM 1697 C C . GLY A 1 236 ? 17.002 -8.081 26.648 1.00 12.06 ? 236 GLY A C 1 ATOM 1698 O O . GLY A 1 236 ? 16.208 -8.921 26.244 1.00 12.32 ? 236 GLY A O 1 ATOM 1699 N N . GLY A 1 237 ? 16.666 -7.022 27.370 1.00 12.34 ? 237 GLY A N 1 ATOM 1700 C CA . GLY A 1 237 ? 15.292 -6.839 27.769 1.00 12.52 ? 237 GLY A CA 1 ATOM 1701 C C . GLY A 1 237 ? 14.449 -6.219 26.647 1.00 10.43 ? 237 GLY A C 1 ATOM 1702 O O . GLY A 1 237 ? 14.871 -5.204 26.059 1.00 12.57 ? 237 GLY A O 1 ATOM 1703 N N . ARG A 1 238 ? 13.259 -6.782 26.400 1.00 10.03 ? 238 ARG A N 1 ATOM 1704 C CA . ARG A 1 238 ? 12.313 -6.244 25.430 1.00 9.96 ? 238 ARG A CA 1 ATOM 1705 C C . ARG A 1 238 ? 10.900 -6.527 25.901 1.00 8.24 ? 238 ARG A C 1 ATOM 1706 O O . ARG A 1 238 ? 10.529 -7.663 26.043 1.00 9.90 ? 238 ARG A O 1 ATOM 1707 C CB . ARG A 1 238 ? 12.553 -6.763 24.019 1.00 12.00 ? 238 ARG A CB 1 ATOM 1708 C CG . ARG A 1 238 ? 11.841 -6.000 22.906 1.00 12.03 ? 238 ARG A CG 1 ATOM 1709 C CD . ARG A 1 238 ? 12.510 -4.685 22.664 1.00 13.14 ? 238 ARG A CD 1 ATOM 1710 N NE . ARG A 1 238 ? 12.090 -3.964 21.473 1.00 15.86 ? 238 ARG A NE 1 ATOM 1711 C CZ . ARG A 1 238 ? 11.340 -2.867 21.436 1.00 13.15 ? 238 ARG A CZ 1 ATOM 1712 N NH1 . ARG A 1 238 ? 10.820 -2.279 22.500 1.00 19.77 ? 238 ARG A NH1 1 ATOM 1713 N NH2 . ARG A 1 238 ? 11.095 -2.336 20.234 1.00 17.20 ? 238 ARG A NH2 1 ATOM 1714 N N . ASN A 1 239 ? 10.174 -5.442 26.164 1.00 8.67 ? 239 ASN A N 1 ATOM 1715 C CA . ASN A 1 239 ? 8.913 -5.546 26.911 1.00 8.52 ? 239 ASN A CA 1 ATOM 1716 C C . ASN A 1 239 ? 7.825 -4.761 26.173 1.00 8.45 ? 239 ASN A C 1 ATOM 1717 O O . ASN A 1 239 ? 8.074 -3.842 25.432 1.00 9.26 ? 239 ASN A O 1 ATOM 1718 C CB . ASN A 1 239 ? 9.089 -4.942 28.278 1.00 8.99 ? 239 ASN A CB 1 ATOM 1719 C CG . ASN A 1 239 ? 10.332 -5.391 29.003 1.00 11.11 ? 239 ASN A CG 1 ATOM 1720 O OD1 . ASN A 1 239 ? 10.687 -6.555 28.962 1.00 10.13 ? 239 ASN A OD1 1 ATOM 1721 N ND2 . ASN A 1 239 ? 10.898 -4.443 29.749 1.00 15.62 ? 239 ASN A ND2 1 ATOM 1722 N N . ASP A 1 240 ? 6.572 -5.107 26.507 1.00 8.77 ? 240 ASP A N 1 ATOM 1723 C CA . ASP A 1 240 ? 5.408 -4.363 25.981 1.00 8.13 ? 240 ASP A CA 1 ATOM 1724 C C . ASP A 1 240 ? 4.206 -4.625 26.865 1.00 8.81 ? 240 ASP A C 1 ATOM 1725 O O . ASP A 1 240 ? 3.880 -5.812 27.119 1.00 9.50 ? 240 ASP A O 1 ATOM 1726 C CB . ASP A 1 240 ? 5.186 -4.774 24.526 1.00 9.28 ? 240 ASP A CB 1 ATOM 1727 C CG . ASP A 1 240 ? 4.537 -3.793 23.588 0.66 7.22 ? 240 ASP A CG 1 ATOM 1728 O OD1 . ASP A 1 240 ? 4.176 -2.708 24.054 0.66 7.66 ? 240 ASP A OD1 1 ATOM 1729 O OD2 . ASP A 1 240 ? 4.460 -4.049 22.362 0.66 10.01 ? 240 ASP A OD2 1 ATOM 1730 N N . ILE A 1 241 ? 3.578 -3.576 27.383 1.00 8.56 ? 241 ILE A N 1 ATOM 1731 C CA . ILE A 1 241 ? 2.433 -3.700 28.253 1.00 7.81 ? 241 ILE A CA 1 ATOM 1732 C C . ILE A 1 241 ? 1.310 -2.826 27.744 1.00 8.37 ? 241 ILE A C 1 ATOM 1733 O O . ILE A 1 241 ? 1.544 -1.786 27.111 1.00 8.98 ? 241 ILE A O 1 ATOM 1734 C CB . ILE A 1 241 ? 2.794 -3.330 29.712 1.00 8.40 ? 241 ILE A CB 1 ATOM 1735 C CG1 . ILE A 1 241 ? 3.038 -1.821 29.901 1.00 8.83 ? 241 ILE A CG1 1 ATOM 1736 C CG2 . ILE A 1 241 ? 3.997 -4.139 30.201 1.00 8.56 ? 241 ILE A CG2 1 ATOM 1737 C CD1 . ILE A 1 241 ? 3.107 -1.445 31.368 1.00 9.96 ? 241 ILE A CD1 1 ATOM 1738 N N . GLY A 1 242 ? 0.076 -3.224 28.022 1.00 8.34 ? 242 GLY A N 1 ATOM 1739 C CA . GLY A 1 242 ? -1.021 -2.403 27.567 1.00 10.08 ? 242 GLY A CA 1 ATOM 1740 C C . GLY A 1 242 ? -2.340 -3.142 27.615 1.00 8.43 ? 242 GLY A C 1 ATOM 1741 O O . GLY A 1 242 ? -2.571 -3.924 28.519 1.00 9.22 ? 242 GLY A O 1 ATOM 1742 N N . PHE A 1 243 ? -3.184 -2.865 26.627 1.00 9.00 ? 243 PHE A N 1 ATOM 1743 C CA . PHE A 1 243 ? -4.521 -3.408 26.616 1.00 9.64 ? 243 PHE A CA 1 ATOM 1744 C C . PHE A 1 243 ? -4.848 -3.819 25.203 1.00 10.66 ? 243 PHE A C 1 ATOM 1745 O O . PHE A 1 243 ? -4.322 -3.292 24.212 1.00 10.93 ? 243 PHE A O 1 ATOM 1746 C CB . PHE A 1 243 ? -5.575 -2.413 27.170 1.00 10.77 ? 243 PHE A CB 1 ATOM 1747 C CG . PHE A 1 243 ? -5.893 -1.314 26.184 1.00 11.46 ? 243 PHE A CG 1 ATOM 1748 C CD1 . PHE A 1 243 ? -5.126 -0.162 26.117 1.00 13.08 ? 243 PHE A CD1 1 ATOM 1749 C CD2 . PHE A 1 243 ? -6.963 -1.371 25.319 1.00 13.55 ? 243 PHE A CD2 1 ATOM 1750 C CE1 . PHE A 1 243 ? -5.431 0.806 25.182 1.00 15.75 ? 243 PHE A CE1 1 ATOM 1751 C CE2 . PHE A 1 243 ? -7.249 -0.476 24.367 1.00 18.23 ? 243 PHE A CE2 1 ATOM 1752 C CZ . PHE A 1 243 ? -6.492 0.662 24.315 1.00 15.96 ? 243 PHE A CZ 1 ATOM 1753 N N . PHE A 1 244 ? -5.861 -4.687 25.091 1.00 11.04 ? 244 PHE A N 1 ATOM 1754 C CA . PHE A 1 244 ? -6.499 -4.933 23.805 1.00 11.73 ? 244 PHE A CA 1 ATOM 1755 C C . PHE A 1 244 ? -7.973 -5.275 24.058 1.00 12.15 ? 244 PHE A C 1 ATOM 1756 O O . PHE A 1 244 ? -8.366 -5.813 25.065 1.00 12.70 ? 244 PHE A O 1 ATOM 1757 C CB . PHE A 1 244 ? -5.791 -6.003 23.044 1.00 13.18 ? 244 PHE A CB 1 ATOM 1758 C CG . PHE A 1 244 ? -5.661 -7.366 23.661 1.00 11.85 ? 244 PHE A CG 1 ATOM 1759 C CD1 . PHE A 1 244 ? -4.576 -7.707 24.441 1.00 13.26 ? 244 PHE A CD1 1 ATOM 1760 C CD2 . PHE A 1 244 ? -6.612 -8.339 23.491 1.00 12.53 ? 244 PHE A CD2 1 ATOM 1761 C CE1 . PHE A 1 244 ? -4.442 -8.944 25.023 1.00 13.54 ? 244 PHE A CE1 1 ATOM 1762 C CE2 . PHE A 1 244 ? -6.499 -9.577 24.043 1.00 13.11 ? 244 PHE A CE2 1 ATOM 1763 C CZ . PHE A 1 244 ? -5.414 -9.905 24.819 1.00 13.00 ? 244 PHE A CZ 1 ATOM 1764 N N . LYS A 1 245 ? -8.750 -4.931 23.028 1.00 12.89 ? 245 LYS A N 1 ATOM 1765 C CA . LYS A 1 245 ? -10.178 -5.191 22.939 1.00 12.76 ? 245 LYS A CA 1 ATOM 1766 C C . LYS A 1 245 ? -10.377 -6.061 21.714 1.00 11.69 ? 245 LYS A C 1 ATOM 1767 O O . LYS A 1 245 ? -10.163 -5.614 20.564 1.00 12.00 ? 245 LYS A O 1 ATOM 1768 C CB . LYS A 1 245 ? -10.969 -3.906 22.894 1.00 15.64 ? 245 LYS A CB 1 ATOM 1769 N N . ALA A 1 246 ? -10.828 -7.295 21.912 1.00 11.85 ? 246 ALA A N 1 ATOM 1770 C CA . ALA A 1 246 ? -11.088 -8.274 20.867 1.00 13.84 ? 246 ALA A CA 1 ATOM 1771 C C . ALA A 1 246 ? -12.605 -8.183 20.759 1.00 17.18 ? 246 ALA A C 1 ATOM 1772 O O . ALA A 1 246 ? -13.258 -8.758 21.592 1.00 20.28 ? 246 ALA A O 1 ATOM 1773 C CB . ALA A 1 246 ? -10.527 -9.617 21.226 1.00 19.98 ? 246 ALA A CB 1 ATOM 1774 N N . GLN A 1 247 ? -13.102 -7.415 19.781 1.00 22.24 ? 247 GLN A N 1 ATOM 1775 C CA . GLN A 1 247 ? -14.514 -7.000 19.733 1.00 24.42 ? 247 GLN A CA 1 ATOM 1776 C C . GLN A 1 247 ? -14.861 -6.473 21.101 1.00 26.14 ? 247 GLN A C 1 ATOM 1777 O O . GLN A 1 247 ? -14.297 -5.463 21.565 1.00 35.14 ? 247 GLN A O 1 ATOM 1778 C CB . GLN A 1 247 ? -15.367 -8.160 19.264 1.00 38.15 ? 247 GLN A CB 1 ATOM 1779 N N . GLU A 1 248 ? -15.779 -7.112 21.839 1.00 25.81 ? 248 GLU A N 1 ATOM 1780 C CA . GLU A 1 248 ? -16.205 -6.495 23.087 1.00 25.99 ? 248 GLU A CA 1 ATOM 1781 C C . GLU A 1 248 ? -15.453 -6.987 24.294 1.00 26.51 ? 248 GLU A C 1 ATOM 1782 O O . GLU A 1 248 ? -15.699 -6.518 25.403 1.00 38.28 ? 248 GLU A O 1 ATOM 1783 C CB . GLU A 1 248 ? -17.680 -6.809 23.306 1.00 28.44 ? 248 GLU A CB 1 ATOM 1784 C CG . GLU A 1 248 ? -18.547 -5.790 22.576 1.00 32.52 ? 248 GLU A CG 1 ATOM 1785 C CD . GLU A 1 248 ? -20.017 -6.084 22.726 1.00 32.01 ? 248 GLU A CD 1 ATOM 1786 O OE1 . GLU A 1 248 ? -20.406 -6.418 23.855 1.00 33.26 ? 248 GLU A OE1 1 ATOM 1787 O OE2 . GLU A 1 248 ? -20.761 -5.972 21.724 1.00 23.52 ? 248 GLU A OE2 1 ATOM 1788 N N . ARG A 1 249 ? -14.540 -7.925 24.083 1.00 18.13 ? 249 ARG A N 1 ATOM 1789 C CA . ARG A 1 249 ? -13.833 -8.409 25.262 1.00 22.13 ? 249 ARG A CA 1 ATOM 1790 C C . ARG A 1 249 ? -12.602 -7.551 25.512 1.00 18.48 ? 249 ARG A C 1 ATOM 1791 O O . ARG A 1 249 ? -11.765 -7.449 24.610 1.00 15.69 ? 249 ARG A O 1 ATOM 1792 C CB . ARG A 1 249 ? -13.460 -9.873 25.072 1.00 30.43 ? 249 ARG A CB 1 ATOM 1793 C CG . ARG A 1 249 ? -14.646 -10.717 24.664 1.00 37.12 ? 249 ARG A CG 1 ATOM 1794 C CD . ARG A 1 249 ? -15.622 -10.886 25.813 1.00 48.96 ? 249 ARG A CD 1 ATOM 1795 N NE . ARG A 1 249 ? -15.503 -12.196 26.451 1.00 58.35 ? 249 ARG A NE 1 ATOM 1796 C CZ . ARG A 1 249 ? -14.855 -12.509 27.562 1.00 65.14 ? 249 ARG A CZ 1 ATOM 1797 N NH1 . ARG A 1 249 ? -14.190 -11.602 28.275 1.00 73.29 ? 249 ARG A NH1 1 ATOM 1798 N NH2 . ARG A 1 249 ? -14.859 -13.765 27.996 1.00 71.74 ? 249 ARG A NH2 1 ATOM 1799 N N . ASP A 1 250 ? -12.511 -6.972 26.695 1.00 17.44 ? 250 ASP A N 1 ATOM 1800 C CA . ASP A 1 250 ? -11.366 -6.157 27.083 1.00 15.91 ? 250 ASP A CA 1 ATOM 1801 C C . ASP A 1 250 ? -10.392 -6.932 27.956 1.00 12.88 ? 250 ASP A C 1 ATOM 1802 O O . ASP A 1 250 ? -10.777 -7.661 28.837 1.00 15.91 ? 250 ASP A O 1 ATOM 1803 C CB . ASP A 1 250 ? -11.873 -4.944 27.861 1.00 20.83 ? 250 ASP A CB 1 ATOM 1804 C CG . ASP A 1 250 ? -12.809 -4.102 27.019 1.00 21.44 ? 250 ASP A CG 1 ATOM 1805 O OD1 . ASP A 1 250 ? -12.660 -4.073 25.795 1.00 32.61 ? 250 ASP A OD1 1 ATOM 1806 O OD2 . ASP A 1 250 ? -13.730 -3.526 27.608 1.00 29.64 ? 250 ASP A OD2 1 ATOM 1807 N N . TYR A 1 251 ? -9.107 -6.707 27.668 1.00 11.03 ? 251 TYR A N 1 ATOM 1808 C CA . TYR A 1 251 ? -8.044 -7.396 28.407 1.00 11.25 ? 251 TYR A CA 1 ATOM 1809 C C . TYR A 1 251 ? -6.912 -6.423 28.717 1.00 9.32 ? 251 TYR A C 1 ATOM 1810 O O . TYR A 1 251 ? -6.700 -5.493 27.956 1.00 13.42 ? 251 TYR A O 1 ATOM 1811 C CB . TYR A 1 251 ? -7.457 -8.511 27.555 1.00 11.55 ? 251 TYR A CB 1 ATOM 1812 C CG . TYR A 1 251 ? -8.434 -9.566 27.150 1.00 12.60 ? 251 TYR A CG 1 ATOM 1813 C CD1 . TYR A 1 251 ? -9.168 -9.463 25.978 1.00 13.68 ? 251 TYR A CD1 1 ATOM 1814 C CD2 . TYR A 1 251 ? -8.615 -10.704 27.908 1.00 12.94 ? 251 TYR A CD2 1 ATOM 1815 C CE1 . TYR A 1 251 ? -10.082 -10.414 25.541 1.00 15.84 ? 251 TYR A CE1 1 ATOM 1816 C CE2 . TYR A 1 251 ? -9.518 -11.673 27.481 1.00 16.83 ? 251 TYR A CE2 1 ATOM 1817 C CZ . TYR A 1 251 ? -10.240 -11.534 26.326 1.00 17.80 ? 251 TYR A CZ 1 ATOM 1818 O OH . TYR A 1 251 ? -11.125 -12.507 25.919 1.00 22.09 ? 251 TYR A OH 1 ATOM 1819 N N . ALA A 1 252 ? -6.147 -6.683 29.742 1.00 9.82 ? 252 ALA A N 1 ATOM 1820 C CA . ALA A 1 252 ? -4.876 -6.036 30.020 1.00 9.49 ? 252 ALA A CA 1 ATOM 1821 C C . ALA A 1 252 ? -3.793 -7.075 29.921 1.00 9.31 ? 252 ALA A C 1 ATOM 1822 O O . ALA A 1 252 ? -3.982 -8.253 30.227 1.00 11.61 ? 252 ALA A O 1 ATOM 1823 C CB . ALA A 1 252 ? -4.838 -5.410 31.393 1.00 11.22 ? 252 ALA A CB 1 ATOM 1824 N N . VAL A 1 253 ? -2.648 -6.685 29.387 1.00 8.88 ? 253 VAL A N 1 ATOM 1825 C CA . VAL A 1 253 ? -1.547 -7.600 29.085 1.00 8.99 ? 253 VAL A CA 1 ATOM 1826 C C . VAL A 1 253 ? -0.208 -6.959 29.465 1.00 9.05 ? 253 VAL A C 1 ATOM 1827 O O . VAL A 1 253 ? 0.026 -5.788 29.282 1.00 9.50 ? 253 VAL A O 1 ATOM 1828 C CB . VAL A 1 253 ? -1.557 -7.963 27.605 1.00 10.82 ? 253 VAL A CB 1 ATOM 1829 C CG1 . VAL A 1 253 ? -1.450 -6.789 26.633 1.00 12.14 ? 253 VAL A CG1 1 ATOM 1830 C CG2 . VAL A 1 253 ? -0.448 -8.960 27.290 1.00 14.37 ? 253 VAL A CG2 1 ATOM 1831 N N . ALA A 1 254 ? 0.668 -7.811 29.998 1.00 8.76 ? 254 ALA A N 1 ATOM 1832 C CA . ALA A 1 254 ? 2.039 -7.441 30.212 1.00 8.53 ? 254 ALA A CA 1 ATOM 1833 C C . ALA A 1 254 ? 2.943 -8.539 29.666 1.00 8.69 ? 254 ALA A C 1 ATOM 1834 O O . ALA A 1 254 ? 2.785 -9.696 30.038 1.00 10.31 ? 254 ALA A O 1 ATOM 1835 C CB . ALA A 1 254 ? 2.363 -7.182 31.661 1.00 9.51 ? 254 ALA A CB 1 ATOM 1836 N N . VAL A 1 255 ? 3.916 -8.146 28.843 1.00 8.32 ? 255 VAL A N 1 ATOM 1837 C CA . VAL A 1 255 ? 4.907 -9.026 28.294 1.00 8.26 ? 255 VAL A CA 1 ATOM 1838 C C . VAL A 1 255 ? 6.298 -8.464 28.583 1.00 8.58 ? 255 VAL A C 1 ATOM 1839 O O . VAL A 1 255 ? 6.604 -7.328 28.237 1.00 8.94 ? 255 VAL A O 1 ATOM 1840 C CB . VAL A 1 255 ? 4.727 -9.237 26.773 1.00 8.76 ? 255 VAL A CB 1 ATOM 1841 C CG1 . VAL A 1 255 ? 5.874 -10.022 26.181 1.00 10.33 ? 255 VAL A CG1 1 ATOM 1842 C CG2 . VAL A 1 255 ? 3.389 -9.854 26.475 1.00 9.75 ? 255 VAL A CG2 1 ATOM 1843 N N . TYR A 1 256 ? 7.080 -9.298 29.263 1.00 8.45 ? 256 TYR A N 1 ATOM 1844 C CA . TYR A 1 256 ? 8.466 -8.978 29.587 1.00 8.94 ? 256 TYR A CA 1 ATOM 1845 C C . TYR A 1 256 ? 9.332 -10.095 29.018 1.00 8.50 ? 256 TYR A C 1 ATOM 1846 O O . TYR A 1 256 ? 9.027 -11.265 29.228 1.00 10.86 ? 256 TYR A O 1 ATOM 1847 C CB . TYR A 1 256 ? 8.720 -8.857 31.127 1.00 8.99 ? 256 TYR A CB 1 ATOM 1848 C CG . TYR A 1 256 ? 8.044 -7.600 31.592 1.00 8.59 ? 256 TYR A CG 1 ATOM 1849 C CD1 . TYR A 1 256 ? 8.699 -6.395 31.639 1.00 8.95 ? 256 TYR A CD1 1 ATOM 1850 C CD2 . TYR A 1 256 ? 6.714 -7.550 32.015 1.00 9.07 ? 256 TYR A CD2 1 ATOM 1851 C CE1 . TYR A 1 256 ? 8.132 -5.207 32.037 1.00 8.90 ? 256 TYR A CE1 1 ATOM 1852 C CE2 . TYR A 1 256 ? 6.132 -6.365 32.420 1.00 9.10 ? 256 TYR A CE2 1 ATOM 1853 C CZ . TYR A 1 256 ? 6.838 -5.186 32.448 1.00 8.92 ? 256 TYR A CZ 1 ATOM 1854 O OH . TYR A 1 256 ? 6.182 -4.032 32.829 1.00 9.81 ? 256 TYR A OH 1 ATOM 1855 N N . THR A 1 257 ? 10.377 -9.771 28.281 1.00 9.81 ? 257 THR A N 1 ATOM 1856 C CA . THR A 1 257 ? 11.261 -10.797 27.732 1.00 10.57 ? 257 THR A CA 1 ATOM 1857 C C . THR A 1 257 ? 12.710 -10.452 27.933 1.00 10.61 ? 257 THR A C 1 ATOM 1858 O O . THR A 1 257 ? 13.106 -9.285 28.024 1.00 11.15 ? 257 THR A O 1 ATOM 1859 C CB . THR A 1 257 ? 11.062 -11.088 26.221 1.00 11.52 ? 257 THR A CB 1 ATOM 1860 O OG1 . THR A 1 257 ? 11.593 -10.052 25.407 1.00 10.34 ? 257 THR A OG1 1 ATOM 1861 C CG2 . THR A 1 257 ? 9.585 -11.232 25.889 1.00 11.53 ? 257 THR A CG2 1 ATOM 1862 N N . THR A 1 258 ? 13.498 -11.537 28.020 1.00 9.98 ? 258 THR A N 1 ATOM 1863 C CA . THR A 1 258 ? 14.928 -11.374 28.168 1.00 10.98 ? 258 THR A CA 1 ATOM 1864 C C . THR A 1 258 ? 15.615 -12.285 27.153 1.00 12.57 ? 258 THR A C 1 ATOM 1865 O O . THR A 1 258 ? 15.402 -13.489 27.234 1.00 13.45 ? 258 THR A O 1 ATOM 1866 C CB . THR A 1 258 ? 15.444 -11.748 29.575 1.00 13.05 ? 258 THR A CB 1 ATOM 1867 O OG1 . THR A 1 258 ? 14.689 -11.111 30.601 1.00 16.30 ? 258 THR A OG1 1 ATOM 1868 C CG2 . THR A 1 258 ? 16.905 -11.338 29.724 1.00 23.66 ? 258 THR A CG2 1 ATOM 1869 N N . ALA A 1 259 ? 16.385 -11.725 26.235 1.00 13.40 ? 259 ALA A N 1 ATOM 1870 C CA . ALA A 1 259 ? 16.947 -12.554 25.164 1.00 12.44 ? 259 ALA A CA 1 ATOM 1871 C C . ALA A 1 259 ? 18.311 -11.958 24.824 1.00 13.70 ? 259 ALA A C 1 ATOM 1872 O O . ALA A 1 259 ? 18.441 -11.238 23.843 1.00 15.15 ? 259 ALA A O 1 ATOM 1873 C CB . ALA A 1 259 ? 16.024 -12.650 23.968 1.00 15.58 ? 259 ALA A CB 1 ATOM 1874 N N . PRO A 1 260 ? 19.301 -12.219 25.684 1.00 15.75 ? 260 PRO A N 1 ATOM 1875 C CA . PRO A 1 260 ? 20.577 -11.553 25.546 1.00 17.10 ? 260 PRO A CA 1 ATOM 1876 C C . PRO A 1 260 ? 21.267 -11.810 24.202 1.00 17.42 ? 260 PRO A C 1 ATOM 1877 O O . PRO A 1 260 ? 22.026 -10.962 23.774 1.00 20.68 ? 260 PRO A O 1 ATOM 1878 C CB . PRO A 1 260 ? 21.426 -12.135 26.692 1.00 20.95 ? 260 PRO A CB 1 ATOM 1879 C CG . PRO A 1 260 ? 20.487 -12.815 27.599 1.00 20.97 ? 260 PRO A CG 1 ATOM 1880 C CD . PRO A 1 260 ? 19.257 -13.136 26.842 1.00 17.52 ? 260 PRO A CD 1 ATOM 1881 N N . LYS A 1 261 ? 21.029 -12.936 23.535 1.00 18.05 ? 261 LYS A N 1 ATOM 1882 C CA . LYS A 1 261 ? 21.726 -13.366 22.345 1.00 21.12 ? 261 LYS A CA 1 ATOM 1883 C C . LYS A 1 261 ? 21.147 -12.806 21.057 1.00 19.04 ? 261 LYS A C 1 ATOM 1884 O O . LYS A 1 261 ? 21.855 -12.805 20.060 1.00 23.73 ? 261 LYS A O 1 ATOM 1885 C CB . LYS A 1 261 ? 21.728 -14.907 22.355 1.00 29.67 ? 261 LYS A CB 1 ATOM 1886 C CG . LYS A 1 261 ? 22.399 -15.485 23.587 1.00 39.22 ? 261 LYS A CG 1 ATOM 1887 C CD . LYS A 1 261 ? 23.685 -16.203 23.255 1.00 48.16 ? 261 LYS A CD 1 ATOM 1888 C CE . LYS A 1 261 ? 24.090 -17.168 24.350 1.00 48.17 ? 261 LYS A CE 1 ATOM 1889 N NZ . LYS A 1 261 ? 25.295 -16.646 25.067 1.00 63.18 ? 261 LYS A NZ 1 ATOM 1890 N N . LEU A 1 262 ? 19.898 -12.345 21.109 1.00 15.72 ? 262 LEU A N 1 ATOM 1891 C CA . LEU A 1 262 ? 19.233 -11.866 19.921 1.00 16.52 ? 262 LEU A CA 1 ATOM 1892 C C . LEU A 1 262 ? 19.656 -10.457 19.552 1.00 16.16 ? 262 LEU A C 1 ATOM 1893 O O . LEU A 1 262 ? 20.067 -9.662 20.377 1.00 19.38 ? 262 LEU A O 1 ATOM 1894 C CB . LEU A 1 262 ? 17.728 -11.862 20.140 1.00 15.34 ? 262 LEU A CB 1 ATOM 1895 C CG . LEU A 1 262 ? 17.042 -13.221 20.298 1.00 17.74 ? 262 LEU A CG 1 ATOM 1896 C CD1 . LEU A 1 262 ? 15.540 -13.050 20.391 1.00 15.35 ? 262 LEU A CD1 1 ATOM 1897 C CD2 . LEU A 1 262 ? 17.397 -14.155 19.136 1.00 22.79 ? 262 LEU A CD2 1 ATOM 1898 N N . SER A 1 263 ? 19.534 -10.127 18.260 1.00 17.55 ? 263 SER A N 1 ATOM 1899 C CA . SER A 1 263 ? 19.631 -8.741 17.842 1.00 17.83 ? 263 SER A CA 1 ATOM 1900 C C . SER A 1 263 ? 18.354 -7.983 18.176 1.00 15.54 ? 263 SER A C 1 ATOM 1901 O O . SER A 1 263 ? 17.290 -8.527 18.485 1.00 14.70 ? 263 SER A O 1 ATOM 1902 C CB . SER A 1 263 ? 19.848 -8.698 16.322 1.00 20.45 ? 263 SER A CB 1 ATOM 1903 O OG . SER A 1 263 ? 18.632 -9.143 15.696 1.00 20.01 ? 263 SER A OG 1 ATOM 1904 N N . ALA A 1 264 ? 18.476 -6.636 18.089 1.00 16.19 ? 264 ALA A N 1 ATOM 1905 C CA . ALA A 1 264 ? 17.267 -5.823 18.334 1.00 15.19 ? 264 ALA A CA 1 ATOM 1906 C C . ALA A 1 264 ? 16.093 -6.159 17.435 1.00 13.73 ? 264 ALA A C 1 ATOM 1907 O O . ALA A 1 264 ? 14.948 -6.237 17.914 1.00 12.89 ? 264 ALA A O 1 ATOM 1908 C CB . ALA A 1 264 ? 17.684 -4.369 18.202 1.00 17.56 ? 264 ALA A CB 1 ATOM 1909 N N . VAL A 1 265 ? 16.284 -6.363 16.134 1.00 14.55 ? 265 VAL A N 1 ATOM 1910 C CA . VAL A 1 265 ? 15.154 -6.706 15.275 1.00 15.07 ? 265 VAL A CA 1 ATOM 1911 C C . VAL A 1 265 ? 14.555 -8.063 15.689 1.00 12.82 ? 265 VAL A C 1 ATOM 1912 O O . VAL A 1 265 ? 13.347 -8.267 15.665 1.00 14.27 ? 265 VAL A O 1 ATOM 1913 C CB . VAL A 1 265 ? 15.519 -6.690 13.785 1.00 21.59 ? 265 VAL A CB 1 ATOM 1914 C CG1 . VAL A 1 265 ? 14.382 -7.118 12.886 1.00 27.01 ? 265 VAL A CG1 1 ATOM 1915 C CG2 . VAL A 1 265 ? 15.977 -5.276 13.453 1.00 26.78 ? 265 VAL A CG2 1 ATOM 1916 N N . GLU A 1 266 ? 15.431 -9.006 16.098 1.00 13.51 ? 266 GLU A N 1 ATOM 1917 C CA . GLU A 1 266 ? 14.954 -10.304 16.497 1.00 13.56 ? 266 GLU A CA 1 ATOM 1918 C C . GLU A 1 266 ? 14.150 -10.266 17.794 1.00 10.20 ? 266 GLU A C 1 ATOM 1919 O O . GLU A 1 266 ? 13.197 -11.015 17.998 1.00 12.65 ? 266 GLU A O 1 ATOM 1920 C CB . GLU A 1 266 ? 16.158 -11.235 16.633 1.00 14.22 ? 266 GLU A CB 1 ATOM 1921 C CG . GLU A 1 266 ? 16.809 -11.640 15.347 1.00 21.69 ? 266 GLU A CG 1 ATOM 1922 C CD . GLU A 1 266 ? 18.115 -12.388 15.493 1.00 26.77 ? 266 GLU A CD 1 ATOM 1923 O OE1 . GLU A 1 266 ? 18.465 -13.144 14.570 1.00 37.10 ? 266 GLU A OE1 1 ATOM 1924 O OE2 . GLU A 1 266 ? 18.857 -12.296 16.493 1.00 22.98 ? 266 GLU A OE2 1 ATOM 1925 N N . ARG A 1 267 ? 14.504 -9.351 18.678 1.00 10.85 ? 267 ARG A N 1 ATOM 1926 C CA . ARG A 1 267 ? 13.709 -9.170 19.888 1.00 10.69 ? 267 ARG A CA 1 ATOM 1927 C C . ARG A 1 267 ? 12.352 -8.558 19.615 1.00 10.10 ? 267 ARG A C 1 ATOM 1928 O O . ARG A 1 267 ? 11.344 -8.945 20.228 1.00 11.57 ? 267 ARG A O 1 ATOM 1929 C CB . ARG A 1 267 ? 14.472 -8.302 20.884 1.00 11.36 ? 267 ARG A CB 1 ATOM 1930 C CG . ARG A 1 267 ? 15.701 -9.002 21.409 1.00 11.76 ? 267 ARG A CG 1 ATOM 1931 C CD . ARG A 1 267 ? 16.421 -8.083 22.368 1.00 15.32 ? 267 ARG A CD 1 ATOM 1932 N NE . ARG A 1 267 ? 17.739 -8.567 22.777 1.00 14.62 ? 267 ARG A NE 1 ATOM 1933 C CZ . ARG A 1 267 ? 18.921 -7.974 22.637 1.00 13.27 ? 267 ARG A CZ 1 ATOM 1934 N NH1 . ARG A 1 267 ? 19.067 -6.804 22.055 1.00 15.91 ? 267 ARG A NH1 1 ATOM 1935 N NH2 . ARG A 1 267 ? 20.015 -8.595 23.101 1.00 16.03 ? 267 ARG A NH2 1 ATOM 1936 N N . ASP A 1 268 ? 12.253 -7.601 18.683 1.00 11.37 ? 268 ASP A N 1 ATOM 1937 C CA . ASP A 1 268 ? 10.966 -7.109 18.237 1.00 11.54 ? 268 ASP A CA 1 ATOM 1938 C C . ASP A 1 268 ? 10.114 -8.267 17.709 1.00 10.23 ? 268 ASP A C 1 ATOM 1939 O O . ASP A 1 268 ? 8.952 -8.403 18.026 1.00 10.72 ? 268 ASP A O 1 ATOM 1940 C CB . ASP A 1 268 ? 11.123 -6.064 17.138 1.00 12.64 ? 268 ASP A CB 1 ATOM 1941 C CG . ASP A 1 268 ? 11.730 -4.756 17.487 1.00 18.07 ? 268 ASP A CG 1 ATOM 1942 O OD1 . ASP A 1 268 ? 11.956 -3.901 16.571 1.00 26.27 ? 268 ASP A OD1 1 ATOM 1943 O OD2 . ASP A 1 268 ? 11.982 -4.487 18.676 1.00 19.74 ? 268 ASP A OD2 1 ATOM 1944 N N . GLU A 1 269 ? 10.726 -9.083 16.836 1.00 11.14 ? 269 GLU A N 1 ATOM 1945 C CA . GLU A 1 269 ? 9.990 -10.219 16.244 1.00 11.87 ? 269 GLU A CA 1 ATOM 1946 C C . GLU A 1 269 ? 9.564 -11.219 17.304 1.00 10.36 ? 269 GLU A C 1 ATOM 1947 O O . GLU A 1 269 ? 8.464 -11.807 17.231 1.00 12.03 ? 269 GLU A O 1 ATOM 1948 C CB . GLU A 1 269 ? 10.830 -10.858 15.161 1.00 13.14 ? 269 GLU A CB 1 ATOM 1949 C CG . GLU A 1 269 ? 11.146 -9.957 13.975 1.00 20.82 ? 269 GLU A CG 1 ATOM 1950 C CD . GLU A 1 269 ? 12.080 -10.518 12.903 1.00 24.61 ? 269 GLU A CD 1 ATOM 1951 O OE1 . GLU A 1 269 ? 12.729 -11.560 13.142 1.00 36.86 ? 269 GLU A OE1 1 ATOM 1952 O OE2 . GLU A 1 269 ? 12.145 -9.904 11.822 1.00 34.53 ? 269 GLU A OE2 1 ATOM 1953 N N . LEU A 1 270 ? 10.378 -11.419 18.343 1.00 11.26 ? 270 LEU A N 1 ATOM 1954 C CA . LEU A 1 270 ? 10.034 -12.243 19.478 1.00 11.53 ? 270 LEU A CA 1 ATOM 1955 C C . LEU A 1 270 ? 8.746 -11.777 20.131 1.00 8.93 ? 270 LEU A C 1 ATOM 1956 O O . LEU A 1 270 ? 7.805 -12.518 20.390 1.00 10.70 ? 270 LEU A O 1 ATOM 1957 C CB . LEU A 1 270 ? 11.200 -12.299 20.488 1.00 11.78 ? 270 LEU A CB 1 ATOM 1958 C CG . LEU A 1 270 ? 10.927 -13.170 21.722 1.00 12.76 ? 270 LEU A CG 1 ATOM 1959 C CD1 . LEU A 1 270 ? 10.720 -14.602 21.307 1.00 19.72 ? 270 LEU A CD1 1 ATOM 1960 C CD2 . LEU A 1 270 ? 12.006 -12.953 22.760 1.00 17.48 ? 270 LEU A CD2 1 ATOM 1961 N N . VAL A 1 271 ? 8.698 -10.458 20.426 1.00 10.78 ? 271 VAL A N 1 ATOM 1962 C CA . VAL A 1 271 ? 7.510 -9.934 21.076 1.00 9.78 ? 271 VAL A CA 1 ATOM 1963 C C . VAL A 1 271 ? 6.293 -10.030 20.178 1.00 8.67 ? 271 VAL A C 1 ATOM 1964 O O . VAL A 1 271 ? 5.186 -10.347 20.632 1.00 9.39 ? 271 VAL A O 1 ATOM 1965 C CB . VAL A 1 271 ? 7.764 -8.533 21.620 1.00 10.56 ? 271 VAL A CB 1 ATOM 1966 C CG1 . VAL A 1 271 ? 6.497 -7.975 22.282 1.00 11.25 ? 271 VAL A CG1 1 ATOM 1967 C CG2 . VAL A 1 271 ? 8.897 -8.535 22.649 1.00 12.21 ? 271 VAL A CG2 1 ATOM 1968 N N . ALA A 1 272 ? 6.428 -9.757 18.853 1.00 9.79 ? 272 ALA A N 1 ATOM 1969 C CA . ALA A 1 272 ? 5.319 -9.957 17.924 1.00 10.08 ? 272 ALA A CA 1 ATOM 1970 C C . ALA A 1 272 ? 4.859 -11.399 17.874 1.00 9.61 ? 272 ALA A C 1 ATOM 1971 O O . ALA A 1 272 ? 3.667 -11.646 17.788 1.00 10.80 ? 272 ALA A O 1 ATOM 1972 C CB . ALA A 1 272 ? 5.703 -9.462 16.541 1.00 11.35 ? 272 ALA A CB 1 ATOM 1973 N N . SER A 1 273 ? 5.780 -12.339 17.965 1.00 10.47 ? 273 SER A N 1 ATOM 1974 C CA . SER A 1 273 ? 5.482 -13.762 18.047 1.00 10.84 ? 273 SER A CA 1 ATOM 1975 C C . SER A 1 273 ? 4.663 -14.081 19.295 1.00 9.58 ? 273 SER A C 1 ATOM 1976 O O . SER A 1 273 ? 3.710 -14.880 19.253 1.00 11.73 ? 273 SER A O 1 ATOM 1977 C CB . SER A 1 273 ? 6.761 -14.608 17.995 1.00 12.36 ? 273 SER A CB 1 ATOM 1978 O OG . SER A 1 273 ? 7.323 -14.542 16.689 1.00 14.39 ? 273 SER A OG 1 ATOM 1979 N N . VAL A 1 274 ? 5.020 -13.484 20.436 1.00 9.87 ? 274 VAL A N 1 ATOM 1980 C CA . VAL A 1 274 ? 4.218 -13.632 21.668 1.00 10.46 ? 274 VAL A CA 1 ATOM 1981 C C . VAL A 1 274 ? 2.818 -13.122 21.420 1.00 8.83 ? 274 VAL A C 1 ATOM 1982 O O . VAL A 1 274 ? 1.815 -13.705 21.874 1.00 10.57 ? 274 VAL A O 1 ATOM 1983 C CB . VAL A 1 274 ? 4.928 -12.967 22.883 1.00 10.54 ? 274 VAL A CB 1 ATOM 1984 C CG1 . VAL A 1 274 ? 4.026 -12.998 24.094 1.00 11.69 ? 274 VAL A CG1 1 ATOM 1985 C CG2 . VAL A 1 274 ? 6.262 -13.646 23.140 1.00 12.47 ? 274 VAL A CG2 1 ATOM 1986 N N . GLY A 1 275 ? 2.670 -12.002 20.698 1.00 9.22 ? 275 GLY A N 1 ATOM 1987 C CA . GLY A 1 275 ? 1.373 -11.473 20.361 1.00 9.86 ? 275 GLY A CA 1 ATOM 1988 C C . GLY A 1 275 ? 0.545 -12.468 19.566 1.00 7.98 ? 275 GLY A C 1 ATOM 1989 O O . GLY A 1 275 ? -0.671 -12.600 19.829 1.00 9.90 ? 275 GLY A O 1 ATOM 1990 N N . GLN A 1 276 ? 1.176 -13.218 18.655 1.00 9.84 ? 276 GLN A N 1 ATOM 1991 C CA . GLN A 1 276 ? 0.442 -14.238 17.895 1.00 9.89 ? 276 GLN A CA 1 ATOM 1992 C C . GLN A 1 276 ? 0.017 -15.419 18.732 1.00 10.65 ? 276 GLN A C 1 ATOM 1993 O O . GLN A 1 276 ? -1.065 -15.970 18.570 1.00 11.01 ? 276 GLN A O 1 ATOM 1994 C CB . GLN A 1 276 ? 1.383 -14.711 16.778 1.00 11.45 ? 276 GLN A CB 1 ATOM 1995 C CG . GLN A 1 276 ? 1.610 -13.643 15.718 1.00 12.67 ? 276 GLN A CG 1 ATOM 1996 C CD . GLN A 1 276 ? 2.743 -13.958 14.824 1.00 15.85 ? 276 GLN A CD 1 ATOM 1997 O OE1 . GLN A 1 276 ? 3.800 -13.278 14.784 1.00 24.59 ? 276 GLN A OE1 1 ATOM 1998 N NE2 . GLN A 1 276 ? 2.594 -15.054 14.120 1.00 14.82 ? 276 GLN A NE2 1 ATOM 1999 N N . VAL A 1 277 ? 0.836 -15.809 19.756 1.00 10.64 ? 277 VAL A N 1 ATOM 2000 C CA . VAL A 1 277 ? 0.461 -16.863 20.696 1.00 11.32 ? 277 VAL A CA 1 ATOM 2001 C C . VAL A 1 277 ? -0.715 -16.456 21.536 1.00 10.22 ? 277 VAL A C 1 ATOM 2002 O O . VAL A 1 277 ? -1.657 -17.223 21.747 1.00 11.46 ? 277 VAL A O 1 ATOM 2003 C CB . VAL A 1 277 ? 1.686 -17.252 21.506 1.00 11.27 ? 277 VAL A CB 1 ATOM 2004 C CG1 . VAL A 1 277 ? 1.363 -18.296 22.557 1.00 14.11 ? 277 VAL A CG1 1 ATOM 2005 C CG2 . VAL A 1 277 ? 2.760 -17.811 20.554 1.00 13.09 ? 277 VAL A CG2 1 ATOM 2006 N N . ILE A 1 278 ? -0.650 -15.188 22.028 1.00 10.52 ? 278 ILE A N 1 ATOM 2007 C CA . ILE A 1 278 ? -1.778 -14.630 22.756 1.00 10.51 ? 278 ILE A CA 1 ATOM 2008 C C . ILE A 1 278 ? -3.051 -14.720 21.906 1.00 9.06 ? 278 ILE A C 1 ATOM 2009 O O . ILE A 1 278 ? -4.129 -15.078 22.344 1.00 11.11 ? 278 ILE A O 1 ATOM 2010 C CB . ILE A 1 278 ? -1.433 -13.212 23.207 1.00 9.60 ? 278 ILE A CB 1 ATOM 2011 C CG1 . ILE A 1 278 ? -0.311 -13.202 24.273 1.00 9.87 ? 278 ILE A CG1 1 ATOM 2012 C CG2 . ILE A 1 278 ? -2.702 -12.528 23.725 1.00 10.55 ? 278 ILE A CG2 1 ATOM 2013 C CD1 . ILE A 1 278 ? 0.277 -11.844 24.525 1.00 10.47 ? 278 ILE A CD1 1 ATOM 2014 N N . THR A 1 279 ? -2.905 -14.282 20.648 1.00 10.36 ? 279 THR A N 1 ATOM 2015 C CA . THR A 1 279 ? -4.041 -14.235 19.752 1.00 10.28 ? 279 THR A CA 1 ATOM 2016 C C . THR A 1 279 ? -4.698 -15.589 19.517 1.00 9.68 ? 279 THR A C 1 ATOM 2017 O O . THR A 1 279 ? -5.924 -15.726 19.583 1.00 12.43 ? 279 THR A O 1 ATOM 2018 C CB . THR A 1 279 ? -3.637 -13.659 18.394 1.00 9.69 ? 279 THR A CB 1 ATOM 2019 O OG1 . THR A 1 279 ? -3.182 -12.331 18.553 1.00 10.69 ? 279 THR A OG1 1 ATOM 2020 C CG2 . THR A 1 279 ? -4.845 -13.650 17.452 1.00 10.26 ? 279 THR A CG2 1 ATOM 2021 N N . GLN A 1 280 ? -3.892 -16.621 19.334 1.00 11.09 ? 280 GLN A N 1 ATOM 2022 C CA . GLN A 1 280 ? -4.477 -17.960 19.214 1.00 12.15 ? 280 GLN A CA 1 ATOM 2023 C C . GLN A 1 280 ? -5.319 -18.317 20.431 1.00 12.17 ? 280 GLN A C 1 ATOM 2024 O O . GLN A 1 280 ? -6.434 -18.869 20.305 1.00 14.18 ? 280 GLN A O 1 ATOM 2025 C CB A GLN A 1 280 ? -3.407 -18.993 18.941 0.78 14.19 ? 280 GLN A CB 1 ATOM 2026 C CB B GLN A 1 280 ? -3.440 -19.019 18.881 0.22 12.25 ? 280 GLN A CB 1 ATOM 2027 C CG A GLN A 1 280 ? -4.041 -20.358 18.721 0.78 13.08 ? 280 GLN A CG 1 ATOM 2028 C CG B GLN A 1 280 ? -1.988 -18.834 18.454 0.22 14.93 ? 280 GLN A CG 1 ATOM 2029 C CD A GLN A 1 280 ? -3.180 -21.452 18.186 0.78 12.00 ? 280 GLN A CD 1 ATOM 2030 C CD B GLN A 1 280 ? -1.459 -18.789 17.071 0.22 16.09 ? 280 GLN A CD 1 ATOM 2031 O OE1 A GLN A 1 280 ? -1.946 -21.364 18.065 0.78 16.89 ? 280 GLN A OE1 1 ATOM 2032 O OE1 B GLN A 1 280 ? -1.238 -17.754 16.436 0.22 15.30 ? 280 GLN A OE1 1 ATOM 2033 N NE2 A GLN A 1 280 ? -3.826 -22.571 17.881 0.78 15.29 ? 280 GLN A NE2 1 ATOM 2034 N NE2 B GLN A 1 280 ? -1.140 -19.930 16.463 0.22 27.41 ? 280 GLN A NE2 1 ATOM 2035 N N . LEU A 1 281 ? -4.820 -18.043 21.636 1.00 10.77 ? 281 LEU A N 1 ATOM 2036 C CA A LEU A 1 281 ? -5.583 -18.345 22.815 0.61 11.77 ? 281 LEU A CA 1 ATOM 2037 C CA B LEU A 1 281 ? -5.557 -18.308 22.862 0.39 11.94 ? 281 LEU A CA 1 ATOM 2038 C C . LEU A 1 281 ? -6.879 -17.559 22.859 1.00 12.34 ? 281 LEU A C 1 ATOM 2039 O O . LEU A 1 281 ? -7.959 -18.130 23.147 1.00 13.90 ? 281 LEU A O 1 ATOM 2040 C CB A LEU A 1 281 ? -4.649 -18.099 24.001 0.61 13.34 ? 281 LEU A CB 1 ATOM 2041 C CB B LEU A 1 281 ? -4.762 -17.946 24.113 0.39 11.24 ? 281 LEU A CB 1 ATOM 2042 C CG A LEU A 1 281 ? -5.342 -18.172 25.361 0.61 15.87 ? 281 LEU A CG 1 ATOM 2043 C CG B LEU A 1 281 ? -5.227 -18.373 25.506 0.39 16.86 ? 281 LEU A CG 1 ATOM 2044 C CD1 A LEU A 1 281 ? -5.522 -19.621 25.787 0.61 22.42 ? 281 LEU A CD1 1 ATOM 2045 C CD1 B LEU A 1 281 ? -6.284 -17.452 26.091 0.39 21.72 ? 281 LEU A CD1 1 ATOM 2046 C CD2 A LEU A 1 281 ? -4.483 -17.427 26.347 0.61 18.64 ? 281 LEU A CD2 1 ATOM 2047 C CD2 B LEU A 1 281 ? -5.732 -19.814 25.477 0.39 19.57 ? 281 LEU A CD2 1 ATOM 2048 N N . ILE A 1 282 ? -6.816 -16.251 22.626 1.00 10.77 ? 282 ILE A N 1 ATOM 2049 C CA . ILE A 1 282 ? -8.015 -15.437 22.716 1.00 13.07 ? 282 ILE A CA 1 ATOM 2050 C C . ILE A 1 282 ? -9.031 -15.898 21.671 1.00 11.98 ? 282 ILE A C 1 ATOM 2051 O O . ILE A 1 282 ? -10.245 -16.034 22.000 1.00 15.88 ? 282 ILE A O 1 ATOM 2052 C CB . ILE A 1 282 ? -7.643 -13.956 22.595 1.00 12.39 ? 282 ILE A CB 1 ATOM 2053 C CG1 . ILE A 1 282 ? -6.670 -13.487 23.691 1.00 13.20 ? 282 ILE A CG1 1 ATOM 2054 C CG2 . ILE A 1 282 ? -8.865 -13.071 22.550 1.00 15.09 ? 282 ILE A CG2 1 ATOM 2055 C CD1 . ILE A 1 282 ? -7.238 -13.569 25.087 1.00 15.47 ? 282 ILE A CD1 1 ATOM 2056 N N . LEU A 1 283 ? -8.564 -16.169 20.481 1.00 14.63 ? 283 LEU A N 1 ATOM 2057 C CA . LEU A 1 283 ? -9.494 -16.555 19.419 1.00 15.87 ? 283 LEU A CA 1 ATOM 2058 C C . LEU A 1 283 ? -10.199 -17.861 19.747 1.00 18.23 ? 283 LEU A C 1 ATOM 2059 O O . LEU A 1 283 ? -11.299 -18.110 19.255 1.00 21.69 ? 283 LEU A O 1 ATOM 2060 C CB . LEU A 1 283 ? -8.770 -16.608 18.091 1.00 17.05 ? 283 LEU A CB 1 ATOM 2061 C CG . LEU A 1 283 ? -8.324 -15.279 17.474 1.00 16.24 ? 283 LEU A CG 1 ATOM 2062 C CD1 . LEU A 1 283 ? -7.716 -15.502 16.104 1.00 18.56 ? 283 LEU A CD1 1 ATOM 2063 C CD2 . LEU A 1 283 ? -9.450 -14.261 17.368 1.00 22.48 ? 283 LEU A CD2 1 ATOM 2064 N N . SER A 1 284 ? -9.650 -18.718 20.589 1.00 16.26 ? 284 SER A N 1 ATOM 2065 C CA . SER A 1 284 ? -10.179 -20.022 20.920 1.00 17.92 ? 284 SER A CA 1 ATOM 2066 C C . SER A 1 284 ? -11.413 -19.922 21.818 1.00 21.92 ? 284 SER A C 1 ATOM 2067 O O . SER A 1 284 ? -12.198 -20.868 21.935 1.00 31.12 ? 284 SER A O 1 ATOM 2068 C CB . SER A 1 284 ? -9.141 -20.926 21.554 1.00 19.75 ? 284 SER A CB 1 ATOM 2069 O OG . SER A 1 284 ? -8.920 -20.636 22.907 1.00 20.60 ? 284 SER A OG 1 ATOM 2070 N N . THR A 1 285 ? -11.626 -18.781 22.447 1.00 27.75 ? 285 THR A N 1 ATOM 2071 C CA . THR A 1 285 ? -12.763 -18.485 23.307 1.00 31.77 ? 285 THR A CA 1 ATOM 2072 C C . THR A 1 285 ? -13.895 -17.790 22.553 1.00 34.70 ? 285 THR A C 1 ATOM 2073 O O . THR A 1 285 ? -15.093 -17.842 22.960 1.00 43.41 ? 285 THR A O 1 ATOM 2074 C CB . THR A 1 285 ? -12.267 -17.665 24.502 1.00 38.53 ? 285 THR A CB 1 ATOM 2075 N N . SER B 1 19 ? 24.569 44.330 0.086 1.00 45.70 ? 19 SER B N 1 ATOM 2076 C CA . SER B 1 19 ? 25.368 44.227 1.309 1.00 39.03 ? 19 SER B CA 1 ATOM 2077 C C . SER B 1 19 ? 25.171 42.847 1.893 1.00 28.50 ? 19 SER B C 1 ATOM 2078 O O . SER B 1 19 ? 25.586 41.823 1.322 1.00 25.97 ? 19 SER B O 1 ATOM 2079 C CB . SER B 1 19 ? 24.970 45.420 2.170 1.00 50.58 ? 19 SER B CB 1 ATOM 2080 N N . GLU B 1 20 ? 24.496 42.763 3.044 1.00 23.32 ? 20 GLU B N 1 ATOM 2081 C CA . GLU B 1 20 ? 24.123 41.434 3.522 1.00 19.77 ? 20 GLU B CA 1 ATOM 2082 C C . GLU B 1 20 ? 23.118 40.839 2.529 1.00 17.45 ? 20 GLU B C 1 ATOM 2083 O O . GLU B 1 20 ? 23.082 39.638 2.346 1.00 16.06 ? 20 GLU B O 1 ATOM 2084 C CB . GLU B 1 20 ? 23.601 41.543 4.935 1.00 21.34 ? 20 GLU B CB 1 ATOM 2085 C CG . GLU B 1 20 ? 22.482 42.413 5.081 1.00 38.91 ? 20 GLU B CG 1 ATOM 2086 N N . LYS B 1 21 ? 22.316 41.698 1.886 1.00 19.66 ? 21 LYS B N 1 ATOM 2087 C CA . LYS B 1 21 ? 21.306 41.238 0.946 1.00 17.79 ? 21 LYS B CA 1 ATOM 2088 C C . LYS B 1 21 ? 21.972 40.705 -0.316 1.00 18.63 ? 21 LYS B C 1 ATOM 2089 O O . LYS B 1 21 ? 21.492 39.723 -0.912 1.00 18.22 ? 21 LYS B O 1 ATOM 2090 C CB . LYS B 1 21 ? 20.261 42.304 0.594 1.00 23.65 ? 21 LYS B CB 1 ATOM 2091 C CG . LYS B 1 21 ? 19.236 42.354 1.587 1.00 34.65 ? 21 LYS B CG 1 ATOM 2092 N N . LEU B 1 22 ? 23.035 41.316 -0.738 1.00 20.14 ? 22 LEU B N 1 ATOM 2093 C CA . LEU B 1 22 ? 23.793 40.877 -1.911 1.00 18.96 ? 22 LEU B CA 1 ATOM 2094 C C . LEU B 1 22 ? 24.446 39.519 -1.656 1.00 17.55 ? 22 LEU B C 1 ATOM 2095 O O . LEU B 1 22 ? 24.365 38.616 -2.492 1.00 19.10 ? 22 LEU B O 1 ATOM 2096 C CB . LEU B 1 22 ? 24.876 41.885 -2.325 1.00 21.84 ? 22 LEU B CB 1 ATOM 2097 C CG . LEU B 1 22 ? 25.742 41.451 -3.503 1.00 22.41 ? 22 LEU B CG 1 ATOM 2098 C CD1 . LEU B 1 22 ? 24.847 41.246 -4.725 1.00 25.65 ? 22 LEU B CD1 1 ATOM 2099 C CD2 . LEU B 1 22 ? 26.859 42.425 -3.840 1.00 28.05 ? 22 LEU B CD2 1 ATOM 2100 N N . THR B 1 23 ? 25.078 39.322 -0.509 1.00 18.63 ? 23 THR B N 1 ATOM 2101 C CA . THR B 1 23 ? 25.670 38.076 -0.088 1.00 16.75 ? 23 THR B CA 1 ATOM 2102 C C . THR B 1 23 ? 24.608 36.970 -0.078 1.00 14.94 ? 23 THR B C 1 ATOM 2103 O O . THR B 1 23 ? 24.846 35.850 -0.558 1.00 15.49 ? 23 THR B O 1 ATOM 2104 C CB . THR B 1 23 ? 26.315 38.274 1.297 1.00 16.82 ? 23 THR B CB 1 ATOM 2105 O OG1 . THR B 1 23 ? 27.460 39.115 1.124 1.00 21.10 ? 23 THR B OG1 1 ATOM 2106 C CG2 . THR B 1 23 ? 26.789 36.958 1.875 1.00 20.86 ? 23 THR B CG2 1 ATOM 2107 N N . PHE B 1 24 ? 23.450 37.275 0.506 1.00 13.99 ? 24 PHE B N 1 ATOM 2108 C CA . PHE B 1 24 ? 22.348 36.320 0.557 1.00 14.93 ? 24 PHE B CA 1 ATOM 2109 C C . PHE B 1 24 ? 21.922 35.923 -0.824 1.00 12.99 ? 24 PHE B C 1 ATOM 2110 O O . PHE B 1 24 ? 21.828 34.716 -1.093 1.00 14.23 ? 24 PHE B O 1 ATOM 2111 C CB . PHE B 1 24 ? 21.231 36.970 1.349 1.00 15.65 ? 24 PHE B CB 1 ATOM 2112 C CG . PHE B 1 24 ? 19.894 36.251 1.457 1.00 12.93 ? 24 PHE B CG 1 ATOM 2113 C CD1 . PHE B 1 24 ? 18.834 36.482 0.637 1.00 15.03 ? 24 PHE B CD1 1 ATOM 2114 C CD2 . PHE B 1 24 ? 19.747 35.341 2.478 1.00 16.22 ? 24 PHE B CD2 1 ATOM 2115 C CE1 . PHE B 1 24 ? 17.634 35.841 0.842 1.00 17.22 ? 24 PHE B CE1 1 ATOM 2116 C CE2 . PHE B 1 24 ? 18.563 34.690 2.666 1.00 16.69 ? 24 PHE B CE2 1 ATOM 2117 C CZ . PHE B 1 24 ? 17.489 34.941 1.857 1.00 17.21 ? 24 PHE B CZ 1 ATOM 2118 N N . LYS B 1 25 ? 21.684 36.863 -1.713 1.00 14.17 ? 25 LYS B N 1 ATOM 2119 C CA . LYS B 1 25 ? 21.361 36.563 -3.114 1.00 14.87 ? 25 LYS B CA 1 ATOM 2120 C C . LYS B 1 25 ? 22.411 35.702 -3.821 1.00 14.35 ? 25 LYS B C 1 ATOM 2121 O O . LYS B 1 25 ? 22.095 34.717 -4.477 1.00 15.29 ? 25 LYS B O 1 ATOM 2122 C CB . LYS B 1 25 ? 21.134 37.864 -3.902 1.00 15.41 ? 25 LYS B CB 1 ATOM 2123 C CG . LYS B 1 25 ? 20.654 37.688 -5.325 1.00 17.19 ? 25 LYS B CG 1 ATOM 2124 C CD . LYS B 1 25 ? 20.384 39.014 -5.969 1.00 17.28 ? 25 LYS B CD 1 ATOM 2125 C CE . LYS B 1 25 ? 20.080 38.961 -7.452 1.00 22.97 ? 25 LYS B CE 1 ATOM 2126 N NZ . LYS B 1 25 ? 19.164 37.848 -7.776 1.00 36.08 ? 25 LYS B NZ 1 ATOM 2127 N N . THR B 1 26 ? 23.650 36.136 -3.700 1.00 13.98 ? 26 THR B N 1 ATOM 2128 C CA . THR B 1 26 ? 24.803 35.546 -4.324 1.00 16.61 ? 26 THR B CA 1 ATOM 2129 C C . THR B 1 26 ? 24.946 34.104 -3.860 1.00 15.30 ? 26 THR B C 1 ATOM 2130 O O . THR B 1 26 ? 25.089 33.217 -4.690 1.00 15.83 ? 26 THR B O 1 ATOM 2131 C CB . THR B 1 26 ? 26.068 36.362 -3.992 1.00 22.22 ? 26 THR B CB 1 ATOM 2132 O OG1 . THR B 1 26 ? 25.891 37.640 -4.614 1.00 22.32 ? 26 THR B OG1 1 ATOM 2133 C CG2 . THR B 1 26 ? 27.281 35.670 -4.582 1.00 27.94 ? 26 THR B CG2 1 ATOM 2134 N N . ASP B 1 27 ? 24.878 33.900 -2.542 1.00 16.26 ? 27 ASP B N 1 ATOM 2135 C CA . ASP B 1 27 ? 25.084 32.542 -2.030 1.00 14.97 ? 27 ASP B CA 1 ATOM 2136 C C . ASP B 1 27 ? 23.908 31.656 -2.402 1.00 14.98 ? 27 ASP B C 1 ATOM 2137 O O . ASP B 1 27 ? 24.121 30.475 -2.670 1.00 15.59 ? 27 ASP B O 1 ATOM 2138 C CB . ASP B 1 27 ? 25.344 32.602 -0.542 1.00 17.41 ? 27 ASP B CB 1 ATOM 2139 C CG . ASP B 1 27 ? 26.771 33.060 -0.264 1.00 19.91 ? 27 ASP B CG 1 ATOM 2140 O OD1 . ASP B 1 27 ? 27.617 33.222 -1.148 1.00 23.15 ? 27 ASP B OD1 1 ATOM 2141 O OD2 . ASP B 1 27 ? 27.070 33.257 0.914 1.00 20.03 ? 27 ASP B OD2 1 ATOM 2142 N N . LEU B 1 28 ? 22.644 32.114 -2.428 1.00 15.14 ? 28 LEU B N 1 ATOM 2143 C CA . LEU B 1 28 ? 21.561 31.255 -2.878 1.00 13.62 ? 28 LEU B CA 1 ATOM 2144 C C . LEU B 1 28 ? 21.636 30.963 -4.361 1.00 14.86 ? 28 LEU B C 1 ATOM 2145 O O . LEU B 1 28 ? 21.345 29.859 -4.795 1.00 16.88 ? 28 LEU B O 1 ATOM 2146 C CB . LEU B 1 28 ? 20.220 31.904 -2.579 1.00 13.87 ? 28 LEU B CB 1 ATOM 2147 C CG . LEU B 1 28 ? 19.832 32.084 -1.119 1.00 14.02 ? 28 LEU B CG 1 ATOM 2148 C CD1 . LEU B 1 28 ? 18.509 32.816 -0.954 1.00 14.36 ? 28 LEU B CD1 1 ATOM 2149 C CD2 . LEU B 1 28 ? 19.779 30.742 -0.383 1.00 13.67 ? 28 LEU B CD2 1 ATOM 2150 N N . GLU B 1 29 ? 22.086 31.902 -5.177 1.00 15.83 ? 29 GLU B N 1 ATOM 2151 C CA . GLU B 1 29 ? 22.239 31.585 -6.591 1.00 14.91 ? 29 GLU B CA 1 ATOM 2152 C C . GLU B 1 29 ? 23.388 30.648 -6.931 1.00 15.81 ? 29 GLU B C 1 ATOM 2153 O O . GLU B 1 29 ? 23.247 29.866 -7.868 1.00 15.40 ? 29 GLU B O 1 ATOM 2154 C CB . GLU B 1 29 ? 22.311 32.889 -7.401 1.00 17.15 ? 29 GLU B CB 1 ATOM 2155 C CG . GLU B 1 29 ? 20.930 33.510 -7.257 1.00 20.03 ? 29 GLU B CG 1 ATOM 2156 C CD . GLU B 1 29 ? 20.706 34.864 -7.874 1.00 20.27 ? 29 GLU B CD 1 ATOM 2157 O OE1 . GLU B 1 29 ? 21.635 35.472 -8.442 1.00 26.14 ? 29 GLU B OE1 1 ATOM 2158 O OE2 . GLU B 1 29 ? 19.542 35.331 -7.774 1.00 24.33 ? 29 GLU B OE2 1 ATOM 2159 N N . LYS B 1 30 ? 24.449 30.665 -6.147 1.00 16.80 ? 30 LYS B N 1 ATOM 2160 C CA . LYS B 1 30 ? 25.496 29.666 -6.259 1.00 17.07 ? 30 LYS B CA 1 ATOM 2161 C C . LYS B 1 30 ? 24.917 28.270 -6.016 1.00 14.46 ? 30 LYS B C 1 ATOM 2162 O O . LYS B 1 30 ? 25.179 27.360 -6.784 1.00 17.97 ? 30 LYS B O 1 ATOM 2163 C CB . LYS B 1 30 ? 26.636 29.930 -5.288 1.00 22.65 ? 30 LYS B CB 1 ATOM 2164 C CG . LYS B 1 30 ? 27.435 31.184 -5.601 1.00 31.43 ? 30 LYS B CG 1 ATOM 2165 C CD . LYS B 1 30 ? 28.912 30.932 -5.841 1.00 36.79 ? 30 LYS B CD 1 ATOM 2166 C CE . LYS B 1 30 ? 29.679 32.213 -6.112 1.00 42.72 ? 30 LYS B CE 1 ATOM 2167 N NZ . LYS B 1 30 ? 30.763 32.500 -5.126 1.00 49.74 ? 30 LYS B NZ 1 ATOM 2168 N N . LEU B 1 31 ? 24.176 28.121 -4.943 1.00 13.94 ? 31 LEU B N 1 ATOM 2169 C CA . LEU B 1 31 ? 23.478 26.880 -4.609 1.00 14.21 ? 31 LEU B CA 1 ATOM 2170 C C . LEU B 1 31 ? 22.584 26.436 -5.755 1.00 14.46 ? 31 LEU B C 1 ATOM 2171 O O . LEU B 1 31 ? 22.554 25.250 -6.146 1.00 15.61 ? 31 LEU B O 1 ATOM 2172 C CB . LEU B 1 31 ? 22.690 27.058 -3.293 1.00 17.56 ? 31 LEU B CB 1 ATOM 2173 C CG . LEU B 1 31 ? 22.911 26.282 -2.047 1.00 27.65 ? 31 LEU B CG 1 ATOM 2174 C CD1 . LEU B 1 31 ? 24.255 25.679 -1.741 1.00 19.09 ? 31 LEU B CD1 1 ATOM 2175 C CD2 . LEU B 1 31 ? 22.519 27.215 -0.854 1.00 22.60 ? 31 LEU B CD2 1 ATOM 2176 N N . GLU B 1 32 ? 21.813 27.351 -6.321 1.00 14.53 ? 32 GLU B N 1 ATOM 2177 C CA . GLU B 1 32 ? 20.926 27.047 -7.449 1.00 14.29 ? 32 GLU B CA 1 ATOM 2178 C C . GLU B 1 32 ? 21.688 26.453 -8.626 1.00 15.48 ? 32 GLU B C 1 ATOM 2179 O O . GLU B 1 32 ? 21.326 25.415 -9.229 1.00 15.93 ? 32 GLU B O 1 ATOM 2180 C CB . GLU B 1 32 ? 20.160 28.301 -7.870 1.00 16.27 ? 32 GLU B CB 1 ATOM 2181 C CG . GLU B 1 32 ? 19.017 28.660 -6.994 1.00 14.42 ? 32 GLU B CG 1 ATOM 2182 C CD . GLU B 1 32 ? 18.141 29.790 -7.457 1.00 17.15 ? 32 GLU B CD 1 ATOM 2183 O OE1 . GLU B 1 32 ? 18.601 30.582 -8.299 1.00 30.31 ? 32 GLU B OE1 1 ATOM 2184 O OE2 . GLU B 1 32 ? 16.980 29.859 -7.046 1.00 15.91 ? 32 GLU B OE2 1 ATOM 2185 N N . ARG B 1 33 ? 22.792 27.091 -9.010 1.00 15.49 ? 33 ARG B N 1 ATOM 2186 C CA . ARG B 1 33 ? 23.516 26.621 -10.170 1.00 18.91 ? 33 ARG B CA 1 ATOM 2187 C C . ARG B 1 33 ? 24.201 25.287 -9.932 1.00 18.22 ? 33 ARG B C 1 ATOM 2188 O O . ARG B 1 33 ? 24.182 24.372 -10.747 1.00 22.57 ? 33 ARG B O 1 ATOM 2189 C CB . ARG B 1 33 ? 24.580 27.673 -10.530 1.00 20.78 ? 33 ARG B CB 1 ATOM 2190 C CG . ARG B 1 33 ? 23.971 28.935 -11.117 1.00 22.91 ? 33 ARG B CG 1 ATOM 2191 C CD . ARG B 1 33 ? 25.084 29.718 -11.805 1.00 25.66 ? 33 ARG B CD 1 ATOM 2192 N NE . ARG B 1 33 ? 26.082 30.180 -10.853 1.00 23.41 ? 33 ARG B NE 1 ATOM 2193 C CZ . ARG B 1 33 ? 26.019 31.293 -10.131 1.00 24.28 ? 33 ARG B CZ 1 ATOM 2194 N NH1 . ARG B 1 33 ? 24.976 32.094 -10.244 1.00 26.47 ? 33 ARG B NH1 1 ATOM 2195 N NH2 . ARG B 1 33 ? 27.008 31.599 -9.288 1.00 27.07 ? 33 ARG B NH2 1 ATOM 2196 N N . GLU B 1 34 ? 24.847 25.179 -8.771 1.00 17.53 ? 34 GLU B N 1 ATOM 2197 C CA . GLU B 1 34 ? 25.618 23.990 -8.476 1.00 20.16 ? 34 GLU B CA 1 ATOM 2198 C C . GLU B 1 34 ? 24.742 22.774 -8.217 1.00 20.04 ? 34 GLU B C 1 ATOM 2199 O O . GLU B 1 34 ? 25.237 21.669 -8.483 1.00 25.75 ? 34 GLU B O 1 ATOM 2200 C CB . GLU B 1 34 ? 26.548 24.296 -7.301 1.00 19.76 ? 34 GLU B CB 1 ATOM 2201 C CG . GLU B 1 34 ? 27.600 25.338 -7.730 1.00 24.89 ? 34 GLU B CG 1 ATOM 2202 C CD . GLU B 1 34 ? 28.513 25.675 -6.555 1.00 31.76 ? 34 GLU B CD 1 ATOM 2203 O OE1 . GLU B 1 34 ? 28.229 25.114 -5.482 1.00 45.83 ? 34 GLU B OE1 1 ATOM 2204 O OE2 . GLU B 1 34 ? 29.482 26.456 -6.644 1.00 46.77 ? 34 GLU B OE2 1 ATOM 2205 N N . LYS B 1 35 ? 23.514 22.949 -7.736 1.00 16.53 ? 35 LYS B N 1 ATOM 2206 C CA . LYS B 1 35 ? 22.559 21.881 -7.420 1.00 17.75 ? 35 LYS B CA 1 ATOM 2207 C C . LYS B 1 35 ? 21.489 21.742 -8.485 1.00 19.54 ? 35 LYS B C 1 ATOM 2208 O O . LYS B 1 35 ? 20.593 20.885 -8.360 1.00 20.47 ? 35 LYS B O 1 ATOM 2209 C CB . LYS B 1 35 ? 21.924 22.117 -6.035 1.00 18.80 ? 35 LYS B CB 1 ATOM 2210 C CG . LYS B 1 35 ? 22.744 21.781 -4.832 1.00 19.56 ? 35 LYS B CG 1 ATOM 2211 C CD . LYS B 1 35 ? 23.919 22.692 -4.569 1.00 24.12 ? 35 LYS B CD 1 ATOM 2212 C CE . LYS B 1 35 ? 24.655 22.247 -3.313 1.00 18.92 ? 35 LYS B CE 1 ATOM 2213 N NZ . LYS B 1 35 ? 26.018 22.844 -3.222 1.00 27.18 ? 35 LYS B NZ 1 ATOM 2214 N N . ALA B 1 36 ? 21.530 22.571 -9.513 1.00 16.88 ? 36 ALA B N 1 ATOM 2215 C CA . ALA B 1 36 ? 20.487 22.538 -10.553 1.00 17.31 ? 36 ALA B CA 1 ATOM 2216 C C . ALA B 1 36 ? 19.100 22.666 -9.918 1.00 17.08 ? 36 ALA B C 1 ATOM 2217 O O . ALA B 1 36 ? 18.206 21.902 -10.201 1.00 20.64 ? 36 ALA B O 1 ATOM 2218 C CB . ALA B 1 36 ? 20.576 21.294 -11.430 1.00 20.88 ? 36 ALA B CB 1 ATOM 2219 N N . ALA B 1 37 ? 18.963 23.663 -9.060 1.00 17.72 ? 37 ALA B N 1 ATOM 2220 C CA . ALA B 1 37 ? 17.811 23.839 -8.199 1.00 13.99 ? 37 ALA B CA 1 ATOM 2221 C C . ALA B 1 37 ? 17.249 25.248 -8.340 1.00 14.11 ? 37 ALA B C 1 ATOM 2222 O O . ALA B 1 37 ? 17.972 26.180 -8.714 1.00 15.03 ? 37 ALA B O 1 ATOM 2223 C CB . ALA B 1 37 ? 18.215 23.569 -6.757 1.00 16.14 ? 37 ALA B CB 1 ATOM 2224 N N . GLN B 1 38 ? 15.981 25.386 -8.000 1.00 14.44 ? 38 GLN B N 1 ATOM 2225 C CA . GLN B 1 38 ? 15.360 26.682 -7.780 1.00 13.69 ? 38 GLN B CA 1 ATOM 2226 C C . GLN B 1 38 ? 15.032 26.811 -6.299 1.00 12.67 ? 38 GLN B C 1 ATOM 2227 O O . GLN B 1 38 ? 14.488 25.872 -5.709 1.00 13.40 ? 38 GLN B O 1 ATOM 2228 C CB . GLN B 1 38 ? 14.088 26.880 -8.604 1.00 17.04 ? 38 GLN B CB 1 ATOM 2229 C CG . GLN B 1 38 ? 14.385 26.740 -10.085 1.00 26.71 ? 38 GLN B CG 1 ATOM 2230 C CD . GLN B 1 38 ? 13.397 27.538 -10.899 1.00 36.08 ? 38 GLN B CD 1 ATOM 2231 O OE1 . GLN B 1 38 ? 13.779 28.393 -11.696 1.00 62.31 ? 38 GLN B OE1 1 ATOM 2232 N NE2 . GLN B 1 38 ? 12.119 27.246 -10.707 1.00 52.10 ? 38 GLN B NE2 1 ATOM 2233 N N . ILE B 1 39 ? 15.393 27.953 -5.722 1.00 11.12 ? 39 ILE B N 1 ATOM 2234 C CA . ILE B 1 39 ? 15.256 28.209 -4.312 1.00 11.05 ? 39 ILE B CA 1 ATOM 2235 C C . ILE B 1 39 ? 14.418 29.476 -4.123 1.00 11.44 ? 39 ILE B C 1 ATOM 2236 O O . ILE B 1 39 ? 14.829 30.569 -4.506 1.00 13.06 ? 39 ILE B O 1 ATOM 2237 C CB . ILE B 1 39 ? 16.626 28.327 -3.613 1.00 11.82 ? 39 ILE B CB 1 ATOM 2238 C CG1 . ILE B 1 39 ? 17.453 27.048 -3.733 1.00 13.79 ? 39 ILE B CG1 1 ATOM 2239 C CG2 . ILE B 1 39 ? 16.455 28.716 -2.149 1.00 14.70 ? 39 ILE B CG2 1 ATOM 2240 C CD1 . ILE B 1 39 ? 18.929 27.234 -3.371 1.00 14.69 ? 39 ILE B CD1 1 ATOM 2241 N N . GLY B 1 40 ? 13.271 29.288 -3.493 1.00 10.23 ? 40 GLY B N 1 ATOM 2242 C CA . GLY B 1 40 ? 12.385 30.379 -3.142 1.00 10.42 ? 40 GLY B CA 1 ATOM 2243 C C . GLY B 1 40 ? 12.367 30.570 -1.642 1.00 9.94 ? 40 GLY B C 1 ATOM 2244 O O . GLY B 1 40 ? 12.209 29.636 -0.857 1.00 11.41 ? 40 GLY B O 1 ATOM 2245 N N . VAL B 1 41 ? 12.618 31.823 -1.227 1.00 8.83 ? 41 VAL B N 1 ATOM 2246 C CA . VAL B 1 41 ? 12.695 32.140 0.181 1.00 8.73 ? 41 VAL B CA 1 ATOM 2247 C C . VAL B 1 41 ? 11.964 33.443 0.431 1.00 8.45 ? 41 VAL B C 1 ATOM 2248 O O . VAL B 1 41 ? 12.099 34.391 -0.349 1.00 9.69 ? 41 VAL B O 1 ATOM 2249 C CB . VAL B 1 41 ? 14.133 32.364 0.657 1.00 10.29 ? 41 VAL B CB 1 ATOM 2250 C CG1 . VAL B 1 41 ? 14.196 32.685 2.142 1.00 11.52 ? 41 VAL B CG1 1 ATOM 2251 C CG2 . VAL B 1 41 ? 15.029 31.177 0.346 1.00 12.53 ? 41 VAL B CG2 1 ATOM 2252 N N . ALA B 1 42 ? 11.259 33.537 1.533 1.00 8.69 ? 42 ALA B N 1 ATOM 2253 C CA . ALA B 1 42 ? 10.839 34.824 2.022 1.00 8.04 ? 42 ALA B CA 1 ATOM 2254 C C . ALA B 1 42 ? 10.969 34.801 3.558 1.00 8.47 ? 42 ALA B C 1 ATOM 2255 O O . ALA B 1 42 ? 10.557 33.845 4.203 1.00 9.52 ? 42 ALA B O 1 ATOM 2256 C CB . ALA B 1 42 ? 9.418 35.186 1.611 1.00 9.51 ? 42 ALA B CB 1 ATOM 2257 N N . ILE B 1 43 ? 11.510 35.873 4.114 1.00 9.06 ? 43 ILE B N 1 ATOM 2258 C CA . ILE B 1 43 ? 11.577 36.091 5.555 1.00 8.61 ? 43 ILE B CA 1 ATOM 2259 C C . ILE B 1 43 ? 10.826 37.395 5.829 1.00 8.76 ? 43 ILE B C 1 ATOM 2260 O O . ILE B 1 43 ? 11.135 38.399 5.152 1.00 9.90 ? 43 ILE B O 1 ATOM 2261 C CB . ILE B 1 43 ? 13.015 36.214 6.079 1.00 9.95 ? 43 ILE B CB 1 ATOM 2262 C CG1 . ILE B 1 43 ? 13.898 35.047 5.681 1.00 11.08 ? 43 ILE B CG1 1 ATOM 2263 C CG2 . ILE B 1 43 ? 13.046 36.386 7.599 1.00 10.84 ? 43 ILE B CG2 1 ATOM 2264 C CD1 . ILE B 1 43 ? 15.334 35.303 5.957 1.00 19.97 ? 43 ILE B CD1 1 ATOM 2265 N N . VAL B 1 44 ? 9.862 37.359 6.749 1.00 8.48 ? 44 VAL B N 1 ATOM 2266 C CA . VAL B 1 44 ? 9.120 38.574 7.110 1.00 9.05 ? 44 VAL B CA 1 ATOM 2267 C C . VAL B 1 44 ? 9.139 38.755 8.607 1.00 9.06 ? 44 VAL B C 1 ATOM 2268 O O . VAL B 1 44 ? 9.301 37.834 9.405 1.00 9.87 ? 44 VAL B O 1 ATOM 2269 C CB . VAL B 1 44 ? 7.665 38.580 6.564 1.00 9.58 ? 44 VAL B CB 1 ATOM 2270 C CG1 . VAL B 1 44 ? 7.694 38.442 5.050 1.00 10.38 ? 44 VAL B CG1 1 ATOM 2271 C CG2 . VAL B 1 44 ? 6.769 37.531 7.168 1.00 11.18 ? 44 VAL B CG2 1 ATOM 2272 N N . ASP B 1 45 ? 8.903 40.020 9.009 1.00 10.28 ? 45 ASP B N 1 ATOM 2273 C CA . ASP B 1 45 ? 8.710 40.316 10.426 1.00 10.55 ? 45 ASP B CA 1 ATOM 2274 C C . ASP B 1 45 ? 7.278 40.021 10.859 1.00 9.75 ? 45 ASP B C 1 ATOM 2275 O O . ASP B 1 45 ? 6.488 39.535 10.022 1.00 11.52 ? 45 ASP B O 1 ATOM 2276 C CB . ASP B 1 45 ? 9.195 41.779 10.626 1.00 11.17 ? 45 ASP B CB 1 ATOM 2277 C CG . ASP B 1 45 ? 8.191 42.841 10.307 1.00 11.87 ? 45 ASP B CG 1 ATOM 2278 O OD1 . ASP B 1 45 ? 7.019 42.569 9.902 1.00 13.51 ? 45 ASP B OD1 1 ATOM 2279 O OD2 . ASP B 1 45 ? 8.598 44.035 10.461 1.00 19.42 ? 45 ASP B OD2 1 ATOM 2280 N N . PRO B 1 46 ? 6.929 40.206 12.113 1.00 10.90 ? 46 PRO B N 1 ATOM 2281 C CA . PRO B 1 46 ? 5.585 39.808 12.558 1.00 11.56 ? 46 PRO B CA 1 ATOM 2282 C C . PRO B 1 46 ? 4.408 40.466 11.864 1.00 12.31 ? 46 PRO B C 1 ATOM 2283 O O . PRO B 1 46 ? 3.339 39.857 11.868 1.00 14.24 ? 46 PRO B O 1 ATOM 2284 C CB . PRO B 1 46 ? 5.630 40.177 14.046 1.00 13.98 ? 46 PRO B CB 1 ATOM 2285 C CG . PRO B 1 46 ? 7.078 40.032 14.436 1.00 14.82 ? 46 PRO B CG 1 ATOM 2286 C CD . PRO B 1 46 ? 7.763 40.582 13.254 1.00 12.96 ? 46 PRO B CD 1 ATOM 2287 N N . GLN B 1 47 ? 4.634 41.640 11.319 1.00 12.49 ? 47 GLN B N 1 ATOM 2288 C CA . GLN B 1 47 ? 3.604 42.364 10.584 1.00 14.12 ? 47 GLN B CA 1 ATOM 2289 C C . GLN B 1 47 ? 3.643 42.086 9.085 1.00 15.34 ? 47 GLN B C 1 ATOM 2290 O O . GLN B 1 47 ? 2.904 42.691 8.285 1.00 16.78 ? 47 GLN B O 1 ATOM 2291 C CB . GLN B 1 47 ? 3.748 43.872 10.847 1.00 19.45 ? 47 GLN B CB 1 ATOM 2292 C CG . GLN B 1 47 ? 3.240 44.273 12.223 1.00 25.40 ? 47 GLN B CG 1 ATOM 2293 C CD . GLN B 1 47 ? 4.216 43.835 13.302 1.00 28.76 ? 47 GLN B CD 1 ATOM 2294 O OE1 . GLN B 1 47 ? 5.385 44.199 13.302 1.00 41.30 ? 47 GLN B OE1 1 ATOM 2295 N NE2 . GLN B 1 47 ? 3.706 43.026 14.227 1.00 40.67 ? 47 GLN B NE2 1 ATOM 2296 N N . GLY B 1 48 ? 4.511 41.189 8.633 1.00 13.16 ? 48 GLY B N 1 ATOM 2297 C CA . GLY B 1 48 ? 4.571 40.850 7.240 1.00 13.54 ? 48 GLY B CA 1 ATOM 2298 C C . GLY B 1 48 ? 5.536 41.674 6.440 1.00 11.66 ? 48 GLY B C 1 ATOM 2299 O O . GLY B 1 48 ? 5.580 41.510 5.211 1.00 13.52 ? 48 GLY B O 1 ATOM 2300 N N . GLU B 1 49 ? 6.332 42.532 7.053 1.00 11.57 ? 49 GLU B N 1 ATOM 2301 C CA . GLU B 1 49 ? 7.270 43.355 6.300 1.00 13.59 ? 49 GLU B CA 1 ATOM 2302 C C . GLU B 1 49 ? 8.463 42.506 5.895 1.00 10.73 ? 49 GLU B C 1 ATOM 2303 O O . GLU B 1 49 ? 8.949 41.675 6.647 1.00 11.79 ? 49 GLU B O 1 ATOM 2304 C CB . GLU B 1 49 ? 7.783 44.538 7.112 1.00 16.83 ? 49 GLU B CB 1 ATOM 2305 C CG . GLU B 1 49 ? 6.694 45.496 7.596 1.00 23.54 ? 49 GLU B CG 1 ATOM 2306 C CD . GLU B 1 49 ? 5.945 46.047 6.392 0.61 30.85 ? 49 GLU B CD 1 ATOM 2307 O OE1 . GLU B 1 49 ? 6.601 46.419 5.398 0.61 30.72 ? 49 GLU B OE1 1 ATOM 2308 O OE2 . GLU B 1 49 ? 4.699 46.082 6.467 0.61 40.79 ? 49 GLU B OE2 1 ATOM 2309 N N . ILE B 1 50 ? 8.932 42.709 4.684 1.00 11.87 ? 50 ILE B N 1 ATOM 2310 C CA . ILE B 1 50 ? 10.005 41.893 4.092 1.00 11.39 ? 50 ILE B CA 1 ATOM 2311 C C . ILE B 1 50 ? 11.321 42.152 4.796 1.00 11.18 ? 50 ILE B C 1 ATOM 2312 O O . ILE B 1 50 ? 11.757 43.291 4.926 1.00 15.17 ? 50 ILE B O 1 ATOM 2313 C CB . ILE B 1 50 ? 10.112 42.087 2.568 1.00 13.47 ? 50 ILE B CB 1 ATOM 2314 C CG1 . ILE B 1 50 ? 8.859 41.601 1.844 1.00 16.19 ? 50 ILE B CG1 1 ATOM 2315 C CG2 . ILE B 1 50 ? 11.348 41.409 1.972 1.00 16.46 ? 50 ILE B CG2 1 ATOM 2316 C CD1 . ILE B 1 50 ? 8.550 42.242 0.530 1.00 22.35 ? 50 ILE B CD1 1 ATOM 2317 N N . VAL B 1 51 ? 11.950 41.092 5.236 1.00 10.85 ? 51 VAL B N 1 ATOM 2318 C CA . VAL B 1 51 ? 13.311 41.075 5.739 1.00 11.48 ? 51 VAL B CA 1 ATOM 2319 C C . VAL B 1 51 ? 14.252 40.710 4.610 1.00 12.72 ? 51 VAL B C 1 ATOM 2320 O O . VAL B 1 51 ? 15.261 41.428 4.416 1.00 17.15 ? 51 VAL B O 1 ATOM 2321 C CB . VAL B 1 51 ? 13.433 40.147 6.941 1.00 12.30 ? 51 VAL B CB 1 ATOM 2322 C CG1 . VAL B 1 51 ? 14.849 40.016 7.410 1.00 14.98 ? 51 VAL B CG1 1 ATOM 2323 C CG2 . VAL B 1 51 ? 12.534 40.670 8.064 1.00 12.60 ? 51 VAL B CG2 1 ATOM 2324 N N . ALA B 1 52 ? 13.979 39.632 3.871 1.00 11.41 ? 52 ALA B N 1 ATOM 2325 C CA . ALA B 1 52 ? 14.799 39.200 2.755 1.00 11.60 ? 52 ALA B CA 1 ATOM 2326 C C . ALA B 1 52 ? 14.047 38.155 1.933 1.00 11.34 ? 52 ALA B C 1 ATOM 2327 O O . ALA B 1 52 ? 13.093 37.563 2.448 1.00 12.13 ? 52 ALA B O 1 ATOM 2328 C CB . ALA B 1 52 ? 16.134 38.615 3.196 1.00 18.30 ? 52 ALA B CB 1 ATOM 2329 N N . GLY B 1 53 ? 14.484 37.940 0.727 1.00 11.55 ? 53 GLY B N 1 ATOM 2330 C CA . GLY B 1 53 ? 13.850 36.907 -0.076 1.00 11.59 ? 53 GLY B CA 1 ATOM 2331 C C . GLY B 1 53 ? 14.571 36.585 -1.358 1.00 11.02 ? 53 GLY B C 1 ATOM 2332 O O . GLY B 1 53 ? 15.516 37.292 -1.703 1.00 13.76 ? 53 GLY B O 1 ATOM 2333 N N . HIS B 1 54 ? 14.112 35.553 -2.022 1.00 11.51 ? 54 HIS B N 1 ATOM 2334 C CA . HIS B 1 54 ? 14.713 35.085 -3.255 1.00 11.57 ? 54 HIS B CA 1 ATOM 2335 C C . HIS B 1 54 ? 13.598 34.371 -4.034 1.00 11.25 ? 54 HIS B C 1 ATOM 2336 O O . HIS B 1 54 ? 12.906 33.555 -3.441 1.00 12.22 ? 54 HIS B O 1 ATOM 2337 C CB . HIS B 1 54 ? 15.901 34.173 -2.985 1.00 12.06 ? 54 HIS B CB 1 ATOM 2338 C CG . HIS B 1 54 ? 16.677 33.833 -4.231 1.00 13.39 ? 54 HIS B CG 1 ATOM 2339 N ND1 . HIS B 1 54 ? 17.569 34.645 -4.844 1.00 18.95 ? 54 HIS B ND1 1 ATOM 2340 C CD2 . HIS B 1 54 ? 16.589 32.696 -4.979 1.00 14.08 ? 54 HIS B CD2 1 ATOM 2341 C CE1 . HIS B 1 54 ? 18.007 34.015 -5.892 1.00 18.34 ? 54 HIS B CE1 1 ATOM 2342 N NE2 . HIS B 1 54 ? 17.466 32.827 -6.011 1.00 18.79 ? 54 HIS B NE2 1 ATOM 2343 N N . ARG B 1 55 ? 13.374 34.716 -5.278 1.00 12.59 ? 55 ARG B N 1 ATOM 2344 C CA . ARG B 1 55 ? 12.314 34.180 -6.104 1.00 12.09 ? 55 ARG B CA 1 ATOM 2345 C C . ARG B 1 55 ? 11.015 34.320 -5.333 1.00 11.55 ? 55 ARG B C 1 ATOM 2346 O O . ARG B 1 55 ? 10.114 33.459 -5.349 1.00 13.44 ? 55 ARG B O 1 ATOM 2347 C CB . ARG B 1 55 ? 12.518 32.716 -6.518 1.00 13.55 ? 55 ARG B CB 1 ATOM 2348 C CG . ARG B 1 55 ? 13.702 32.559 -7.459 1.00 16.29 ? 55 ARG B CG 1 ATOM 2349 C CD . ARG B 1 55 ? 13.803 31.057 -7.802 1.00 15.16 ? 55 ARG B CD 1 ATOM 2350 N NE . ARG B 1 55 ? 14.997 30.840 -8.625 1.00 18.93 ? 55 ARG B NE 1 ATOM 2351 C CZ . ARG B 1 55 ? 15.026 30.998 -9.946 1.00 22.64 ? 55 ARG B CZ 1 ATOM 2352 N NH1 . ARG B 1 55 ? 13.922 31.397 -10.600 1.00 25.04 ? 55 ARG B NH1 1 ATOM 2353 N NH2 . ARG B 1 55 ? 16.145 30.777 -10.644 1.00 29.18 ? 55 ARG B NH2 1 ATOM 2354 N N . MET B 1 56 ? 10.841 35.450 -4.626 1.00 12.71 ? 56 MET B N 1 ATOM 2355 C CA . MET B 1 56 ? 9.806 35.393 -3.575 1.00 14.85 ? 56 MET B CA 1 ATOM 2356 C C . MET B 1 56 ? 8.413 35.478 -4.145 1.00 12.56 ? 56 MET B C 1 ATOM 2357 O O . MET B 1 56 ? 7.457 35.115 -3.437 1.00 14.94 ? 56 MET B O 1 ATOM 2358 C CB . MET B 1 56 ? 10.083 36.400 -2.443 1.00 16.57 ? 56 MET B CB 1 ATOM 2359 C CG . MET B 1 56 ? 9.672 37.797 -2.857 1.00 18.83 ? 56 MET B CG 1 ATOM 2360 S SD . MET B 1 56 ? 10.052 38.836 -1.396 1.00 33.54 ? 56 MET B SD 1 ATOM 2361 C CE . MET B 1 56 ? 11.726 39.153 -1.826 1.00 28.41 ? 56 MET B CE 1 ATOM 2362 N N . ALA B 1 57 ? 8.250 35.885 -5.397 1.00 14.02 ? 57 ALA B N 1 ATOM 2363 C CA . ALA B 1 57 ? 6.967 35.994 -6.028 1.00 14.74 ? 57 ALA B CA 1 ATOM 2364 C C . ALA B 1 57 ? 6.722 34.903 -7.064 1.00 13.08 ? 57 ALA B C 1 ATOM 2365 O O . ALA B 1 57 ? 5.739 34.886 -7.789 1.00 15.68 ? 57 ALA B O 1 ATOM 2366 C CB . ALA B 1 57 ? 6.825 37.378 -6.659 1.00 21.64 ? 57 ALA B CB 1 ATOM 2367 N N . GLN B 1 58 ? 7.545 33.864 -7.096 1.00 11.99 ? 58 GLN B N 1 ATOM 2368 C CA . GLN B 1 58 ? 7.398 32.727 -7.972 1.00 11.71 ? 58 GLN B CA 1 ATOM 2369 C C . GLN B 1 58 ? 6.595 31.624 -7.306 1.00 11.41 ? 58 GLN B C 1 ATOM 2370 O O . GLN B 1 58 ? 6.732 31.372 -6.088 1.00 10.65 ? 58 GLN B O 1 ATOM 2371 C CB A GLN B 1 58 ? 8.808 32.300 -8.334 0.48 12.16 ? 58 GLN B CB 1 ATOM 2372 C CB B GLN B 1 58 ? 8.768 32.186 -8.367 0.52 12.20 ? 58 GLN B CB 1 ATOM 2373 C CG A GLN B 1 58 ? 9.047 30.965 -8.980 0.48 15.98 ? 58 GLN B CG 1 ATOM 2374 C CG B GLN B 1 58 ? 9.467 33.293 -9.115 0.52 15.44 ? 58 GLN B CG 1 ATOM 2375 C CD A GLN B 1 58 ? 10.471 30.738 -9.440 0.48 18.47 ? 58 GLN B CD 1 ATOM 2376 C CD B GLN B 1 58 ? 10.815 33.049 -9.694 0.52 14.88 ? 58 GLN B CD 1 ATOM 2377 O OE1 A GLN B 1 58 ? 11.241 31.639 -9.757 0.48 18.34 ? 58 GLN B OE1 1 ATOM 2378 O OE1 B GLN B 1 58 ? 11.268 31.946 -9.966 0.52 18.57 ? 58 GLN B OE1 1 ATOM 2379 N NE2 A GLN B 1 58 ? 10.841 29.462 -9.505 0.48 18.43 ? 58 GLN B NE2 1 ATOM 2380 N NE2 B GLN B 1 58 ? 11.472 34.198 -9.843 0.52 13.23 ? 58 GLN B NE2 1 ATOM 2381 N N . ARG B 1 59 ? 5.752 30.941 -8.098 1.00 11.88 ? 59 ARG B N 1 ATOM 2382 C CA . ARG B 1 59 ? 4.942 29.853 -7.569 1.00 11.24 ? 59 ARG B CA 1 ATOM 2383 C C . ARG B 1 59 ? 5.764 28.571 -7.433 1.00 10.63 ? 59 ARG B C 1 ATOM 2384 O O . ARG B 1 59 ? 6.549 28.198 -8.281 1.00 12.16 ? 59 ARG B O 1 ATOM 2385 C CB . ARG B 1 59 ? 3.715 29.572 -8.453 1.00 13.73 ? 59 ARG B CB 1 ATOM 2386 C CG . ARG B 1 59 ? 2.609 30.591 -8.211 1.00 21.94 ? 59 ARG B CG 1 ATOM 2387 C CD . ARG B 1 59 ? 1.284 30.206 -8.794 1.00 22.55 ? 59 ARG B CD 1 ATOM 2388 N NE . ARG B 1 59 ? 0.224 31.106 -8.445 1.00 21.26 ? 59 ARG B NE 1 ATOM 2389 C CZ . ARG B 1 59 ? -0.586 31.276 -7.451 1.00 19.79 ? 59 ARG B CZ 1 ATOM 2390 N NH1 . ARG B 1 59 ? -0.690 30.605 -6.299 1.00 25.55 ? 59 ARG B NH1 1 ATOM 2391 N NH2 . ARG B 1 59 ? -1.464 32.283 -7.527 1.00 24.79 ? 59 ARG B NH2 1 ATOM 2392 N N . PHE B 1 60 ? 5.538 27.918 -6.298 1.00 9.80 ? 60 PHE B N 1 ATOM 2393 C CA . PHE B 1 60 ? 6.017 26.610 -5.968 1.00 10.26 ? 60 PHE B CA 1 ATOM 2394 C C . PHE B 1 60 ? 4.916 25.744 -5.405 1.00 10.16 ? 60 PHE B C 1 ATOM 2395 O O . PHE B 1 60 ? 3.995 26.239 -4.740 1.00 10.64 ? 60 PHE B O 1 ATOM 2396 C CB . PHE B 1 60 ? 7.105 26.680 -4.880 1.00 10.36 ? 60 PHE B CB 1 ATOM 2397 C CG . PHE B 1 60 ? 8.397 27.364 -5.274 1.00 9.94 ? 60 PHE B CG 1 ATOM 2398 C CD1 . PHE B 1 60 ? 8.507 28.753 -5.276 1.00 10.78 ? 60 PHE B CD1 1 ATOM 2399 C CD2 . PHE B 1 60 ? 9.497 26.622 -5.672 1.00 11.24 ? 60 PHE B CD2 1 ATOM 2400 C CE1 . PHE B 1 60 ? 9.734 29.316 -5.648 1.00 12.90 ? 60 PHE B CE1 1 ATOM 2401 C CE2 . PHE B 1 60 ? 10.701 27.176 -6.001 1.00 13.26 ? 60 PHE B CE2 1 ATOM 2402 C CZ . PHE B 1 60 ? 10.808 28.562 -5.996 1.00 13.65 ? 60 PHE B CZ 1 ATOM 2403 N N . ALA B 1 61 ? 5.027 24.436 -5.623 1.00 11.83 ? 61 ALA B N 1 ATOM 2404 C CA . ALA B 1 61 ? 4.100 23.488 -5.027 1.00 10.41 ? 61 ALA B CA 1 ATOM 2405 C C . ALA B 1 61 ? 4.227 23.561 -3.516 1.00 10.83 ? 61 ALA B C 1 ATOM 2406 O O . ALA B 1 61 ? 5.327 23.508 -2.945 1.00 11.34 ? 61 ALA B O 1 ATOM 2407 C CB . ALA B 1 61 ? 4.373 22.065 -5.483 1.00 13.22 ? 61 ALA B CB 1 ATOM 2408 N N . MET B 1 62 ? 3.075 23.656 -2.820 1.00 11.36 ? 62 MET B N 1 ATOM 2409 C CA . MET B 1 62 ? 3.132 23.706 -1.356 1.00 10.68 ? 62 MET B CA 1 ATOM 2410 C C . MET B 1 62 ? 3.520 22.406 -0.724 1.00 11.47 ? 62 MET B C 1 ATOM 2411 O O . MET B 1 62 ? 4.163 22.382 0.355 1.00 11.58 ? 62 MET B O 1 ATOM 2412 C CB . MET B 1 62 ? 1.754 24.002 -0.761 1.00 12.62 ? 62 MET B CB 1 ATOM 2413 C CG . MET B 1 62 ? 1.315 25.416 -0.963 1.00 14.24 ? 62 MET B CG 1 ATOM 2414 S SD . MET B 1 62 ? -0.183 25.902 -0.079 1.00 13.03 ? 62 MET B SD 1 ATOM 2415 C CE . MET B 1 62 ? -1.395 24.992 -0.979 1.00 17.34 ? 62 MET B CE 1 ATOM 2416 N N A CYS B 1 63 ? 3.174 21.294 -1.351 0.58 12.68 ? 63 CYS B N 1 ATOM 2417 N N C CYS B 1 63 ? 3.046 21.321 -1.286 0.42 12.62 ? 63 CYS B N 1 ATOM 2418 C CA A CYS B 1 63 ? 3.388 19.991 -0.712 0.58 13.12 ? 63 CYS B CA 1 ATOM 2419 C CA C CYS B 1 63 ? 2.875 19.988 -0.729 0.42 12.99 ? 63 CYS B CA 1 ATOM 2420 C C A CYS B 1 63 ? 2.739 20.011 0.673 0.58 12.48 ? 63 CYS B C 1 ATOM 2421 C C C CYS B 1 63 ? 2.617 20.050 0.769 0.42 11.94 ? 63 CYS B C 1 ATOM 2422 O O A CYS B 1 63 ? 1.737 20.717 0.905 0.58 13.87 ? 63 CYS B O 1 ATOM 2423 O O C CYS B 1 63 ? 1.718 20.817 1.171 0.42 10.13 ? 63 CYS B O 1 ATOM 2424 C CB A CYS B 1 63 ? 4.866 19.611 -0.694 0.33 14.51 ? 63 CYS B CB 1 ATOM 2425 C CB B CYS B 1 63 ? 4.877 19.591 -0.649 0.25 12.74 ? 63 CYS B CB 1 ATOM 2426 C CB C CYS B 1 63 ? 4.022 19.074 -1.137 0.42 14.89 ? 63 CYS B CB 1 ATOM 2427 S SG A CYS B 1 63 ? 5.825 19.925 -2.213 0.33 18.86 ? 63 CYS B SG 1 ATOM 2428 S SG B CYS B 1 63 ? 4.594 17.810 -0.378 0.25 31.25 ? 63 CYS B SG 1 ATOM 2429 S SG C CYS B 1 63 ? 5.673 19.426 -0.548 0.42 18.34 ? 63 CYS B SG 1 ATOM 2430 N N . SER B 1 64 ? 3.297 19.285 1.607 1.00 10.91 ? 64 SER B N 1 ATOM 2431 C CA . SER B 1 64 ? 2.795 19.133 2.967 1.00 10.28 ? 64 SER B CA 1 ATOM 2432 C C . SER B 1 64 ? 2.891 20.403 3.798 1.00 9.16 ? 64 SER B C 1 ATOM 2433 O O . SER B 1 64 ? 2.359 20.423 4.896 1.00 8.95 ? 64 SER B O 1 ATOM 2434 C CB . SER B 1 64 ? 3.502 17.963 3.673 1.00 11.22 ? 64 SER B CB 1 ATOM 2435 O OG . SER B 1 64 ? 3.083 16.749 3.113 1.00 13.43 ? 64 SER B OG 1 ATOM 2436 N N . THR B 1 65 ? 3.565 21.441 3.296 1.00 7.90 ? 65 THR B N 1 ATOM 2437 C CA . THR B 1 65 ? 3.580 22.667 4.077 1.00 8.04 ? 65 THR B CA 1 ATOM 2438 C C . THR B 1 65 ? 2.175 23.213 4.355 1.00 8.33 ? 65 THR B C 1 ATOM 2439 O O . THR B 1 65 ? 1.995 23.902 5.338 1.00 9.07 ? 65 THR B O 1 ATOM 2440 C CB . THR B 1 65 ? 4.453 23.772 3.476 1.00 8.16 ? 65 THR B CB 1 ATOM 2441 O OG1 . THR B 1 65 ? 3.909 24.208 2.212 1.00 10.20 ? 65 THR B OG1 1 ATOM 2442 C CG2 . THR B 1 65 ? 5.873 23.317 3.270 1.00 8.22 ? 65 THR B CG2 1 ATOM 2443 N N . PHE B 1 66 ? 1.231 22.909 3.467 1.00 8.36 ? 66 PHE B N 1 ATOM 2444 C CA . PHE B 1 66 ? -0.116 23.424 3.691 1.00 8.55 ? 66 PHE B CA 1 ATOM 2445 C C . PHE B 1 66 ? -0.745 22.875 4.947 1.00 8.22 ? 66 PHE B C 1 ATOM 2446 O O . PHE B 1 66 ? -1.763 23.406 5.390 1.00 8.61 ? 66 PHE B O 1 ATOM 2447 C CB . PHE B 1 66 ? -0.998 23.133 2.463 1.00 10.68 ? 66 PHE B CB 1 ATOM 2448 C CG . PHE B 1 66 ? -1.845 21.888 2.548 1.00 10.90 ? 66 PHE B CG 1 ATOM 2449 C CD1 . PHE B 1 66 ? -1.380 20.624 2.251 1.00 13.65 ? 66 PHE B CD1 1 ATOM 2450 C CD2 . PHE B 1 66 ? -3.173 21.975 2.995 1.00 13.82 ? 66 PHE B CD2 1 ATOM 2451 C CE1 . PHE B 1 66 ? -2.204 19.540 2.454 1.00 18.02 ? 66 PHE B CE1 1 ATOM 2452 C CE2 . PHE B 1 66 ? -4.006 20.924 3.146 1.00 18.35 ? 66 PHE B CE2 1 ATOM 2453 C CZ . PHE B 1 66 ? -3.516 19.661 2.836 1.00 19.54 ? 66 PHE B CZ 1 ATOM 2454 N N . LYS B 1 67 ? -0.241 21.756 5.499 1.00 8.28 ? 67 LYS B N 1 ATOM 2455 C CA . LYS B 1 67 ? -0.859 21.147 6.667 1.00 8.00 ? 67 LYS B CA 1 ATOM 2456 C C . LYS B 1 67 ? -0.792 22.089 7.858 1.00 6.87 ? 67 LYS B C 1 ATOM 2457 O O . LYS B 1 67 ? -1.618 21.995 8.784 1.00 8.20 ? 67 LYS B O 1 ATOM 2458 C CB . LYS B 1 67 ? -0.179 19.816 6.968 1.00 7.86 ? 67 LYS B CB 1 ATOM 2459 C CG . LYS B 1 67 ? -0.474 18.777 5.892 1.00 8.36 ? 67 LYS B CG 1 ATOM 2460 C CD . LYS B 1 67 ? 0.374 17.567 5.927 1.00 9.18 ? 67 LYS B CD 1 ATOM 2461 C CE . LYS B 1 67 ? 0.082 16.617 4.785 1.00 10.29 ? 67 LYS B CE 1 ATOM 2462 N NZ . LYS B 1 67 ? 1.101 15.595 4.523 1.00 10.77 ? 67 LYS B NZ 1 ATOM 2463 N N . PHE B 1 68 ? 0.174 23.017 7.882 1.00 7.38 ? 68 PHE B N 1 ATOM 2464 C CA . PHE B 1 68 ? 0.201 24.056 8.910 1.00 7.70 ? 68 PHE B CA 1 ATOM 2465 C C . PHE B 1 68 ? -0.974 24.992 8.704 1.00 7.77 ? 68 PHE B C 1 ATOM 2466 O O . PHE B 1 68 ? -1.821 25.108 9.633 1.00 7.82 ? 68 PHE B O 1 ATOM 2467 C CB . PHE B 1 68 ? 1.579 24.687 8.989 1.00 9.24 ? 68 PHE B CB 1 ATOM 2468 C CG . PHE B 1 68 ? 1.657 25.948 9.804 1.00 9.57 ? 68 PHE B CG 1 ATOM 2469 C CD1 . PHE B 1 68 ? 2.565 26.905 9.398 1.00 21.03 ? 68 PHE B CD1 1 ATOM 2470 C CD2 . PHE B 1 68 ? 1.034 26.201 10.964 1.00 13.28 ? 68 PHE B CD2 1 ATOM 2471 C CE1 . PHE B 1 68 ? 2.722 28.057 10.095 1.00 22.94 ? 68 PHE B CE1 1 ATOM 2472 C CE2 . PHE B 1 68 ? 1.051 27.405 11.611 1.00 16.24 ? 68 PHE B CE2 1 ATOM 2473 C CZ . PHE B 1 68 ? 1.925 28.358 11.189 1.00 18.18 ? 68 PHE B CZ 1 ATOM 2474 N N . PRO B 1 69 ? -1.169 25.718 7.616 1.00 8.02 ? 69 PRO B N 1 ATOM 2475 C CA . PRO B 1 69 ? -2.405 26.464 7.388 1.00 8.62 ? 69 PRO B CA 1 ATOM 2476 C C . PRO B 1 69 ? -3.699 25.658 7.622 1.00 8.22 ? 69 PRO B C 1 ATOM 2477 O O . PRO B 1 69 ? -4.673 26.211 8.115 1.00 8.69 ? 69 PRO B O 1 ATOM 2478 C CB . PRO B 1 69 ? -2.260 26.903 5.933 1.00 13.77 ? 69 PRO B CB 1 ATOM 2479 C CG . PRO B 1 69 ? -0.824 27.032 5.677 1.00 12.26 ? 69 PRO B CG 1 ATOM 2480 C CD . PRO B 1 69 ? -0.195 25.968 6.527 1.00 9.39 ? 69 PRO B CD 1 ATOM 2481 N N . LEU B 1 70 ? -3.715 24.350 7.266 1.00 8.43 ? 70 LEU B N 1 ATOM 2482 C CA . LEU B 1 70 ? -4.887 23.550 7.550 1.00 8.25 ? 70 LEU B CA 1 ATOM 2483 C C . LEU B 1 70 ? -5.162 23.514 9.046 1.00 7.90 ? 70 LEU B C 1 ATOM 2484 O O . LEU B 1 70 ? -6.326 23.649 9.449 1.00 8.80 ? 70 LEU B O 1 ATOM 2485 C CB . LEU B 1 70 ? -4.712 22.154 6.988 1.00 8.71 ? 70 LEU B CB 1 ATOM 2486 C CG . LEU B 1 70 ? -5.855 21.154 7.248 1.00 9.87 ? 70 LEU B CG 1 ATOM 2487 C CD1 . LEU B 1 70 ? -7.166 21.670 6.670 1.00 11.34 ? 70 LEU B CD1 1 ATOM 2488 C CD2 . LEU B 1 70 ? -5.463 19.779 6.719 1.00 11.10 ? 70 LEU B CD2 1 ATOM 2489 N N . ALA B 1 71 ? -4.139 23.259 9.854 1.00 7.76 ? 71 ALA B N 1 ATOM 2490 C CA . ALA B 1 71 ? -4.346 23.308 11.282 1.00 7.92 ? 71 ALA B CA 1 ATOM 2491 C C . ALA B 1 71 ? -4.806 24.671 11.760 1.00 7.90 ? 71 ALA B C 1 ATOM 2492 O O . ALA B 1 71 ? -5.636 24.763 12.663 1.00 8.57 ? 71 ALA B O 1 ATOM 2493 C CB . ALA B 1 71 ? -3.118 22.834 12.002 1.00 8.67 ? 71 ALA B CB 1 ATOM 2494 N N . ALA B 1 72 ? -4.308 25.745 11.167 1.00 7.57 ? 72 ALA B N 1 ATOM 2495 C CA . ALA B 1 72 ? -4.772 27.086 11.504 1.00 8.68 ? 72 ALA B CA 1 ATOM 2496 C C . ALA B 1 72 ? -6.258 27.245 11.227 1.00 8.12 ? 72 ALA B C 1 ATOM 2497 O O . ALA B 1 72 ? -7.000 27.774 12.018 1.00 9.65 ? 72 ALA B O 1 ATOM 2498 C CB . ALA B 1 72 ? -3.925 28.141 10.793 1.00 8.74 ? 72 ALA B CB 1 ATOM 2499 N N . LEU B 1 73 ? -6.701 26.757 10.053 1.00 8.27 ? 73 LEU B N 1 ATOM 2500 C CA . LEU B 1 73 ? -8.151 26.765 9.741 1.00 9.26 ? 73 LEU B CA 1 ATOM 2501 C C . LEU B 1 73 ? -8.917 26.045 10.804 1.00 8.96 ? 73 LEU B C 1 ATOM 2502 O O . LEU B 1 73 ? -9.977 26.464 11.261 1.00 10.35 ? 73 LEU B O 1 ATOM 2503 C CB A LEU B 1 73 ? -8.277 26.129 8.359 0.49 10.17 ? 73 LEU B CB 1 ATOM 2504 C CB B LEU B 1 73 ? -8.406 26.182 8.360 0.51 9.64 ? 73 LEU B CB 1 ATOM 2505 C CG A LEU B 1 73 ? -9.668 26.001 7.721 0.49 11.68 ? 73 LEU B CG 1 ATOM 2506 C CG B LEU B 1 73 ? -9.889 25.917 8.020 0.51 12.62 ? 73 LEU B CG 1 ATOM 2507 C CD1 A LEU B 1 73 ? -9.543 25.813 6.216 0.49 11.37 ? 73 LEU B CD1 1 ATOM 2508 C CD1 B LEU B 1 73 ? -10.750 27.162 8.142 0.51 12.18 ? 73 LEU B CD1 1 ATOM 2509 C CD2 A LEU B 1 73 ? -10.515 24.849 8.224 0.49 16.84 ? 73 LEU B CD2 1 ATOM 2510 C CD2 B LEU B 1 73 ? -9.976 25.375 6.609 0.51 10.66 ? 73 LEU B CD2 1 ATOM 2511 N N . VAL B 1 74 ? -8.453 24.850 11.179 1.00 9.15 ? 74 VAL B N 1 ATOM 2512 C CA . VAL B 1 74 ? -9.127 24.070 12.199 1.00 9.37 ? 74 VAL B CA 1 ATOM 2513 C C . VAL B 1 74 ? -9.221 24.871 13.473 1.00 8.97 ? 74 VAL B C 1 ATOM 2514 O O . VAL B 1 74 ? -10.296 24.941 14.112 1.00 9.48 ? 74 VAL B O 1 ATOM 2515 C CB . VAL B 1 74 ? -8.408 22.726 12.397 1.00 10.60 ? 74 VAL B CB 1 ATOM 2516 C CG1 . VAL B 1 74 ? -8.923 22.036 13.662 1.00 11.75 ? 74 VAL B CG1 1 ATOM 2517 C CG2 . VAL B 1 74 ? -8.596 21.827 11.192 1.00 12.38 ? 74 VAL B CG2 1 ATOM 2518 N N . PHE B 1 75 ? -8.142 25.520 13.898 1.00 8.71 ? 75 PHE B N 1 ATOM 2519 C CA . PHE B 1 75 ? -8.195 26.332 15.100 1.00 9.17 ? 75 PHE B CA 1 ATOM 2520 C C . PHE B 1 75 ? -9.090 27.562 14.952 1.00 9.31 ? 75 PHE B C 1 ATOM 2521 O O . PHE B 1 75 ? -9.752 27.951 15.909 1.00 10.87 ? 75 PHE B O 1 ATOM 2522 C CB . PHE B 1 75 ? -6.816 26.769 15.590 1.00 9.47 ? 75 PHE B CB 1 ATOM 2523 C CG . PHE B 1 75 ? -6.067 25.683 16.335 1.00 9.28 ? 75 PHE B CG 1 ATOM 2524 C CD1 . PHE B 1 75 ? -4.951 25.103 15.810 1.00 12.64 ? 75 PHE B CD1 1 ATOM 2525 C CD2 . PHE B 1 75 ? -6.502 25.267 17.584 1.00 11.61 ? 75 PHE B CD2 1 ATOM 2526 C CE1 . PHE B 1 75 ? -4.291 24.105 16.518 1.00 14.70 ? 75 PHE B CE1 1 ATOM 2527 C CE2 . PHE B 1 75 ? -5.863 24.250 18.308 1.00 14.08 ? 75 PHE B CE2 1 ATOM 2528 C CZ . PHE B 1 75 ? -4.717 23.687 17.754 1.00 14.56 ? 75 PHE B CZ 1 ATOM 2529 N N . GLU B 1 76 ? -9.183 28.152 13.790 1.00 9.68 ? 76 GLU B N 1 ATOM 2530 C CA . GLU B 1 76 ? -10.099 29.247 13.554 1.00 11.30 ? 76 GLU B CA 1 ATOM 2531 C C . GLU B 1 76 ? -11.540 28.758 13.748 1.00 9.90 ? 76 GLU B C 1 ATOM 2532 O O . GLU B 1 76 ? -12.373 29.444 14.313 1.00 11.75 ? 76 GLU B O 1 ATOM 2533 C CB . GLU B 1 76 ? -9.923 29.844 12.150 1.00 11.79 ? 76 GLU B CB 1 ATOM 2534 C CG A GLU B 1 76 ? -11.041 30.803 11.814 0.58 19.89 ? 76 GLU B CG 1 ATOM 2535 C CG B GLU B 1 76 ? -10.721 31.112 11.905 0.42 15.43 ? 76 GLU B CG 1 ATOM 2536 C CD A GLU B 1 76 ? -11.748 30.331 10.555 0.58 27.31 ? 76 GLU B CD 1 ATOM 2537 C CD B GLU B 1 76 ? -12.162 30.988 11.445 0.42 17.83 ? 76 GLU B CD 1 ATOM 2538 O OE1 A GLU B 1 76 ? -12.167 29.162 10.516 0.58 38.57 ? 76 GLU B OE1 1 ATOM 2539 O OE1 B GLU B 1 76 ? -13.005 31.862 11.764 0.42 23.73 ? 76 GLU B OE1 1 ATOM 2540 O OE2 A GLU B 1 76 ? -11.863 31.154 9.621 0.58 48.42 ? 76 GLU B OE2 1 ATOM 2541 O OE2 B GLU B 1 76 ? -12.486 29.961 10.802 0.42 24.91 ? 76 GLU B OE2 1 ATOM 2542 N N . ARG B 1 77 ? -11.853 27.569 13.264 1.00 9.36 ? 77 ARG B N 1 ATOM 2543 C CA . ARG B 1 77 ? -13.173 26.979 13.436 1.00 10.61 ? 77 ARG B CA 1 ATOM 2544 C C . ARG B 1 77 ? -13.431 26.618 14.903 1.00 9.93 ? 77 ARG B C 1 ATOM 2545 O O . ARG B 1 77 ? -14.567 26.777 15.358 1.00 11.12 ? 77 ARG B O 1 ATOM 2546 C CB . ARG B 1 77 ? -13.366 25.764 12.520 1.00 11.90 ? 77 ARG B CB 1 ATOM 2547 C CG . ARG B 1 77 ? -13.321 26.030 11.059 1.00 16.85 ? 77 ARG B CG 1 ATOM 2548 C CD . ARG B 1 77 ? -14.498 26.321 10.293 1.00 27.21 ? 77 ARG B CD 1 ATOM 2549 N NE . ARG B 1 77 ? -14.241 26.437 8.882 1.00 27.32 ? 77 ARG B NE 1 ATOM 2550 C CZ . ARG B 1 77 ? -14.537 25.623 7.887 1.00 29.73 ? 77 ARG B CZ 1 ATOM 2551 N NH1 . ARG B 1 77 ? -15.157 24.455 8.037 1.00 32.90 ? 77 ARG B NH1 1 ATOM 2552 N NH2 . ARG B 1 77 ? -14.176 26.004 6.669 1.00 38.77 ? 77 ARG B NH2 1 ATOM 2553 N N . ILE B 1 78 ? -12.423 26.153 15.643 1.00 9.73 ? 78 ILE B N 1 ATOM 2554 C CA . ILE B 1 78 ? -12.552 25.931 17.070 1.00 10.26 ? 78 ILE B CA 1 ATOM 2555 C C . ILE B 1 78 ? -12.793 27.269 17.759 1.00 11.09 ? 78 ILE B C 1 ATOM 2556 O O . ILE B 1 78 ? -13.703 27.378 18.618 1.00 12.58 ? 78 ILE B O 1 ATOM 2557 C CB . ILE B 1 78 ? -11.351 25.166 17.599 1.00 10.89 ? 78 ILE B CB 1 ATOM 2558 C CG1 . ILE B 1 78 ? -11.363 23.735 17.079 1.00 10.67 ? 78 ILE B CG1 1 ATOM 2559 C CG2 . ILE B 1 78 ? -11.389 25.246 19.116 1.00 12.19 ? 78 ILE B CG2 1 ATOM 2560 C CD1 . ILE B 1 78 ? -10.087 22.954 17.383 1.00 12.44 ? 78 ILE B CD1 1 ATOM 2561 N N . ASP B 1 79 ? -12.048 28.282 17.434 1.00 10.99 ? 79 ASP B N 1 ATOM 2562 C CA . ASP B 1 79 ? -12.211 29.623 17.986 1.00 12.36 ? 79 ASP B CA 1 ATOM 2563 C C . ASP B 1 79 ? -13.611 30.202 17.770 1.00 12.67 ? 79 ASP B C 1 ATOM 2564 O O . ASP B 1 79 ? -14.174 30.748 18.695 1.00 14.99 ? 79 ASP B O 1 ATOM 2565 C CB . ASP B 1 79 ? -11.142 30.559 17.387 1.00 11.52 ? 79 ASP B CB 1 ATOM 2566 C CG . ASP B 1 79 ? -9.749 30.353 17.908 1.00 12.06 ? 79 ASP B CG 1 ATOM 2567 O OD1 . ASP B 1 79 ? -9.531 29.630 18.915 1.00 14.37 ? 79 ASP B OD1 1 ATOM 2568 O OD2 . ASP B 1 79 ? -8.838 30.968 17.312 1.00 13.24 ? 79 ASP B OD2 1 ATOM 2569 N N . SER B 1 80 ? -14.146 30.045 16.560 1.00 12.80 ? 80 SER B N 1 ATOM 2570 C CA . SER B 1 80 ? -15.471 30.569 16.243 1.00 15.10 ? 80 SER B CA 1 ATOM 2571 C C . SER B 1 80 ? -16.593 29.732 16.802 1.00 13.44 ? 80 SER B C 1 ATOM 2572 O O . SER B 1 80 ? -17.764 30.130 16.851 1.00 16.88 ? 80 SER B O 1 ATOM 2573 C CB . SER B 1 80 ? -15.679 30.696 14.727 1.00 16.72 ? 80 SER B CB 1 ATOM 2574 O OG . SER B 1 80 ? -15.872 29.402 14.179 1.00 19.16 ? 80 SER B OG 1 ATOM 2575 N N . GLY B 1 81 ? -16.303 28.503 17.189 1.00 14.19 ? 81 GLY B N 1 ATOM 2576 C CA . GLY B 1 81 ? -17.242 27.540 17.678 1.00 15.63 ? 81 GLY B CA 1 ATOM 2577 C C . GLY B 1 81 ? -17.841 26.665 16.598 1.00 13.60 ? 81 GLY B C 1 ATOM 2578 O O . GLY B 1 81 ? -18.753 25.891 16.956 1.00 15.60 ? 81 GLY B O 1 ATOM 2579 N N . THR B 1 82 ? -17.435 26.757 15.346 1.00 13.55 ? 82 THR B N 1 ATOM 2580 C CA . THR B 1 82 ? -17.998 25.903 14.304 1.00 15.12 ? 82 THR B CA 1 ATOM 2581 C C . THR B 1 82 ? -17.415 24.499 14.316 1.00 20.34 ? 82 THR B C 1 ATOM 2582 O O . THR B 1 82 ? -17.990 23.588 13.759 1.00 43.08 ? 82 THR B O 1 ATOM 2583 C CB A THR B 1 82 ? -17.946 26.520 12.897 0.57 18.54 ? 82 THR B CB 1 ATOM 2584 C CB B THR B 1 82 ? -17.699 26.489 12.921 0.43 16.88 ? 82 THR B CB 1 ATOM 2585 O OG1 A THR B 1 82 ? -16.626 26.738 12.385 0.57 15.98 ? 82 THR B OG1 1 ATOM 2586 O OG1 B THR B 1 82 ? -18.199 27.815 12.842 0.43 21.73 ? 82 THR B OG1 1 ATOM 2587 C CG2 A THR B 1 82 ? -18.500 27.944 12.831 0.57 22.31 ? 82 THR B CG2 1 ATOM 2588 C CG2 B THR B 1 82 ? -18.376 25.621 11.880 0.43 20.93 ? 82 THR B CG2 1 ATOM 2589 N N . GLU B 1 83 ? -16.274 24.308 14.944 1.00 14.77 ? 83 GLU B N 1 ATOM 2590 C CA . GLU B 1 83 ? -15.741 22.963 15.147 1.00 15.54 ? 83 GLU B CA 1 ATOM 2591 C C . GLU B 1 83 ? -15.472 22.751 16.634 1.00 14.69 ? 83 GLU B C 1 ATOM 2592 O O . GLU B 1 83 ? -15.220 23.705 17.377 1.00 15.95 ? 83 GLU B O 1 ATOM 2593 C CB . GLU B 1 83 ? -14.480 22.808 14.279 1.00 16.61 ? 83 GLU B CB 1 ATOM 2594 C CG . GLU B 1 83 ? -13.821 21.449 14.316 1.00 21.01 ? 83 GLU B CG 1 ATOM 2595 C CD . GLU B 1 83 ? -14.789 20.484 13.632 1.00 24.36 ? 83 GLU B CD 1 ATOM 2596 O OE1 . GLU B 1 83 ? -14.805 20.390 12.401 1.00 35.37 ? 83 GLU B OE1 1 ATOM 2597 O OE2 . GLU B 1 83 ? -15.565 19.929 14.422 1.00 27.37 ? 83 GLU B OE2 1 ATOM 2598 N N . ARG B 1 84 ? -15.426 21.501 17.047 1.00 16.33 ? 84 ARG B N 1 ATOM 2599 C CA . ARG B 1 84 ? -15.017 21.126 18.390 1.00 16.50 ? 84 ARG B CA 1 ATOM 2600 C C . ARG B 1 84 ? -13.780 20.229 18.295 1.00 14.92 ? 84 ARG B C 1 ATOM 2601 O O . ARG B 1 84 ? -13.758 19.312 17.493 1.00 15.95 ? 84 ARG B O 1 ATOM 2602 C CB . ARG B 1 84 ? -16.095 20.392 19.150 1.00 23.78 ? 84 ARG B CB 1 ATOM 2603 C CG . ARG B 1 84 ? -17.008 21.154 20.070 1.00 31.26 ? 84 ARG B CG 1 ATOM 2604 C CD . ARG B 1 84 ? -18.110 20.224 20.588 0.49 35.46 ? 84 ARG B CD 1 ATOM 2605 N NE . ARG B 1 84 ? -17.660 18.838 20.598 0.49 35.74 ? 84 ARG B NE 1 ATOM 2606 C CZ . ARG B 1 84 ? -18.148 17.783 19.969 0.49 40.09 ? 84 ARG B CZ 1 ATOM 2607 N NH1 . ARG B 1 84 ? -19.216 17.884 19.185 0.49 45.40 ? 84 ARG B NH1 1 ATOM 2608 N NH2 . ARG B 1 84 ? -17.559 16.598 20.126 0.49 44.19 ? 84 ARG B NH2 1 ATOM 2609 N N . GLY B 1 85 ? -12.763 20.504 19.093 1.00 16.13 ? 85 GLY B N 1 ATOM 2610 C CA . GLY B 1 85 ? -11.540 19.738 19.113 1.00 14.37 ? 85 GLY B CA 1 ATOM 2611 C C . GLY B 1 85 ? -11.693 18.253 19.385 1.00 13.86 ? 85 GLY B C 1 ATOM 2612 O O . GLY B 1 85 ? -10.944 17.428 18.848 1.00 12.69 ? 85 GLY B O 1 ATOM 2613 N N . ASP B 1 86 ? -12.683 17.918 20.185 1.00 13.75 ? 86 ASP B N 1 ATOM 2614 C CA . ASP B 1 86 ? -12.886 16.519 20.549 1.00 14.58 ? 86 ASP B CA 1 ATOM 2615 C C . ASP B 1 86 ? -13.895 15.852 19.652 1.00 13.61 ? 86 ASP B C 1 ATOM 2616 O O . ASP B 1 86 ? -14.192 14.664 19.897 1.00 16.50 ? 86 ASP B O 1 ATOM 2617 C CB . ASP B 1 86 ? -13.331 16.402 22.002 1.00 18.64 ? 86 ASP B CB 1 ATOM 2618 C CG . ASP B 1 86 ? -14.644 17.072 22.306 0.67 20.27 ? 86 ASP B CG 1 ATOM 2619 O OD1 . ASP B 1 86 ? -15.196 17.818 21.482 0.67 26.36 ? 86 ASP B OD1 1 ATOM 2620 O OD2 . ASP B 1 86 ? -15.173 16.884 23.430 0.67 28.13 ? 86 ASP B OD2 1 ATOM 2621 N N . ARG B 1 87 ? -14.385 16.452 18.589 1.00 14.33 ? 87 ARG B N 1 ATOM 2622 C CA . ARG B 1 87 ? -15.292 15.801 17.657 1.00 14.13 ? 87 ARG B CA 1 ATOM 2623 C C . ARG B 1 87 ? -14.586 14.612 17.010 1.00 12.83 ? 87 ARG B C 1 ATOM 2624 O O . ARG B 1 87 ? -13.474 14.694 16.542 1.00 12.29 ? 87 ARG B O 1 ATOM 2625 C CB . ARG B 1 87 ? -15.810 16.734 16.561 1.00 15.18 ? 87 ARG B CB 1 ATOM 2626 C CG . ARG B 1 87 ? -16.675 16.049 15.508 1.00 20.09 ? 87 ARG B CG 1 ATOM 2627 C CD . ARG B 1 87 ? -17.255 17.123 14.574 1.00 21.63 ? 87 ARG B CD 1 ATOM 2628 N NE . ARG B 1 87 ? -17.512 16.605 13.250 1.00 36.22 ? 87 ARG B NE 1 ATOM 2629 C CZ . ARG B 1 87 ? -18.648 16.231 12.702 1.00 37.59 ? 87 ARG B CZ 1 ATOM 2630 N NH1 . ARG B 1 87 ? -19.795 16.301 13.370 1.00 45.79 ? 87 ARG B NH1 1 ATOM 2631 N NH2 . ARG B 1 87 ? -18.622 15.778 11.440 1.00 36.71 ? 87 ARG B NH2 1 ATOM 2632 N N . LYS B 1 88 ? -15.265 13.469 17.022 1.00 12.85 ? 88 LYS B N 1 ATOM 2633 C CA . LYS B 1 88 ? -14.703 12.243 16.504 1.00 12.20 ? 88 LYS B CA 1 ATOM 2634 C C . LYS B 1 88 ? -14.913 12.186 15.000 1.00 12.81 ? 88 LYS B C 1 ATOM 2635 O O . LYS B 1 88 ? -16.089 12.337 14.591 1.00 15.11 ? 88 LYS B O 1 ATOM 2636 C CB . LYS B 1 88 ? -15.332 11.027 17.169 1.00 14.35 ? 88 LYS B CB 1 ATOM 2637 C CG . LYS B 1 88 ? -15.112 10.930 18.661 1.00 14.82 ? 88 LYS B CG 1 ATOM 2638 C CD . LYS B 1 88 ? -15.696 9.655 19.278 1.00 19.32 ? 88 LYS B CD 1 ATOM 2639 C CE . LYS B 1 88 ? -15.389 9.555 20.771 1.00 25.58 ? 88 LYS B CE 1 ATOM 2640 N NZ . LYS B 1 88 ? -15.967 8.332 21.383 1.00 35.65 ? 88 LYS B NZ 1 ATOM 2641 N N . LEU B 1 89 ? -13.887 11.978 14.214 1.00 10.62 ? 89 LEU B N 1 ATOM 2642 C CA . LEU B 1 89 ? -13.946 11.808 12.777 1.00 11.30 ? 89 LEU B CA 1 ATOM 2643 C C . LEU B 1 89 ? -13.763 10.322 12.485 1.00 10.61 ? 89 LEU B C 1 ATOM 2644 O O . LEU B 1 89 ? -12.660 9.786 12.635 1.00 10.65 ? 89 LEU B O 1 ATOM 2645 C CB . LEU B 1 89 ? -12.831 12.640 12.171 1.00 12.09 ? 89 LEU B CB 1 ATOM 2646 C CG . LEU B 1 89 ? -12.837 14.120 12.539 1.00 13.40 ? 89 LEU B CG 1 ATOM 2647 C CD1 . LEU B 1 89 ? -11.692 14.851 11.876 1.00 14.58 ? 89 LEU B CD1 1 ATOM 2648 C CD2 . LEU B 1 89 ? -14.179 14.770 12.197 1.00 17.31 ? 89 LEU B CD2 1 ATOM 2649 N N . SER B 1 90 ? -14.835 9.676 12.091 1.00 11.07 ? 90 SER B N 1 ATOM 2650 C CA . SER B 1 90 ? -14.845 8.246 11.858 1.00 10.71 ? 90 SER B CA 1 ATOM 2651 C C . SER B 1 90 ? -14.295 7.929 10.499 1.00 10.02 ? 90 SER B C 1 ATOM 2652 O O . SER B 1 90 ? -14.458 8.666 9.527 1.00 13.66 ? 90 SER B O 1 ATOM 2653 C CB . SER B 1 90 ? -16.268 7.707 12.011 1.00 15.29 ? 90 SER B CB 1 ATOM 2654 O OG . SER B 1 90 ? -16.702 7.812 13.336 1.00 24.39 ? 90 SER B OG 1 ATOM 2655 N N . TYR B 1 91 ? -13.643 6.768 10.408 1.00 10.54 ? 91 TYR B N 1 ATOM 2656 C CA . TYR B 1 91 ? -13.131 6.323 9.124 1.00 10.49 ? 91 TYR B CA 1 ATOM 2657 C C . TYR B 1 91 ? -12.835 4.829 9.154 1.00 11.97 ? 91 TYR B C 1 ATOM 2658 O O . TYR B 1 91 ? -12.741 4.213 10.207 1.00 12.00 ? 91 TYR B O 1 ATOM 2659 C CB . TYR B 1 91 ? -11.839 7.050 8.787 1.00 10.95 ? 91 TYR B CB 1 ATOM 2660 C CG . TYR B 1 91 ? -10.657 6.855 9.676 1.00 9.34 ? 91 TYR B CG 1 ATOM 2661 C CD1 . TYR B 1 91 ? -10.527 7.649 10.799 1.00 10.24 ? 91 TYR B CD1 1 ATOM 2662 C CD2 . TYR B 1 91 ? -9.704 5.890 9.445 1.00 9.72 ? 91 TYR B CD2 1 ATOM 2663 C CE1 . TYR B 1 91 ? -9.471 7.480 11.661 1.00 9.54 ? 91 TYR B CE1 1 ATOM 2664 C CE2 . TYR B 1 91 ? -8.636 5.717 10.296 1.00 8.82 ? 91 TYR B CE2 1 ATOM 2665 C CZ . TYR B 1 91 ? -8.502 6.524 11.388 1.00 8.95 ? 91 TYR B CZ 1 ATOM 2666 O OH . TYR B 1 91 ? -7.463 6.411 12.293 1.00 9.70 ? 91 TYR B OH 1 ATOM 2667 N N . GLY B 1 92 ? -12.660 4.284 7.950 1.00 12.57 ? 92 GLY B N 1 ATOM 2668 C CA . GLY B 1 92 ? -12.259 2.892 7.751 1.00 13.44 ? 92 GLY B CA 1 ATOM 2669 C C . GLY B 1 92 ? -10.995 2.795 6.925 1.00 11.61 ? 92 GLY B C 1 ATOM 2670 O O . GLY B 1 92 ? -10.323 3.801 6.691 1.00 11.30 ? 92 GLY B O 1 ATOM 2671 N N . PRO B 1 93 ? -10.642 1.584 6.553 1.00 12.51 ? 93 PRO B N 1 ATOM 2672 C CA . PRO B 1 93 ? -9.339 1.380 5.943 1.00 12.23 ? 93 PRO B CA 1 ATOM 2673 C C . PRO B 1 93 ? -9.141 2.073 4.625 1.00 12.65 ? 93 PRO B C 1 ATOM 2674 O O . PRO B 1 93 ? -7.970 2.257 4.225 1.00 14.21 ? 93 PRO B O 1 ATOM 2675 C CB . PRO B 1 93 ? -9.292 -0.143 5.793 1.00 15.50 ? 93 PRO B CB 1 ATOM 2676 C CG . PRO B 1 93 ? -10.707 -0.586 5.894 1.00 20.62 ? 93 PRO B CG 1 ATOM 2677 C CD . PRO B 1 93 ? -11.443 0.370 6.783 1.00 16.13 ? 93 PRO B CD 1 ATOM 2678 N N . ASP B 1 94 ? -10.191 2.487 3.914 1.00 13.76 ? 94 ASP B N 1 ATOM 2679 C CA . ASP B 1 94 ? -9.932 3.207 2.675 1.00 14.90 ? 94 ASP B CA 1 ATOM 2680 C C . ASP B 1 94 ? -9.327 4.585 2.909 1.00 14.27 ? 94 ASP B C 1 ATOM 2681 O O . ASP B 1 94 ? -8.879 5.214 1.933 1.00 18.13 ? 94 ASP B O 1 ATOM 2682 C CB . ASP B 1 94 ? -11.193 3.313 1.840 1.00 18.29 ? 94 ASP B CB 1 ATOM 2683 C CG . ASP B 1 94 ? -12.308 4.162 2.358 1.00 22.72 ? 94 ASP B CG 1 ATOM 2684 O OD1 . ASP B 1 94 ? -12.157 4.725 3.451 1.00 27.04 ? 94 ASP B OD1 1 ATOM 2685 O OD2 . ASP B 1 94 ? -13.339 4.276 1.654 1.00 36.49 ? 94 ASP B OD2 1 ATOM 2686 N N . MET B 1 95 ? -9.259 5.055 4.138 1.00 13.05 ? 95 MET B N 1 ATOM 2687 C CA . MET B 1 95 ? -8.610 6.327 4.428 1.00 13.46 ? 95 MET B CA 1 ATOM 2688 C C . MET B 1 95 ? -7.108 6.223 4.549 1.00 12.51 ? 95 MET B C 1 ATOM 2689 O O . MET B 1 95 ? -6.397 7.231 4.655 1.00 13.84 ? 95 MET B O 1 ATOM 2690 C CB . MET B 1 95 ? -9.239 6.938 5.706 1.00 16.63 ? 95 MET B CB 1 ATOM 2691 C CG . MET B 1 95 ? -10.608 7.523 5.331 0.79 24.73 ? 95 MET B CG 1 ATOM 2692 S SD . MET B 1 95 ? -10.402 8.941 4.305 0.79 35.17 ? 95 MET B SD 1 ATOM 2693 C CE . MET B 1 95 ? -9.613 10.144 5.364 0.79 62.77 ? 95 MET B CE 1 ATOM 2694 N N . ILE B 1 96 ? -6.607 5.006 4.613 1.00 12.92 ? 96 ILE B N 1 ATOM 2695 C CA . ILE B 1 96 ? -5.159 4.843 4.732 1.00 13.76 ? 96 ILE B CA 1 ATOM 2696 C C . ILE B 1 96 ? -4.521 5.038 3.376 1.00 12.20 ? 96 ILE B C 1 ATOM 2697 O O . ILE B 1 96 ? -4.790 4.323 2.414 1.00 14.91 ? 96 ILE B O 1 ATOM 2698 C CB . ILE B 1 96 ? -4.815 3.464 5.300 1.00 14.14 ? 96 ILE B CB 1 ATOM 2699 C CG1 . ILE B 1 96 ? -5.507 3.164 6.631 1.00 14.78 ? 96 ILE B CG1 1 ATOM 2700 C CG2 . ILE B 1 96 ? -3.310 3.296 5.409 1.00 15.58 ? 96 ILE B CG2 1 ATOM 2701 C CD1 . ILE B 1 96 ? -5.338 4.248 7.666 1.00 19.24 ? 96 ILE B CD1 1 ATOM 2702 N N . VAL B 1 97 ? -3.697 6.064 3.289 1.00 12.59 ? 97 VAL B N 1 ATOM 2703 C CA . VAL B 1 97 ? -2.898 6.373 2.088 1.00 13.17 ? 97 VAL B CA 1 ATOM 2704 C C . VAL B 1 97 ? -1.448 6.377 2.498 1.00 12.77 ? 97 VAL B C 1 ATOM 2705 O O . VAL B 1 97 ? -1.158 6.198 3.688 1.00 14.40 ? 97 VAL B O 1 ATOM 2706 C CB . VAL B 1 97 ? -3.362 7.690 1.453 1.00 13.02 ? 97 VAL B CB 1 ATOM 2707 C CG1 . VAL B 1 97 ? -4.797 7.628 0.975 1.00 14.75 ? 97 VAL B CG1 1 ATOM 2708 C CG2 . VAL B 1 97 ? -3.181 8.841 2.445 1.00 15.17 ? 97 VAL B CG2 1 ATOM 2709 N N . GLU B 1 98 ? -0.557 6.568 1.536 1.00 15.00 ? 98 GLU B N 1 ATOM 2710 C CA . GLU B 1 98 ? 0.859 6.563 1.816 1.00 17.90 ? 98 GLU B CA 1 ATOM 2711 C C . GLU B 1 98 ? 1.133 7.574 2.941 1.00 15.18 ? 98 GLU B C 1 ATOM 2712 O O . GLU B 1 98 ? 0.572 8.674 2.994 1.00 15.85 ? 98 GLU B O 1 ATOM 2713 C CB . GLU B 1 98 ? 1.680 6.937 0.582 1.00 25.14 ? 98 GLU B CB 1 ATOM 2714 C CG . GLU B 1 98 ? 3.181 6.792 0.744 1.00 28.65 ? 98 GLU B CG 1 ATOM 2715 C CD . GLU B 1 98 ? 3.877 6.561 -0.586 0.09 26.95 ? 98 GLU B CD 1 ATOM 2716 O OE1 . GLU B 1 98 ? 3.545 7.292 -1.544 0.09 28.41 ? 98 GLU B OE1 1 ATOM 2717 O OE2 . GLU B 1 98 ? 4.738 5.662 -0.670 0.09 24.01 ? 98 GLU B OE2 1 ATOM 2718 N N . TRP B 1 99 ? 1.996 7.139 3.853 1.00 15.21 ? 99 TRP B N 1 ATOM 2719 C CA . TRP B 1 99 ? 2.427 7.904 4.994 1.00 15.05 ? 99 TRP B CA 1 ATOM 2720 C C . TRP B 1 99 ? 1.289 8.438 5.845 1.00 12.43 ? 99 TRP B C 1 ATOM 2721 O O . TRP B 1 99 ? 0.988 9.617 5.935 1.00 13.59 ? 99 TRP B O 1 ATOM 2722 C CB . TRP B 1 99 ? 3.383 9.053 4.588 1.00 16.24 ? 99 TRP B CB 1 ATOM 2723 C CG . TRP B 1 99 ? 4.058 9.433 5.875 1.00 16.17 ? 99 TRP B CG 1 ATOM 2724 C CD1 . TRP B 1 99 ? 3.910 10.599 6.548 1.00 16.49 ? 99 TRP B CD1 1 ATOM 2725 C CD2 . TRP B 1 99 ? 4.965 8.631 6.648 1.00 21.17 ? 99 TRP B CD2 1 ATOM 2726 N NE1 . TRP B 1 99 ? 4.672 10.593 7.691 1.00 20.93 ? 99 TRP B NE1 1 ATOM 2727 C CE2 . TRP B 1 99 ? 5.332 9.389 7.779 1.00 25.05 ? 99 TRP B CE2 1 ATOM 2728 C CE3 . TRP B 1 99 ? 5.473 7.346 6.449 1.00 32.38 ? 99 TRP B CE3 1 ATOM 2729 C CZ2 . TRP B 1 99 ? 6.217 8.880 8.731 1.00 34.63 ? 99 TRP B CZ2 1 ATOM 2730 C CZ3 . TRP B 1 99 ? 6.346 6.856 7.397 1.00 42.27 ? 99 TRP B CZ3 1 ATOM 2731 C CH2 . TRP B 1 99 ? 6.709 7.619 8.520 1.00 43.03 ? 99 TRP B CH2 1 ATOM 2732 N N . SER B 1 100 ? 0.689 7.476 6.531 1.00 11.69 ? 100 SER B N 1 ATOM 2733 C CA . SER B 1 100 ? -0.381 7.706 7.444 1.00 10.04 ? 100 SER B CA 1 ATOM 2734 C C . SER B 1 100 ? -0.121 7.021 8.795 1.00 10.10 ? 100 SER B C 1 ATOM 2735 O O . SER B 1 100 ? -0.900 6.172 9.207 1.00 10.84 ? 100 SER B O 1 ATOM 2736 C CB . SER B 1 100 ? -1.696 7.163 6.836 1.00 11.18 ? 100 SER B CB 1 ATOM 2737 O OG . SER B 1 100 ? -1.954 7.743 5.600 1.00 15.15 ? 100 SER B OG 1 ATOM 2738 N N . PRO B 1 101 ? 0.985 7.319 9.479 1.00 10.59 ? 101 PRO B N 1 ATOM 2739 C CA . PRO B 1 101 ? 1.329 6.508 10.653 1.00 10.58 ? 101 PRO B CA 1 ATOM 2740 C C . PRO B 1 101 ? 0.342 6.538 11.824 1.00 10.09 ? 101 PRO B C 1 ATOM 2741 O O . PRO B 1 101 ? 0.111 5.499 12.415 1.00 10.68 ? 101 PRO B O 1 ATOM 2742 C CB . PRO B 1 101 ? 2.701 7.067 11.059 1.00 14.18 ? 101 PRO B CB 1 ATOM 2743 C CG . PRO B 1 101 ? 2.700 8.440 10.482 1.00 13.00 ? 101 PRO B CG 1 ATOM 2744 C CD . PRO B 1 101 ? 1.994 8.337 9.147 1.00 10.72 ? 101 PRO B CD 1 ATOM 2745 N N . ALA B 1 102 ? -0.157 7.713 12.157 1.00 9.10 ? 102 ALA B N 1 ATOM 2746 C CA . ALA B 1 102 ? -1.151 7.817 13.227 1.00 8.89 ? 102 ALA B CA 1 ATOM 2747 C C . ALA B 1 102 ? -2.497 7.264 12.801 1.00 8.41 ? 102 ALA B C 1 ATOM 2748 O O . ALA B 1 102 ? -3.138 6.558 13.556 1.00 8.65 ? 102 ALA B O 1 ATOM 2749 C CB . ALA B 1 102 ? -1.275 9.241 13.706 1.00 9.33 ? 102 ALA B CB 1 ATOM 2750 N N . THR B 1 103 ? -2.904 7.624 11.590 1.00 7.99 ? 103 THR B N 1 ATOM 2751 C CA . THR B 1 103 ? -4.173 7.131 11.074 1.00 9.33 ? 103 THR B CA 1 ATOM 2752 C C . THR B 1 103 ? -4.225 5.610 11.113 1.00 8.34 ? 103 THR B C 1 ATOM 2753 O O . THR B 1 103 ? -5.271 5.032 11.468 1.00 9.16 ? 103 THR B O 1 ATOM 2754 C CB . THR B 1 103 ? -4.406 7.660 9.651 1.00 11.39 ? 103 THR B CB 1 ATOM 2755 O OG1 . THR B 1 103 ? -4.259 9.067 9.580 1.00 12.56 ? 103 THR B OG1 1 ATOM 2756 C CG2 . THR B 1 103 ? -5.806 7.303 9.186 1.00 16.11 ? 103 THR B CG2 1 ATOM 2757 N N . GLU B 1 104 ? -3.113 4.967 10.741 1.00 8.84 ? 104 GLU B N 1 ATOM 2758 C CA . GLU B 1 104 ? -3.043 3.505 10.802 1.00 9.35 ? 104 GLU B CA 1 ATOM 2759 C C . GLU B 1 104 ? -3.192 2.973 12.224 1.00 8.44 ? 104 GLU B C 1 ATOM 2760 O O . GLU B 1 104 ? -3.882 1.990 12.472 1.00 11.09 ? 104 GLU B O 1 ATOM 2761 C CB . GLU B 1 104 ? -1.748 3.022 10.163 1.00 13.30 ? 104 GLU B CB 1 ATOM 2762 C CG . GLU B 1 104 ? -1.735 1.592 9.673 1.00 35.78 ? 104 GLU B CG 1 ATOM 2763 C CD . GLU B 1 104 ? -0.711 1.412 8.556 1.00 47.86 ? 104 GLU B CD 1 ATOM 2764 O OE1 . GLU B 1 104 ? 0.234 2.247 8.497 1.00 54.33 ? 104 GLU B OE1 1 ATOM 2765 O OE2 . GLU B 1 104 ? -0.853 0.476 7.739 1.00 65.57 ? 104 GLU B OE2 1 ATOM 2766 N N . ARG B 1 105 ? -2.555 3.648 13.190 1.00 8.12 ? 105 ARG B N 1 ATOM 2767 C CA . ARG B 1 105 ? -2.629 3.216 14.571 1.00 8.33 ? 105 ARG B CA 1 ATOM 2768 C C . ARG B 1 105 ? -4.042 3.352 15.136 1.00 8.19 ? 105 ARG B C 1 ATOM 2769 O O . ARG B 1 105 ? -4.457 2.509 15.926 1.00 9.66 ? 105 ARG B O 1 ATOM 2770 C CB . ARG B 1 105 ? -1.658 3.980 15.468 1.00 8.25 ? 105 ARG B CB 1 ATOM 2771 C CG . ARG B 1 105 ? -0.239 3.621 15.118 1.00 8.83 ? 105 ARG B CG 1 ATOM 2772 C CD . ARG B 1 105 ? 0.736 4.593 15.726 1.00 10.07 ? 105 ARG B CD 1 ATOM 2773 N NE . ARG B 1 105 ? 2.094 4.343 15.224 1.00 9.89 ? 105 ARG B NE 1 ATOM 2774 C CZ . ARG B 1 105 ? 2.955 5.241 14.854 1.00 9.66 ? 105 ARG B CZ 1 ATOM 2775 N NH1 . ARG B 1 105 ? 2.701 6.579 14.924 1.00 11.46 ? 105 ARG B NH1 1 ATOM 2776 N NH2 . ARG B 1 105 ? 4.180 4.960 14.370 1.00 11.91 ? 105 ARG B NH2 1 ATOM 2777 N N . PHE B 1 106 ? -4.749 4.416 14.760 1.00 7.77 ? 106 PHE B N 1 ATOM 2778 C CA . PHE B 1 106 ? -6.079 4.668 15.291 1.00 7.98 ? 106 PHE B CA 1 ATOM 2779 C C . PHE B 1 106 ? -7.209 3.955 14.509 1.00 8.14 ? 106 PHE B C 1 ATOM 2780 O O . PHE B 1 106 ? -8.355 4.019 14.918 1.00 8.89 ? 106 PHE B O 1 ATOM 2781 C CB . PHE B 1 106 ? -6.352 6.176 15.369 1.00 7.77 ? 106 PHE B CB 1 ATOM 2782 C CG . PHE B 1 106 ? -5.638 6.857 16.533 1.00 7.56 ? 106 PHE B CG 1 ATOM 2783 C CD1 . PHE B 1 106 ? -4.576 7.693 16.324 1.00 9.55 ? 106 PHE B CD1 1 ATOM 2784 C CD2 . PHE B 1 106 ? -6.005 6.626 17.838 1.00 8.77 ? 106 PHE B CD2 1 ATOM 2785 C CE1 . PHE B 1 106 ? -3.942 8.302 17.402 1.00 11.88 ? 106 PHE B CE1 1 ATOM 2786 C CE2 . PHE B 1 106 ? -5.395 7.246 18.925 1.00 9.82 ? 106 PHE B CE2 1 ATOM 2787 C CZ . PHE B 1 106 ? -4.329 8.071 18.716 1.00 10.32 ? 106 PHE B CZ 1 ATOM 2788 N N . LEU B 1 107 ? -6.854 3.331 13.388 1.00 8.99 ? 107 LEU B N 1 ATOM 2789 C CA . LEU B 1 107 ? -7.852 2.710 12.516 1.00 9.48 ? 107 LEU B CA 1 ATOM 2790 C C . LEU B 1 107 ? -8.762 1.752 13.260 1.00 9.19 ? 107 LEU B C 1 ATOM 2791 O O . LEU B 1 107 ? -10.000 1.829 13.126 1.00 9.98 ? 107 LEU B O 1 ATOM 2792 C CB . LEU B 1 107 ? -7.139 2.069 11.362 1.00 10.43 ? 107 LEU B CB 1 ATOM 2793 C CG . LEU B 1 107 ? -8.022 1.245 10.420 1.00 12.07 ? 107 LEU B CG 1 ATOM 2794 C CD1 . LEU B 1 107 ? -9.017 2.144 9.696 1.00 12.85 ? 107 LEU B CD1 1 ATOM 2795 C CD2 . LEU B 1 107 ? -7.192 0.546 9.337 1.00 16.11 ? 107 LEU B CD2 1 ATOM 2796 N N . ALA B 1 108 ? -8.229 0.808 14.041 1.00 9.00 ? 108 ALA B N 1 ATOM 2797 C CA . ALA B 1 108 ? -9.113 -0.153 14.679 1.00 9.62 ? 108 ALA B CA 1 ATOM 2798 C C . ALA B 1 108 ? -10.109 0.493 15.620 1.00 9.33 ? 108 ALA B C 1 ATOM 2799 O O . ALA B 1 108 ? -11.228 0.010 15.781 1.00 10.43 ? 108 ALA B O 1 ATOM 2800 C CB . ALA B 1 108 ? -8.306 -1.196 15.423 1.00 10.98 ? 108 ALA B CB 1 ATOM 2801 N N . SER B 1 109 ? -9.696 1.587 16.279 1.00 9.04 ? 109 SER B N 1 ATOM 2802 C CA . SER B 1 109 ? -10.584 2.310 17.180 1.00 9.60 ? 109 SER B CA 1 ATOM 2803 C C . SER B 1 109 ? -11.694 3.010 16.437 1.00 10.52 ? 109 SER B C 1 ATOM 2804 O O . SER B 1 109 ? -12.724 3.333 17.035 1.00 13.52 ? 109 SER B O 1 ATOM 2805 C CB . SER B 1 109 ? -9.806 3.341 18.015 1.00 10.13 ? 109 SER B CB 1 ATOM 2806 O OG . SER B 1 109 ? -9.621 4.554 17.288 1.00 10.70 ? 109 SER B OG 1 ATOM 2807 N N . GLY B 1 110 ? -11.543 3.252 15.154 1.00 10.55 ? 110 GLY B N 1 ATOM 2808 C CA . GLY B 1 110 ? -12.618 3.750 14.350 1.00 12.86 ? 110 GLY B CA 1 ATOM 2809 C C . GLY B 1 110 ? -12.660 5.225 14.096 1.00 9.90 ? 110 GLY B C 1 ATOM 2810 O O . GLY B 1 110 ? -13.446 5.681 13.267 1.00 10.53 ? 110 GLY B O 1 ATOM 2811 N N . HIS B 1 111 ? -11.787 5.992 14.750 1.00 9.42 ? 111 HIS B N 1 ATOM 2812 C CA . HIS B 1 111 ? -11.800 7.449 14.620 1.00 8.90 ? 111 HIS B CA 1 ATOM 2813 C C . HIS B 1 111 ? -10.507 8.080 15.131 1.00 8.28 ? 111 HIS B C 1 ATOM 2814 O O . HIS B 1 111 ? -9.775 7.438 15.853 1.00 8.82 ? 111 HIS B O 1 ATOM 2815 C CB . HIS B 1 111 ? -13.006 8.029 15.391 1.00 10.18 ? 111 HIS B CB 1 ATOM 2816 C CG . HIS B 1 111 ? -12.828 7.990 16.873 1.00 12.03 ? 111 HIS B CG 1 ATOM 2817 N ND1 . HIS B 1 111 ? -13.124 6.889 17.654 1.00 16.59 ? 111 HIS B ND1 1 ATOM 2818 C CD2 . HIS B 1 111 ? -12.290 8.912 17.735 1.00 14.62 ? 111 HIS B CD2 1 ATOM 2819 C CE1 . HIS B 1 111 ? -12.838 7.146 18.917 1.00 19.38 ? 111 HIS B CE1 1 ATOM 2820 N NE2 . HIS B 1 111 ? -12.332 8.365 18.988 1.00 18.65 ? 111 HIS B NE2 1 ATOM 2821 N N . MET B 1 112 ? -10.377 9.333 14.702 1.00 8.56 ? 112 MET B N 1 ATOM 2822 C CA . MET B 1 112 ? -9.443 10.235 15.349 1.00 8.60 ? 112 MET B CA 1 ATOM 2823 C C . MET B 1 112 ? -10.261 11.488 15.683 1.00 8.63 ? 112 MET B C 1 ATOM 2824 O O . MET B 1 112 ? -11.160 11.846 14.892 1.00 9.51 ? 112 MET B O 1 ATOM 2825 C CB . MET B 1 112 ? -8.242 10.638 14.541 1.00 9.90 ? 112 MET B CB 1 ATOM 2826 C CG A MET B 1 112 ? -7.161 9.579 14.444 0.62 11.40 ? 112 MET B CG 1 ATOM 2827 C CG B MET B 1 112 ? -7.222 9.509 14.421 0.38 9.75 ? 112 MET B CG 1 ATOM 2828 S SD A MET B 1 112 ? -5.833 9.987 13.313 0.62 15.12 ? 112 MET B SD 1 ATOM 2829 S SD B MET B 1 112 ? -5.730 9.933 13.511 0.38 9.58 ? 112 MET B SD 1 ATOM 2830 C CE A MET B 1 112 ? -4.824 11.047 14.343 0.62 22.24 ? 112 MET B CE 1 ATOM 2831 C CE B MET B 1 112 ? -6.440 10.167 11.875 0.38 8.32 ? 112 MET B CE 1 ATOM 2832 N N . THR B 1 113 ? -9.948 12.196 16.761 1.00 9.05 ? 113 THR B N 1 ATOM 2833 C CA . THR B 1 113 ? -10.624 13.476 16.956 1.00 9.21 ? 113 THR B CA 1 ATOM 2834 C C . THR B 1 113 ? -10.017 14.521 16.004 1.00 8.77 ? 113 THR B C 1 ATOM 2835 O O . THR B 1 113 ? -8.932 14.359 15.433 1.00 8.57 ? 113 THR B O 1 ATOM 2836 C CB . THR B 1 113 ? -10.485 13.976 18.382 1.00 9.73 ? 113 THR B CB 1 ATOM 2837 O OG1 . THR B 1 113 ? -9.085 14.241 18.618 1.00 10.51 ? 113 THR B OG1 1 ATOM 2838 C CG2 . THR B 1 113 ? -11.032 13.023 19.460 1.00 11.81 ? 113 THR B CG2 1 ATOM 2839 N N . VAL B 1 114 ? -10.735 15.632 15.911 1.00 9.15 ? 114 VAL B N 1 ATOM 2840 C CA . VAL B 1 114 ? -10.255 16.755 15.132 1.00 9.48 ? 114 VAL B CA 1 ATOM 2841 C C . VAL B 1 114 ? -8.868 17.144 15.578 1.00 8.90 ? 114 VAL B C 1 ATOM 2842 O O . VAL B 1 114 ? -7.935 17.309 14.784 1.00 9.37 ? 114 VAL B O 1 ATOM 2843 C CB . VAL B 1 114 ? -11.244 17.941 15.277 1.00 10.34 ? 114 VAL B CB 1 ATOM 2844 C CG1 . VAL B 1 114 ? -10.572 19.227 14.828 1.00 11.03 ? 114 VAL B CG1 1 ATOM 2845 C CG2 . VAL B 1 114 ? -12.516 17.625 14.534 1.00 13.48 ? 114 VAL B CG2 1 ATOM 2846 N N . LEU B 1 115 ? -8.662 17.296 16.891 1.00 9.69 ? 115 LEU B N 1 ATOM 2847 C CA . LEU B 1 115 ? -7.361 17.719 17.400 1.00 9.66 ? 115 LEU B CA 1 ATOM 2848 C C . LEU B 1 115 ? -6.299 16.635 17.238 1.00 8.44 ? 115 LEU B C 1 ATOM 2849 O O . LEU B 1 115 ? -5.129 16.943 16.922 1.00 9.64 ? 115 LEU B O 1 ATOM 2850 C CB . LEU B 1 115 ? -7.484 18.092 18.884 1.00 10.56 ? 115 LEU B CB 1 ATOM 2851 C CG . LEU B 1 115 ? -8.046 19.498 19.133 1.00 13.91 ? 115 LEU B CG 1 ATOM 2852 C CD1 . LEU B 1 115 ? -8.277 19.733 20.605 1.00 17.99 ? 115 LEU B CD1 1 ATOM 2853 C CD2 . LEU B 1 115 ? -7.110 20.593 18.626 1.00 17.67 ? 115 LEU B CD2 1 ATOM 2854 N N . GLU B 1 116 ? -6.602 15.366 17.409 1.00 8.71 ? 116 GLU B N 1 ATOM 2855 C CA . GLU B 1 116 ? -5.598 14.317 17.131 1.00 9.27 ? 116 GLU B CA 1 ATOM 2856 C C . GLU B 1 116 ? -5.178 14.328 15.693 1.00 8.01 ? 116 GLU B C 1 ATOM 2857 O O . GLU B 1 116 ? -3.991 14.229 15.365 1.00 8.72 ? 116 GLU B O 1 ATOM 2858 C CB . GLU B 1 116 ? -6.219 12.935 17.440 1.00 9.96 ? 116 GLU B CB 1 ATOM 2859 C CG . GLU B 1 116 ? -6.352 12.602 18.901 1.00 11.61 ? 116 GLU B CG 1 ATOM 2860 C CD . GLU B 1 116 ? -7.158 11.342 19.190 1.00 10.08 ? 116 GLU B CD 1 ATOM 2861 O OE1 . GLU B 1 116 ? -7.940 10.909 18.313 1.00 10.59 ? 116 GLU B OE1 1 ATOM 2862 O OE2 . GLU B 1 116 ? -7.027 10.776 20.310 1.00 11.26 ? 116 GLU B OE2 1 ATOM 2863 N N . ALA B 1 117 ? -6.141 14.440 14.760 1.00 8.38 ? 117 ALA B N 1 ATOM 2864 C CA . ALA B 1 117 ? -5.802 14.453 13.354 1.00 8.19 ? 117 ALA B CA 1 ATOM 2865 C C . ALA B 1 117 ? -4.984 15.688 13.016 1.00 7.81 ? 117 ALA B C 1 ATOM 2866 O O . ALA B 1 117 ? -4.028 15.588 12.257 1.00 7.72 ? 117 ALA B O 1 ATOM 2867 C CB . ALA B 1 117 ? -7.095 14.438 12.526 1.00 8.94 ? 117 ALA B CB 1 ATOM 2868 N N . ALA B 1 118 ? -5.324 16.843 13.544 1.00 8.19 ? 118 ALA B N 1 ATOM 2869 C CA . ALA B 1 118 ? -4.571 18.051 13.221 1.00 8.49 ? 118 ALA B CA 1 ATOM 2870 C C . ALA B 1 118 ? -3.145 17.945 13.719 1.00 7.45 ? 118 ALA B C 1 ATOM 2871 O O . ALA B 1 118 ? -2.192 18.346 13.054 1.00 8.05 ? 118 ALA B O 1 ATOM 2872 C CB . ALA B 1 118 ? -5.311 19.242 13.792 1.00 9.32 ? 118 ALA B CB 1 ATOM 2873 N N . GLN B 1 119 ? -2.973 17.419 14.971 1.00 7.36 ? 119 GLN B N 1 ATOM 2874 C CA . GLN B 1 119 ? -1.618 17.341 15.516 1.00 7.86 ? 119 GLN B CA 1 ATOM 2875 C C . GLN B 1 119 ? -0.776 16.363 14.700 1.00 7.39 ? 119 GLN B C 1 ATOM 2876 O O . GLN B 1 119 ? 0.394 16.549 14.449 1.00 7.43 ? 119 GLN B O 1 ATOM 2877 C CB . GLN B 1 119 ? -1.672 16.996 17.011 1.00 9.40 ? 119 GLN B CB 1 ATOM 2878 C CG . GLN B 1 119 ? -0.278 17.149 17.631 1.00 10.02 ? 119 GLN B CG 1 ATOM 2879 C CD . GLN B 1 119 ? -0.317 16.949 19.141 1.00 11.26 ? 119 GLN B CD 1 ATOM 2880 O OE1 . GLN B 1 119 ? -1.398 16.887 19.737 1.00 11.43 ? 119 GLN B OE1 1 ATOM 2881 N NE2 . GLN B 1 119 ? 0.890 16.805 19.703 1.00 11.64 ? 119 GLN B NE2 1 ATOM 2882 N N . ALA B 1 120 ? -1.390 15.249 14.257 1.00 7.54 ? 120 ALA B N 1 ATOM 2883 C CA . ALA B 1 120 ? -0.693 14.263 13.426 1.00 7.54 ? 120 ALA B CA 1 ATOM 2884 C C . ALA B 1 120 ? -0.363 14.837 12.052 1.00 6.57 ? 120 ALA B C 1 ATOM 2885 O O . ALA B 1 120 ? 0.741 14.587 11.534 1.00 6.95 ? 120 ALA B O 1 ATOM 2886 C CB . ALA B 1 120 ? -1.518 12.998 13.287 1.00 8.90 ? 120 ALA B CB 1 ATOM 2887 N N . ALA B 1 121 ? -1.265 15.617 11.477 1.00 7.03 ? 121 ALA B N 1 ATOM 2888 C CA . ALA B 1 121 ? -0.984 16.259 10.197 1.00 7.86 ? 121 ALA B CA 1 ATOM 2889 C C . ALA B 1 121 ? 0.218 17.179 10.325 1.00 6.76 ? 121 ALA B C 1 ATOM 2890 O O . ALA B 1 121 ? 1.118 17.208 9.485 1.00 8.90 ? 121 ALA B O 1 ATOM 2891 C CB . ALA B 1 121 ? -2.183 17.057 9.713 1.00 8.66 ? 121 ALA B CB 1 ATOM 2892 N N . VAL B 1 122 ? 0.268 17.985 11.383 1.00 6.97 ? 122 VAL B N 1 ATOM 2893 C CA . VAL B 1 122 ? 1.341 18.946 11.545 1.00 7.84 ? 122 VAL B CA 1 ATOM 2894 C C . VAL B 1 122 ? 2.652 18.295 11.920 1.00 6.96 ? 122 VAL B C 1 ATOM 2895 O O . VAL B 1 122 ? 3.710 18.621 11.395 1.00 9.10 ? 122 VAL B O 1 ATOM 2896 C CB . VAL B 1 122 ? 0.946 20.019 12.557 1.00 7.90 ? 122 VAL B CB 1 ATOM 2897 C CG1 . VAL B 1 122 ? 2.136 20.935 12.854 1.00 9.49 ? 122 VAL B CG1 1 ATOM 2898 C CG2 . VAL B 1 122 ? -0.202 20.850 12.037 1.00 9.54 ? 122 VAL B CG2 1 ATOM 2899 N N . GLN B 1 123 ? 2.628 17.390 12.935 1.00 6.85 ? 123 GLN B N 1 ATOM 2900 C CA . GLN B 1 123 ? 3.892 16.919 13.517 1.00 7.11 ? 123 GLN B CA 1 ATOM 2901 C C . GLN B 1 123 ? 4.448 15.640 12.878 1.00 7.05 ? 123 GLN B C 1 ATOM 2902 O O . GLN B 1 123 ? 5.658 15.371 13.015 1.00 8.19 ? 123 GLN B O 1 ATOM 2903 C CB . GLN B 1 123 ? 3.749 16.684 15.014 1.00 8.19 ? 123 GLN B CB 1 ATOM 2904 C CG . GLN B 1 123 ? 3.330 17.928 15.764 1.00 8.75 ? 123 GLN B CG 1 ATOM 2905 C CD . GLN B 1 123 ? 3.516 17.729 17.259 1.00 8.39 ? 123 GLN B CD 1 ATOM 2906 O OE1 . GLN B 1 123 ? 3.040 16.730 17.812 1.00 10.20 ? 123 GLN B OE1 1 ATOM 2907 N NE2 . GLN B 1 123 ? 4.112 18.682 17.907 1.00 9.81 ? 123 GLN B NE2 1 ATOM 2908 N N . LEU B 1 124 ? 3.609 14.868 12.223 1.00 7.38 ? 124 LEU B N 1 ATOM 2909 C CA . LEU B 1 124 ? 4.026 13.639 11.536 1.00 7.70 ? 124 LEU B CA 1 ATOM 2910 C C . LEU B 1 124 ? 3.842 13.739 10.030 1.00 7.95 ? 124 LEU B C 1 ATOM 2911 O O . LEU B 1 124 ? 4.251 12.839 9.307 1.00 10.03 ? 124 LEU B O 1 ATOM 2912 C CB . LEU B 1 124 ? 3.242 12.405 12.043 1.00 8.82 ? 124 LEU B CB 1 ATOM 2913 C CG . LEU B 1 124 ? 3.374 12.130 13.516 1.00 12.20 ? 124 LEU B CG 1 ATOM 2914 C CD1 . LEU B 1 124 ? 2.489 10.947 13.891 1.00 12.22 ? 124 LEU B CD1 1 ATOM 2915 C CD2 . LEU B 1 124 ? 4.827 11.882 13.923 1.00 25.73 ? 124 LEU B CD2 1 ATOM 2916 N N . SER B 1 125 ? 3.186 14.794 9.578 1.00 7.83 ? 125 SER B N 1 ATOM 2917 C CA . SER B 1 125 ? 2.850 14.948 8.159 1.00 7.91 ? 125 SER B CA 1 ATOM 2918 C C . SER B 1 125 ? 1.881 13.863 7.682 1.00 7.96 ? 125 SER B C 1 ATOM 2919 O O . SER B 1 125 ? 1.833 13.508 6.531 1.00 10.01 ? 125 SER B O 1 ATOM 2920 C CB . SER B 1 125 ? 4.079 15.020 7.261 1.00 8.06 ? 125 SER B CB 1 ATOM 2921 O OG . SER B 1 125 ? 3.818 15.910 6.207 1.00 10.81 ? 125 SER B OG 1 ATOM 2922 N N . ASP B 1 126 ? 1.024 13.375 8.595 1.00 7.52 ? 126 ASP B N 1 ATOM 2923 C CA . ASP B 1 126 ? 0.148 12.232 8.301 1.00 7.86 ? 126 ASP B CA 1 ATOM 2924 C C . ASP B 1 126 ? -0.860 12.576 7.233 1.00 8.00 ? 126 ASP B C 1 ATOM 2925 O O . ASP B 1 126 ? -1.681 13.468 7.428 1.00 8.47 ? 126 ASP B O 1 ATOM 2926 C CB . ASP B 1 126 ? -0.489 11.805 9.613 1.00 8.08 ? 126 ASP B CB 1 ATOM 2927 C CG . ASP B 1 126 ? -1.309 10.524 9.545 1.00 8.39 ? 126 ASP B CG 1 ATOM 2928 O OD1 . ASP B 1 126 ? -2.103 10.384 8.592 1.00 8.87 ? 126 ASP B OD1 1 ATOM 2929 O OD2 . ASP B 1 126 ? -1.158 9.662 10.454 1.00 10.75 ? 126 ASP B OD2 1 ATOM 2930 N N . ASN B 1 127 ? -0.833 11.859 6.117 1.00 8.35 ? 127 ASN B N 1 ATOM 2931 C CA . ASN B 1 127 ? -1.683 12.148 4.975 1.00 9.27 ? 127 ASN B CA 1 ATOM 2932 C C . ASN B 1 127 ? -3.121 11.748 5.225 1.00 9.21 ? 127 ASN B C 1 ATOM 2933 O O . ASN B 1 127 ? -4.044 12.457 4.824 1.00 10.38 ? 127 ASN B O 1 ATOM 2934 C CB . ASN B 1 127 ? -1.161 11.521 3.697 1.00 10.77 ? 127 ASN B CB 1 ATOM 2935 C CG . ASN B 1 127 ? 0.088 12.205 3.197 1.00 12.51 ? 127 ASN B CG 1 ATOM 2936 O OD1 . ASN B 1 127 ? 0.099 13.429 3.151 1.00 13.03 ? 127 ASN B OD1 1 ATOM 2937 N ND2 . ASN B 1 127 ? 1.083 11.416 2.844 1.00 23.93 ? 127 ASN B ND2 1 ATOM 2938 N N . GLY B 1 128 ? -3.430 10.657 5.842 1.00 9.93 ? 128 GLY B N 1 ATOM 2939 C CA . GLY B 1 128 ? -4.742 10.182 6.075 1.00 10.81 ? 128 GLY B CA 1 ATOM 2940 C C . GLY B 1 128 ? -5.419 11.124 7.034 1.00 9.72 ? 128 GLY B C 1 ATOM 2941 O O . GLY B 1 128 ? -6.601 11.457 6.873 1.00 10.05 ? 128 GLY B O 1 ATOM 2942 N N . ALA B 1 129 ? -4.684 11.617 8.030 1.00 8.73 ? 129 ALA B N 1 ATOM 2943 C CA . ALA B 1 129 ? -5.213 12.563 8.999 1.00 8.91 ? 129 ALA B CA 1 ATOM 2944 C C . ALA B 1 129 ? -5.562 13.877 8.304 1.00 8.71 ? 129 ALA B C 1 ATOM 2945 O O . ALA B 1 129 ? -6.589 14.477 8.576 1.00 8.92 ? 129 ALA B O 1 ATOM 2946 C CB . ALA B 1 129 ? -4.227 12.825 10.153 1.00 9.68 ? 129 ALA B CB 1 ATOM 2947 N N . THR B 1 130 ? -4.694 14.317 7.424 1.00 8.74 ? 130 THR B N 1 ATOM 2948 C CA . THR B 1 130 ? -4.931 15.483 6.602 1.00 9.10 ? 130 THR B CA 1 ATOM 2949 C C . THR B 1 130 ? -6.203 15.319 5.793 1.00 9.56 ? 130 THR B C 1 ATOM 2950 O O . THR B 1 130 ? -7.070 16.223 5.769 1.00 9.92 ? 130 THR B O 1 ATOM 2951 C CB . THR B 1 130 ? -3.717 15.717 5.682 1.00 9.24 ? 130 THR B CB 1 ATOM 2952 O OG1 . THR B 1 130 ? -2.571 16.001 6.499 1.00 9.69 ? 130 THR B OG1 1 ATOM 2953 C CG2 . THR B 1 130 ? -3.955 16.882 4.761 1.00 10.40 ? 130 THR B CG2 1 ATOM 2954 N N . ASN B 1 131 ? -6.369 14.179 5.141 1.00 9.68 ? 131 ASN B N 1 ATOM 2955 C CA . ASN B 1 131 ? -7.561 13.956 4.326 1.00 11.00 ? 131 ASN B CA 1 ATOM 2956 C C . ASN B 1 131 ? -8.825 13.883 5.167 1.00 10.60 ? 131 ASN B C 1 ATOM 2957 O O . ASN B 1 131 ? -9.916 14.326 4.750 1.00 12.54 ? 131 ASN B O 1 ATOM 2958 C CB . ASN B 1 131 ? -7.387 12.697 3.488 1.00 11.42 ? 131 ASN B CB 1 ATOM 2959 C CG . ASN B 1 131 ? -6.465 12.867 2.323 1.00 12.34 ? 131 ASN B CG 1 ATOM 2960 O OD1 . ASN B 1 131 ? -6.085 13.992 1.984 1.00 12.42 ? 131 ASN B OD1 1 ATOM 2961 N ND2 . ASN B 1 131 ? -6.125 11.765 1.695 1.00 14.65 ? 131 ASN B ND2 1 ATOM 2962 N N . LEU B 1 132 ? -8.705 13.374 6.385 1.00 9.69 ? 132 LEU B N 1 ATOM 2963 C CA . LEU B 1 132 ? -9.849 13.302 7.297 1.00 10.55 ? 132 LEU B CA 1 ATOM 2964 C C . LEU B 1 132 ? -10.291 14.722 7.629 1.00 9.66 ? 132 LEU B C 1 ATOM 2965 O O . LEU B 1 132 ? -11.488 15.016 7.639 1.00 10.94 ? 132 LEU B O 1 ATOM 2966 C CB . LEU B 1 132 ? -9.484 12.531 8.536 1.00 12.04 ? 132 LEU B CB 1 ATOM 2967 C CG . LEU B 1 132 ? -10.495 12.043 9.502 1.00 15.68 ? 132 LEU B CG 1 ATOM 2968 C CD1 . LEU B 1 132 ? -11.468 11.107 8.820 1.00 20.32 ? 132 LEU B CD1 1 ATOM 2969 C CD2 . LEU B 1 132 ? -9.735 11.335 10.646 1.00 24.63 ? 132 LEU B CD2 1 ATOM 2970 N N . LEU B 1 133 ? -9.316 15.585 7.932 1.00 9.42 ? 133 LEU B N 1 ATOM 2971 C CA . LEU B 1 133 ? -9.665 16.974 8.177 1.00 10.64 ? 133 LEU B CA 1 ATOM 2972 C C . LEU B 1 133 ? -10.265 17.670 6.969 1.00 10.52 ? 133 LEU B C 1 ATOM 2973 O O . LEU B 1 133 ? -11.237 18.404 7.072 1.00 13.45 ? 133 LEU B O 1 ATOM 2974 C CB . LEU B 1 133 ? -8.433 17.742 8.658 1.00 9.85 ? 133 LEU B CB 1 ATOM 2975 C CG . LEU B 1 133 ? -7.948 17.304 10.050 1.00 10.95 ? 133 LEU B CG 1 ATOM 2976 C CD1 . LEU B 1 133 ? -6.555 17.882 10.232 1.00 13.68 ? 133 LEU B CD1 1 ATOM 2977 C CD2 . LEU B 1 133 ? -8.953 17.684 11.107 1.00 11.88 ? 133 LEU B CD2 1 ATOM 2978 N N . LEU B 1 134 ? -9.664 17.464 5.798 1.00 11.45 ? 134 LEU B N 1 ATOM 2979 C CA . LEU B 1 134 ? -10.220 18.024 4.592 1.00 14.34 ? 134 LEU B CA 1 ATOM 2980 C C . LEU B 1 134 ? -11.689 17.621 4.421 1.00 15.15 ? 134 LEU B C 1 ATOM 2981 O O . LEU B 1 134 ? -12.495 18.477 4.048 1.00 21.00 ? 134 LEU B O 1 ATOM 2982 C CB . LEU B 1 134 ? -9.454 17.654 3.326 1.00 13.84 ? 134 LEU B CB 1 ATOM 2983 C CG . LEU B 1 134 ? -8.041 18.316 3.227 1.00 14.06 ? 134 LEU B CG 1 ATOM 2984 C CD1 . LEU B 1 134 ? -7.260 17.681 2.098 1.00 14.27 ? 134 LEU B CD1 1 ATOM 2985 C CD2 . LEU B 1 134 ? -8.157 19.809 3.036 1.00 15.30 ? 134 LEU B CD2 1 ATOM 2986 N N . ARG B 1 135 ? -12.035 16.366 4.626 1.00 15.13 ? 135 ARG B N 1 ATOM 2987 C CA . ARG B 1 135 ? -13.432 15.953 4.461 1.00 16.38 ? 135 ARG B CA 1 ATOM 2988 C C . ARG B 1 135 ? -14.282 16.705 5.462 1.00 16.98 ? 135 ARG B C 1 ATOM 2989 O O . ARG B 1 135 ? -15.390 17.169 5.195 1.00 21.16 ? 135 ARG B O 1 ATOM 2990 C CB . ARG B 1 135 ? -13.488 14.438 4.640 1.00 17.43 ? 135 ARG B CB 1 ATOM 2991 C CG . ARG B 1 135 ? -14.904 13.836 4.614 1.00 24.28 ? 135 ARG B CG 1 ATOM 2992 C CD . ARG B 1 135 ? -14.877 12.354 4.918 1.00 31.09 ? 135 ARG B CD 1 ATOM 2993 N NE . ARG B 1 135 ? -14.762 12.033 6.330 1.00 39.34 ? 135 ARG B NE 1 ATOM 2994 C CZ . ARG B 1 135 ? -14.868 10.879 6.965 1.00 44.32 ? 135 ARG B CZ 1 ATOM 2995 N NH1 . ARG B 1 135 ? -15.112 9.720 6.373 1.00 61.90 ? 135 ARG B NH1 1 ATOM 2996 N NH2 . ARG B 1 135 ? -14.718 10.890 8.291 1.00 44.34 ? 135 ARG B NH2 1 ATOM 2997 N N . GLU B 1 136 ? -13.813 16.909 6.680 1.00 15.55 ? 136 GLU B N 1 ATOM 2998 C CA . GLU B 1 136 ? -14.538 17.574 7.733 1.00 17.06 ? 136 GLU B CA 1 ATOM 2999 C C . GLU B 1 136 ? -14.756 19.044 7.430 1.00 16.41 ? 136 GLU B C 1 ATOM 3000 O O . GLU B 1 136 ? -15.851 19.540 7.702 1.00 20.48 ? 136 GLU B O 1 ATOM 3001 C CB . GLU B 1 136 ? -13.817 17.408 9.074 1.00 16.43 ? 136 GLU B CB 1 ATOM 3002 C CG . GLU B 1 136 ? -14.472 18.082 10.253 1.00 17.49 ? 136 GLU B CG 1 ATOM 3003 C CD . GLU B 1 136 ? -15.805 17.596 10.725 0.78 15.55 ? 136 GLU B CD 1 ATOM 3004 O OE1 . GLU B 1 136 ? -16.386 16.592 10.249 0.78 15.74 ? 136 GLU B OE1 1 ATOM 3005 O OE2 . GLU B 1 136 ? -16.307 18.203 11.689 0.78 22.43 ? 136 GLU B OE2 1 ATOM 3006 N N . ILE B 1 137 ? -13.758 19.708 6.835 1.00 18.44 ? 137 ILE B N 1 ATOM 3007 C CA . ILE B 1 137 ? -13.881 21.176 6.812 1.00 22.16 ? 137 ILE B CA 1 ATOM 3008 C C . ILE B 1 137 ? -14.405 21.722 5.494 1.00 23.95 ? 137 ILE B C 1 ATOM 3009 O O . ILE B 1 137 ? -14.604 22.951 5.365 1.00 29.37 ? 137 ILE B O 1 ATOM 3010 C CB . ILE B 1 137 ? -12.607 21.918 7.227 1.00 26.54 ? 137 ILE B CB 1 ATOM 3011 C CG1 . ILE B 1 137 ? -11.348 21.575 6.473 1.00 30.49 ? 137 ILE B CG1 1 ATOM 3012 C CG2 . ILE B 1 137 ? -12.355 21.671 8.721 1.00 25.62 ? 137 ILE B CG2 1 ATOM 3013 C CD1 . ILE B 1 137 ? -11.024 22.222 5.181 1.00 26.33 ? 137 ILE B CD1 1 ATOM 3014 N N . GLY B 1 138 ? -14.671 20.855 4.527 1.00 24.93 ? 138 GLY B N 1 ATOM 3015 C CA . GLY B 1 138 ? -15.226 21.328 3.256 1.00 27.44 ? 138 GLY B CA 1 ATOM 3016 C C . GLY B 1 138 ? -14.189 21.269 2.140 1.00 26.58 ? 138 GLY B C 1 ATOM 3017 O O . GLY B 1 138 ? -14.325 22.012 1.146 1.00 32.14 ? 138 GLY B O 1 ATOM 3018 N N . GLY B 1 139 ? -13.213 20.404 2.209 1.00 27.79 ? 139 GLY B N 1 ATOM 3019 C CA . GLY B 1 139 ? -12.289 20.133 1.131 1.00 26.39 ? 139 GLY B CA 1 ATOM 3020 C C . GLY B 1 139 ? -11.345 21.257 0.777 1.00 24.48 ? 139 GLY B C 1 ATOM 3021 O O . GLY B 1 139 ? -11.215 22.274 1.447 1.00 23.86 ? 139 GLY B O 1 ATOM 3022 N N . PRO B 1 140 ? -10.626 21.003 -0.297 1.00 23.02 ? 140 PRO B N 1 ATOM 3023 C CA . PRO B 1 140 ? -9.719 22.031 -0.813 1.00 23.27 ? 140 PRO B CA 1 ATOM 3024 C C . PRO B 1 140 ? -10.298 23.413 -0.990 1.00 23.74 ? 140 PRO B C 1 ATOM 3025 O O . PRO B 1 140 ? -9.642 24.437 -0.743 1.00 23.03 ? 140 PRO B O 1 ATOM 3026 C CB . PRO B 1 140 ? -9.260 21.399 -2.128 1.00 25.71 ? 140 PRO B CB 1 ATOM 3027 C CG . PRO B 1 140 ? -9.302 19.924 -1.814 1.00 27.71 ? 140 PRO B CG 1 ATOM 3028 C CD . PRO B 1 140 ? -10.581 19.734 -1.045 1.00 27.37 ? 140 PRO B CD 1 ATOM 3029 N N . ALA B 1 141 ? -11.548 23.465 -1.421 1.00 25.50 ? 141 ALA B N 1 ATOM 3030 C CA . ALA B 1 141 ? -12.203 24.750 -1.615 1.00 28.30 ? 141 ALA B CA 1 ATOM 3031 C C . ALA B 1 141 ? -12.217 25.488 -0.285 1.00 24.45 ? 141 ALA B C 1 ATOM 3032 O O . ALA B 1 141 ? -12.002 26.687 -0.243 1.00 26.58 ? 141 ALA B O 1 ATOM 3033 C CB . ALA B 1 141 ? -13.605 24.524 -2.165 1.00 28.99 ? 141 ALA B CB 1 ATOM 3034 N N . ALA B 1 142 ? -12.431 24.791 0.834 1.00 22.08 ? 142 ALA B N 1 ATOM 3035 C CA . ALA B 1 142 ? -12.510 25.455 2.127 1.00 22.08 ? 142 ALA B CA 1 ATOM 3036 C C . ALA B 1 142 ? -11.139 25.937 2.608 1.00 19.39 ? 142 ALA B C 1 ATOM 3037 O O . ALA B 1 142 ? -11.029 27.007 3.197 1.00 18.95 ? 142 ALA B O 1 ATOM 3038 C CB . ALA B 1 142 ? -13.148 24.522 3.134 1.00 28.46 ? 142 ALA B CB 1 ATOM 3039 N N . MET B 1 143 ? -10.137 25.134 2.308 1.00 17.01 ? 143 MET B N 1 ATOM 3040 C CA . MET B 1 143 ? -8.780 25.610 2.600 1.00 15.51 ? 143 MET B CA 1 ATOM 3041 C C . MET B 1 143 ? -8.460 26.882 1.855 1.00 16.27 ? 143 MET B C 1 ATOM 3042 O O . MET B 1 143 ? -7.913 27.844 2.399 1.00 14.54 ? 143 MET B O 1 ATOM 3043 C CB . MET B 1 143 ? -7.803 24.495 2.267 1.00 15.14 ? 143 MET B CB 1 ATOM 3044 C CG . MET B 1 143 ? -6.357 24.823 2.581 1.00 14.30 ? 143 MET B CG 1 ATOM 3045 S SD . MET B 1 143 ? -5.943 24.781 4.318 1.00 15.25 ? 143 MET B SD 1 ATOM 3046 C CE . MET B 1 143 ? -5.828 26.510 4.703 1.00 14.09 ? 143 MET B CE 1 ATOM 3047 N N . THR B 1 144 ? -8.777 26.935 0.553 1.00 17.96 ? 144 THR B N 1 ATOM 3048 C CA . THR B 1 144 ? -8.480 28.128 -0.233 1.00 17.20 ? 144 THR B CA 1 ATOM 3049 C C . THR B 1 144 ? -9.286 29.320 0.244 1.00 18.69 ? 144 THR B C 1 ATOM 3050 O O . THR B 1 144 ? -8.748 30.428 0.322 1.00 18.68 ? 144 THR B O 1 ATOM 3051 C CB . THR B 1 144 ? -8.740 27.818 -1.706 1.00 19.00 ? 144 THR B CB 1 ATOM 3052 O OG1 . THR B 1 144 ? -7.889 26.718 -2.057 1.00 18.70 ? 144 THR B OG1 1 ATOM 3053 C CG2 . THR B 1 144 ? -8.346 29.014 -2.561 1.00 23.59 ? 144 THR B CG2 1 ATOM 3054 N N . GLN B 1 145 ? -10.530 29.057 0.626 1.00 18.58 ? 145 GLN B N 1 ATOM 3055 C CA . GLN B 1 145 ? -11.341 30.145 1.182 1.00 20.66 ? 145 GLN B CA 1 ATOM 3056 C C . GLN B 1 145 ? -10.689 30.699 2.445 1.00 18.37 ? 145 GLN B C 1 ATOM 3057 O O . GLN B 1 145 ? -10.686 31.923 2.659 1.00 19.93 ? 145 GLN B O 1 ATOM 3058 C CB . GLN B 1 145 ? -12.741 29.598 1.334 1.00 24.62 ? 145 GLN B CB 1 ATOM 3059 C CG . GLN B 1 145 ? -13.772 30.476 1.981 1.00 30.56 ? 145 GLN B CG 1 ATOM 3060 C CD . GLN B 1 145 ? -15.040 29.655 2.194 0.83 29.72 ? 145 GLN B CD 1 ATOM 3061 O OE1 . GLN B 1 145 ? -15.783 29.327 1.267 0.83 28.10 ? 145 GLN B OE1 1 ATOM 3062 N NE2 . GLN B 1 145 ? -15.239 29.294 3.455 0.83 33.40 ? 145 GLN B NE2 1 ATOM 3063 N N . TYR B 1 146 ? -10.079 29.868 3.298 1.00 17.23 ? 146 TYR B N 1 ATOM 3064 C CA . TYR B 1 146 ? -9.398 30.370 4.499 1.00 17.09 ? 146 TYR B CA 1 ATOM 3065 C C . TYR B 1 146 ? -8.170 31.204 4.153 1.00 16.77 ? 146 TYR B C 1 ATOM 3066 O O . TYR B 1 146 ? -7.925 32.261 4.755 1.00 17.04 ? 146 TYR B O 1 ATOM 3067 C CB . TYR B 1 146 ? -9.006 29.197 5.423 1.00 15.73 ? 146 TYR B CB 1 ATOM 3068 C CG . TYR B 1 146 ? -8.397 29.716 6.709 1.00 15.84 ? 146 TYR B CG 1 ATOM 3069 C CD1 . TYR B 1 146 ? -7.054 29.537 6.900 1.00 17.99 ? 146 TYR B CD1 1 ATOM 3070 C CD2 . TYR B 1 146 ? -9.137 30.383 7.664 1.00 17.99 ? 146 TYR B CD2 1 ATOM 3071 C CE1 . TYR B 1 146 ? -6.429 29.989 8.034 1.00 17.98 ? 146 TYR B CE1 1 ATOM 3072 C CE2 . TYR B 1 146 ? -8.518 30.857 8.814 1.00 18.42 ? 146 TYR B CE2 1 ATOM 3073 C CZ . TYR B 1 146 ? -7.183 30.649 8.969 1.00 20.63 ? 146 TYR B CZ 1 ATOM 3074 O OH . TYR B 1 146 ? -6.521 31.098 10.088 1.00 21.20 ? 146 TYR B OH 1 ATOM 3075 N N . PHE B 1 147 ? -7.374 30.756 3.184 1.00 14.86 ? 147 PHE B N 1 ATOM 3076 C CA . PHE B 1 147 ? -6.268 31.616 2.736 1.00 14.13 ? 147 PHE B CA 1 ATOM 3077 C C . PHE B 1 147 ? -6.768 33.022 2.357 1.00 15.90 ? 147 PHE B C 1 ATOM 3078 O O . PHE B 1 147 ? -6.154 33.994 2.778 1.00 15.97 ? 147 PHE B O 1 ATOM 3079 C CB . PHE B 1 147 ? -5.587 31.004 1.543 1.00 14.67 ? 147 PHE B CB 1 ATOM 3080 C CG . PHE B 1 147 ? -4.634 29.856 1.827 1.00 12.84 ? 147 PHE B CG 1 ATOM 3081 C CD1 . PHE B 1 147 ? -4.771 28.650 1.155 1.00 12.73 ? 147 PHE B CD1 1 ATOM 3082 C CD2 . PHE B 1 147 ? -3.544 29.961 2.698 1.00 12.34 ? 147 PHE B CD2 1 ATOM 3083 C CE1 . PHE B 1 147 ? -3.877 27.600 1.339 1.00 12.65 ? 147 PHE B CE1 1 ATOM 3084 C CE2 . PHE B 1 147 ? -2.689 28.914 2.914 1.00 13.12 ? 147 PHE B CE2 1 ATOM 3085 C CZ . PHE B 1 147 ? -2.819 27.735 2.234 1.00 12.16 ? 147 PHE B CZ 1 ATOM 3086 N N . ARG B 1 148 ? -7.857 33.078 1.629 1.00 16.85 ? 148 ARG B N 1 ATOM 3087 C CA . ARG B 1 148 ? -8.391 34.387 1.234 1.00 18.59 ? 148 ARG B CA 1 ATOM 3088 C C . ARG B 1 148 ? -8.798 35.194 2.468 1.00 21.50 ? 148 ARG B C 1 ATOM 3089 O O . ARG B 1 148 ? -8.535 36.402 2.505 1.00 23.14 ? 148 ARG B O 1 ATOM 3090 C CB . ARG B 1 148 ? -9.542 34.224 0.268 1.00 24.26 ? 148 ARG B CB 1 ATOM 3091 C CG . ARG B 1 148 ? -9.252 33.480 -1.034 1.00 22.90 ? 148 ARG B CG 1 ATOM 3092 C CD . ARG B 1 148 ? -8.344 34.222 -1.961 1.00 28.25 ? 148 ARG B CD 1 ATOM 3093 N NE . ARG B 1 148 ? -7.823 33.380 -3.055 1.00 27.11 ? 148 ARG B NE 1 ATOM 3094 C CZ . ARG B 1 148 ? -6.764 32.592 -2.974 1.00 26.43 ? 148 ARG B CZ 1 ATOM 3095 N NH1 . ARG B 1 148 ? -5.987 32.430 -1.916 1.00 17.29 ? 148 ARG B NH1 1 ATOM 3096 N NH2 . ARG B 1 148 ? -6.442 31.898 -4.071 1.00 35.51 ? 148 ARG B NH2 1 ATOM 3097 N N . LYS B 1 149 ? -9.417 34.510 3.436 1.00 20.25 ? 149 LYS B N 1 ATOM 3098 C CA . LYS B 1 149 ? -9.911 35.190 4.628 1.00 21.58 ? 149 LYS B CA 1 ATOM 3099 C C . LYS B 1 149 ? -8.777 35.858 5.412 1.00 22.10 ? 149 LYS B C 1 ATOM 3100 O O . LYS B 1 149 ? -8.949 36.933 6.008 1.00 27.26 ? 149 LYS B O 1 ATOM 3101 C CB . LYS B 1 149 ? -10.652 34.207 5.541 1.00 24.40 ? 149 LYS B CB 1 ATOM 3102 C CG . LYS B 1 149 ? -11.091 34.798 6.864 1.00 25.30 ? 149 LYS B CG 1 ATOM 3103 C CD . LYS B 1 149 ? -11.629 33.847 7.902 1.00 31.52 ? 149 LYS B CD 1 ATOM 3104 C CE . LYS B 1 149 ? -11.721 34.611 9.229 1.00 43.28 ? 149 LYS B CE 1 ATOM 3105 N NZ . LYS B 1 149 ? -12.309 33.752 10.292 1.00 59.36 ? 149 LYS B NZ 1 ATOM 3106 N N . ILE B 1 150 ? -7.597 35.224 5.461 1.00 21.63 ? 150 ILE B N 1 ATOM 3107 C CA . ILE B 1 150 ? -6.484 35.844 6.206 1.00 20.09 ? 150 ILE B CA 1 ATOM 3108 C C . ILE B 1 150 ? -5.559 36.679 5.329 1.00 22.00 ? 150 ILE B C 1 ATOM 3109 O O . ILE B 1 150 ? -4.379 36.941 5.644 1.00 22.99 ? 150 ILE B O 1 ATOM 3110 C CB . ILE B 1 150 ? -5.681 34.779 6.996 1.00 18.16 ? 150 ILE B CB 1 ATOM 3111 C CG1 . ILE B 1 150 ? -5.046 33.717 6.104 1.00 19.19 ? 150 ILE B CG1 1 ATOM 3112 C CG2 . ILE B 1 150 ? -6.602 34.225 8.066 1.00 22.87 ? 150 ILE B CG2 1 ATOM 3113 C CD1 . ILE B 1 150 ? -4.031 32.798 6.723 1.00 28.83 ? 150 ILE B CD1 1 ATOM 3114 N N . GLY B 1 151 ? -6.054 37.128 4.179 1.00 22.35 ? 151 GLY B N 1 ATOM 3115 C CA . GLY B 1 151 ? -5.391 38.068 3.293 1.00 20.31 ? 151 GLY B CA 1 ATOM 3116 C C . GLY B 1 151 ? -4.446 37.479 2.273 1.00 19.01 ? 151 GLY B C 1 ATOM 3117 O O . GLY B 1 151 ? -3.654 38.186 1.644 1.00 23.19 ? 151 GLY B O 1 ATOM 3118 N N . ASP B 1 152 ? -4.452 36.170 2.115 1.00 17.48 ? 152 ASP B N 1 ATOM 3119 C CA . ASP B 1 152 ? -3.587 35.508 1.129 1.00 15.08 ? 152 ASP B CA 1 ATOM 3120 C C . ASP B 1 152 ? -4.438 35.222 -0.110 1.00 16.38 ? 152 ASP B C 1 ATOM 3121 O O . ASP B 1 152 ? -5.290 34.330 -0.086 1.00 16.16 ? 152 ASP B O 1 ATOM 3122 C CB . ASP B 1 152 ? -3.015 34.243 1.721 1.00 16.37 ? 152 ASP B CB 1 ATOM 3123 C CG . ASP B 1 152 ? -2.058 33.426 0.886 1.00 13.36 ? 152 ASP B CG 1 ATOM 3124 O OD1 . ASP B 1 152 ? -2.110 33.676 -0.351 1.00 15.69 ? 152 ASP B OD1 1 ATOM 3125 O OD2 . ASP B 1 152 ? -1.362 32.557 1.444 1.00 14.46 ? 152 ASP B OD2 1 ATOM 3126 N N . SER B 1 153 ? -4.236 35.975 -1.170 1.00 16.72 ? 153 SER B N 1 ATOM 3127 C CA . SER B 1 153 ? -4.969 35.819 -2.415 1.00 21.48 ? 153 SER B CA 1 ATOM 3128 C C . SER B 1 153 ? -4.202 34.931 -3.384 1.00 16.46 ? 153 SER B C 1 ATOM 3129 O O . SER B 1 153 ? -4.691 34.853 -4.517 1.00 19.32 ? 153 SER B O 1 ATOM 3130 C CB . SER B 1 153 ? -5.215 37.198 -3.030 1.00 28.65 ? 153 SER B CB 1 ATOM 3131 O OG . SER B 1 153 ? -4.002 37.841 -3.389 1.00 40.06 ? 153 SER B OG 1 ATOM 3132 N N . VAL B 1 154 ? -3.122 34.310 -2.985 1.00 16.01 ? 154 VAL B N 1 ATOM 3133 C CA . VAL B 1 154 ? -2.246 33.565 -3.869 1.00 16.34 ? 154 VAL B CA 1 ATOM 3134 C C . VAL B 1 154 ? -2.276 32.063 -3.615 1.00 14.61 ? 154 VAL B C 1 ATOM 3135 O O . VAL B 1 154 ? -2.459 31.278 -4.559 1.00 15.52 ? 154 VAL B O 1 ATOM 3136 C CB . VAL B 1 154 ? -0.785 34.059 -3.673 1.00 17.67 ? 154 VAL B CB 1 ATOM 3137 C CG1 . VAL B 1 154 ? 0.221 33.187 -4.371 1.00 19.27 ? 154 VAL B CG1 1 ATOM 3138 C CG2 . VAL B 1 154 ? -0.600 35.491 -4.162 1.00 18.66 ? 154 VAL B CG2 1 ATOM 3139 N N . SER B 1 155 ? -2.109 31.650 -2.389 1.00 13.85 ? 155 SER B N 1 ATOM 3140 C CA . SER B 1 155 ? -2.078 30.221 -2.077 1.00 11.61 ? 155 SER B CA 1 ATOM 3141 C C . SER B 1 155 ? -3.390 29.562 -2.477 1.00 12.61 ? 155 SER B C 1 ATOM 3142 O O . SER B 1 155 ? -4.478 30.080 -2.286 1.00 15.19 ? 155 SER B O 1 ATOM 3143 C CB . SER B 1 155 ? -1.844 29.996 -0.600 1.00 11.51 ? 155 SER B CB 1 ATOM 3144 O OG . SER B 1 155 ? -0.826 30.755 -0.021 1.00 14.87 ? 155 SER B OG 1 ATOM 3145 N N . ARG B 1 156 ? -3.324 28.336 -2.987 1.00 12.38 ? 156 ARG B N 1 ATOM 3146 C CA . ARG B 1 156 ? -4.498 27.591 -3.416 1.00 12.54 ? 156 ARG B CA 1 ATOM 3147 C C . ARG B 1 156 ? -4.278 26.091 -3.174 1.00 12.12 ? 156 ARG B C 1 ATOM 3148 O O . ARG B 1 156 ? -3.242 25.577 -3.515 1.00 12.88 ? 156 ARG B O 1 ATOM 3149 C CB . ARG B 1 156 ? -4.834 27.814 -4.876 1.00 13.60 ? 156 ARG B CB 1 ATOM 3150 C CG . ARG B 1 156 ? -3.711 27.618 -5.857 1.00 12.61 ? 156 ARG B CG 1 ATOM 3151 C CD . ARG B 1 156 ? -4.093 28.038 -7.289 1.00 15.42 ? 156 ARG B CD 1 ATOM 3152 N NE . ARG B 1 156 ? -5.022 26.996 -7.796 1.00 17.56 ? 156 ARG B NE 1 ATOM 3153 C CZ . ARG B 1 156 ? -5.460 27.030 -9.049 1.00 16.96 ? 156 ARG B CZ 1 ATOM 3154 N NH1 . ARG B 1 156 ? -5.064 28.009 -9.845 1.00 22.16 ? 156 ARG B NH1 1 ATOM 3155 N NH2 . ARG B 1 156 ? -6.272 26.090 -9.445 1.00 20.02 ? 156 ARG B NH2 1 ATOM 3156 N N . LEU B 1 157 ? -5.262 25.497 -2.536 1.00 13.56 ? 157 LEU B N 1 ATOM 3157 C CA . LEU B 1 157 ? -5.322 24.053 -2.424 1.00 13.13 ? 157 LEU B CA 1 ATOM 3158 C C . LEU B 1 157 ? -6.440 23.567 -3.370 1.00 13.95 ? 157 LEU B C 1 ATOM 3159 O O . LEU B 1 157 ? -7.541 24.088 -3.325 1.00 17.49 ? 157 LEU B O 1 ATOM 3160 C CB . LEU B 1 157 ? -5.598 23.536 -1.022 1.00 14.80 ? 157 LEU B CB 1 ATOM 3161 C CG . LEU B 1 157 ? -5.478 22.025 -0.819 1.00 15.95 ? 157 LEU B CG 1 ATOM 3162 C CD1 . LEU B 1 157 ? -4.044 21.594 -0.875 1.00 18.75 ? 157 LEU B CD1 1 ATOM 3163 C CD2 . LEU B 1 157 ? -6.121 21.586 0.498 1.00 16.46 ? 157 LEU B CD2 1 ATOM 3164 N N . ASP B 1 158 ? -6.029 22.581 -4.139 1.00 14.38 ? 158 ASP B N 1 ATOM 3165 C CA . ASP B 1 158 ? -6.949 22.067 -5.168 1.00 16.36 ? 158 ASP B CA 1 ATOM 3166 C C . ASP B 1 158 ? -7.294 20.608 -4.984 1.00 16.58 ? 158 ASP B C 1 ATOM 3167 O O . ASP B 1 158 ? -8.354 20.180 -5.461 1.00 19.33 ? 158 ASP B O 1 ATOM 3168 C CB . ASP B 1 158 ? -6.304 22.275 -6.556 1.00 14.58 ? 158 ASP B CB 1 ATOM 3169 C CG . ASP B 1 158 ? -6.197 23.734 -6.902 1.00 15.19 ? 158 ASP B CG 1 ATOM 3170 O OD1 . ASP B 1 158 ? -7.170 24.235 -7.530 1.00 19.48 ? 158 ASP B OD1 1 ATOM 3171 O OD2 . ASP B 1 158 ? -5.231 24.389 -6.527 1.00 15.41 ? 158 ASP B OD2 1 ATOM 3172 N N . ARG B 1 159 ? -6.428 19.829 -4.373 1.00 16.53 ? 159 ARG B N 1 ATOM 3173 C CA . ARG B 1 159 ? -6.548 18.393 -4.271 1.00 16.44 ? 159 ARG B CA 1 ATOM 3174 C C . ARG B 1 159 ? -6.165 17.881 -2.873 1.00 15.76 ? 159 ARG B C 1 ATOM 3175 O O . ARG B 1 159 ? -5.457 18.552 -2.161 1.00 15.59 ? 159 ARG B O 1 ATOM 3176 C CB . ARG B 1 159 ? -5.625 17.720 -5.294 1.00 17.49 ? 159 ARG B CB 1 ATOM 3177 C CG . ARG B 1 159 ? -6.007 17.995 -6.733 1.00 19.52 ? 159 ARG B CG 1 ATOM 3178 C CD . ARG B 1 159 ? -4.979 17.434 -7.709 1.00 19.10 ? 159 ARG B CD 1 ATOM 3179 N NE . ARG B 1 159 ? -3.754 18.174 -7.677 1.00 17.17 ? 159 ARG B NE 1 ATOM 3180 C CZ . ARG B 1 159 ? -2.681 18.098 -8.440 1.00 15.64 ? 159 ARG B CZ 1 ATOM 3181 N NH1 . ARG B 1 159 ? -2.674 17.206 -9.397 1.00 21.67 ? 159 ARG B NH1 1 ATOM 3182 N NH2 . ARG B 1 159 ? -1.653 18.901 -8.194 1.00 19.95 ? 159 ARG B NH2 1 ATOM 3183 N N . LYS B 1 160 ? -6.700 16.673 -2.598 1.00 16.06 ? 160 LYS B N 1 ATOM 3184 C CA . LYS B 1 160 ? -6.322 15.955 -1.356 1.00 14.98 ? 160 LYS B CA 1 ATOM 3185 C C . LYS B 1 160 ? -5.006 15.239 -1.568 1.00 13.13 ? 160 LYS B C 1 ATOM 3186 O O . LYS B 1 160 ? -4.397 15.263 -2.613 1.00 15.19 ? 160 LYS B O 1 ATOM 3187 C CB . LYS B 1 160 ? -7.488 15.065 -0.912 1.00 16.82 ? 160 LYS B CB 1 ATOM 3188 C CG . LYS B 1 160 ? -7.697 13.895 -1.887 1.00 19.00 ? 160 LYS B CG 1 ATOM 3189 C CD . LYS B 1 160 ? -8.715 12.912 -1.313 1.00 24.05 ? 160 LYS B CD 1 ATOM 3190 C CE . LYS B 1 160 ? -9.194 11.931 -2.371 1.00 28.92 ? 160 LYS B CE 1 ATOM 3191 N NZ . LYS B 1 160 ? -8.080 11.410 -3.231 1.00 29.02 ? 160 LYS B NZ 1 ATOM 3192 N N . GLU B 1 161 ? -4.568 14.534 -0.492 1.00 13.28 ? 161 GLU B N 1 ATOM 3193 C CA . GLU B 1 161 ? -3.354 13.744 -0.535 1.00 14.61 ? 161 GLU B CA 1 ATOM 3194 C C . GLU B 1 161 ? -3.604 12.350 -1.093 1.00 15.48 ? 161 GLU B C 1 ATOM 3195 O O . GLU B 1 161 ? -4.669 11.808 -0.805 1.00 16.22 ? 161 GLU B O 1 ATOM 3196 C CB . GLU B 1 161 ? -2.767 13.578 0.866 1.00 16.60 ? 161 GLU B CB 1 ATOM 3197 C CG . GLU B 1 161 ? -2.397 14.934 1.464 1.00 21.31 ? 161 GLU B CG 1 ATOM 3198 C CD . GLU B 1 161 ? -1.050 15.375 0.945 1.00 25.04 ? 161 GLU B CD 1 ATOM 3199 O OE1 . GLU B 1 161 ? -0.510 16.355 1.526 1.00 31.63 ? 161 GLU B OE1 1 ATOM 3200 O OE2 . GLU B 1 161 ? -0.481 14.797 0.009 1.00 21.81 ? 161 GLU B OE2 1 ATOM 3201 N N . PRO B 1 162 ? -2.658 11.734 -1.775 1.00 16.92 ? 162 PRO B N 1 ATOM 3202 C CA . PRO B 1 162 ? -1.335 12.265 -2.079 1.00 16.85 ? 162 PRO B CA 1 ATOM 3203 C C . PRO B 1 162 ? -1.222 13.066 -3.379 1.00 17.77 ? 162 PRO B C 1 ATOM 3204 O O . PRO B 1 162 ? -0.153 13.644 -3.632 1.00 17.30 ? 162 PRO B O 1 ATOM 3205 C CB . PRO B 1 162 ? -0.529 10.962 -2.237 1.00 22.23 ? 162 PRO B CB 1 ATOM 3206 C CG . PRO B 1 162 ? -1.525 10.063 -2.910 1.00 24.64 ? 162 PRO B CG 1 ATOM 3207 C CD . PRO B 1 162 ? -2.845 10.330 -2.223 1.00 19.85 ? 162 PRO B CD 1 ATOM 3208 N N . GLU B 1 163 ? -2.255 13.137 -4.206 1.00 18.57 ? 163 GLU B N 1 ATOM 3209 C CA . GLU B 1 163 ? -2.140 13.717 -5.558 1.00 19.63 ? 163 GLU B CA 1 ATOM 3210 C C . GLU B 1 163 ? -1.867 15.201 -5.542 1.00 16.85 ? 163 GLU B C 1 ATOM 3211 O O . GLU B 1 163 ? -1.342 15.831 -6.487 1.00 16.41 ? 163 GLU B O 1 ATOM 3212 C CB . GLU B 1 163 ? -3.383 13.391 -6.406 1.00 21.20 ? 163 GLU B CB 1 ATOM 3213 C CG . GLU B 1 163 ? -4.696 13.857 -5.820 1.00 21.65 ? 163 GLU B CG 1 ATOM 3214 C CD . GLU B 1 163 ? -5.423 12.830 -4.985 1.00 21.96 ? 163 GLU B CD 1 ATOM 3215 O OE1 . GLU B 1 163 ? -4.772 11.971 -4.346 1.00 21.49 ? 163 GLU B OE1 1 ATOM 3216 O OE2 . GLU B 1 163 ? -6.678 12.854 -4.965 1.00 24.31 ? 163 GLU B OE2 1 ATOM 3217 N N . MET B 1 164 ? -2.119 15.884 -4.436 1.00 14.77 ? 164 MET B N 1 ATOM 3218 C CA . MET B 1 164 ? -1.738 17.290 -4.360 1.00 16.15 ? 164 MET B CA 1 ATOM 3219 C C . MET B 1 164 ? -0.242 17.539 -4.450 1.00 14.53 ? 164 MET B C 1 ATOM 3220 O O . MET B 1 164 ? 0.162 18.680 -4.747 1.00 15.84 ? 164 MET B O 1 ATOM 3221 C CB . MET B 1 164 ? -2.287 17.867 -3.072 1.00 17.19 ? 164 MET B CB 1 ATOM 3222 C CG . MET B 1 164 ? -1.534 17.450 -1.820 1.00 21.98 ? 164 MET B CG 1 ATOM 3223 S SD A MET B 1 164 ? -0.269 18.569 -1.285 0.58 18.67 ? 164 MET B SD 1 ATOM 3224 S SD B MET B 1 164 ? -1.813 18.843 -0.698 0.42 34.36 ? 164 MET B SD 1 ATOM 3225 C CE A MET B 1 164 ? -1.000 20.163 -1.114 0.58 22.16 ? 164 MET B CE 1 ATOM 3226 C CE B MET B 1 164 ? -3.482 18.254 -0.255 0.42 36.43 ? 164 MET B CE 1 ATOM 3227 N N . GLY B 1 165 ? 0.538 16.484 -4.203 1.00 13.88 ? 165 GLY B N 1 ATOM 3228 C CA . GLY B 1 165 ? 1.979 16.541 -4.341 1.00 14.64 ? 165 GLY B CA 1 ATOM 3229 C C . GLY B 1 165 ? 2.554 16.224 -5.679 1.00 12.81 ? 165 GLY B C 1 ATOM 3230 O O . GLY B 1 165 ? 3.778 16.129 -5.813 1.00 14.06 ? 165 GLY B O 1 ATOM 3231 N N . ASP B 1 166 ? 1.731 16.082 -6.701 1.00 13.96 ? 166 ASP B N 1 ATOM 3232 C CA . ASP B 1 166 ? 2.233 15.654 -7.994 1.00 14.85 ? 166 ASP B CA 1 ATOM 3233 C C . ASP B 1 166 ? 3.237 16.618 -8.610 1.00 13.26 ? 166 ASP B C 1 ATOM 3234 O O . ASP B 1 166 ? 4.151 16.233 -9.336 1.00 16.17 ? 166 ASP B O 1 ATOM 3235 C CB . ASP B 1 166 ? 1.030 15.469 -8.922 1.00 16.87 ? 166 ASP B CB 1 ATOM 3236 C CG . ASP B 1 166 ? 0.294 14.165 -8.709 0.73 21.12 ? 166 ASP B CG 1 ATOM 3237 O OD1 . ASP B 1 166 ? 0.729 13.348 -7.881 0.73 25.30 ? 166 ASP B OD1 1 ATOM 3238 O OD2 . ASP B 1 166 ? -0.725 13.962 -9.421 0.73 31.93 ? 166 ASP B OD2 1 ATOM 3239 N N . ASN B 1 167 ? 3.054 17.910 -8.302 1.00 12.98 ? 167 ASN B N 1 ATOM 3240 C CA . ASN B 1 167 ? 3.998 18.897 -8.734 1.00 11.87 ? 167 ASN B CA 1 ATOM 3241 C C . ASN B 1 167 ? 4.384 18.857 -10.214 1.00 12.09 ? 167 ASN B C 1 ATOM 3242 O O . ASN B 1 167 ? 5.565 18.866 -10.597 1.00 13.78 ? 167 ASN B O 1 ATOM 3243 C CB . ASN B 1 167 ? 5.289 18.818 -7.887 1.00 13.46 ? 167 ASN B CB 1 ATOM 3244 C CG . ASN B 1 167 ? 6.284 19.947 -7.991 1.00 12.44 ? 167 ASN B CG 1 ATOM 3245 O OD1 . ASN B 1 167 ? 7.490 19.799 -7.660 1.00 15.65 ? 167 ASN B OD1 1 ATOM 3246 N ND2 . ASN B 1 167 ? 5.837 21.122 -8.361 1.00 12.05 ? 167 ASN B ND2 1 ATOM 3247 N N . THR B 1 168 ? 3.362 18.786 -11.026 1.00 14.20 ? 168 THR B N 1 ATOM 3248 C CA . THR B 1 168 ? 3.503 18.797 -12.474 1.00 14.89 ? 168 THR B CA 1 ATOM 3249 C C . THR B 1 168 ? 4.089 20.154 -12.891 1.00 14.68 ? 168 THR B C 1 ATOM 3250 O O . THR B 1 168 ? 3.565 21.194 -12.454 1.00 14.08 ? 168 THR B O 1 ATOM 3251 C CB . THR B 1 168 ? 2.128 18.553 -13.104 1.00 21.52 ? 168 THR B CB 1 ATOM 3252 O OG1 . THR B 1 168 ? 1.575 17.317 -12.613 1.00 22.37 ? 168 THR B OG1 1 ATOM 3253 C CG2 . THR B 1 168 ? 2.329 18.448 -14.608 1.00 27.18 ? 168 THR B CG2 1 ATOM 3254 N N . PRO B 1 169 ? 5.119 20.230 -13.721 1.00 16.65 ? 169 PRO B N 1 ATOM 3255 C CA . PRO B 1 169 ? 5.643 21.553 -14.132 1.00 19.76 ? 169 PRO B CA 1 ATOM 3256 C C . PRO B 1 169 ? 4.576 22.414 -14.790 1.00 19.20 ? 169 PRO B C 1 ATOM 3257 O O . PRO B 1 169 ? 3.835 21.905 -15.628 1.00 24.94 ? 169 PRO B O 1 ATOM 3258 C CB . PRO B 1 169 ? 6.743 21.181 -15.151 1.00 25.26 ? 169 PRO B CB 1 ATOM 3259 C CG . PRO B 1 169 ? 7.126 19.783 -14.803 1.00 24.01 ? 169 PRO B CG 1 ATOM 3260 C CD . PRO B 1 169 ? 5.894 19.114 -14.254 1.00 21.21 ? 169 PRO B CD 1 ATOM 3261 N N . GLY B 1 170 ? 4.529 23.675 -14.341 1.00 15.90 ? 170 GLY B N 1 ATOM 3262 C CA . GLY B 1 170 ? 3.592 24.650 -14.869 1.00 20.03 ? 170 GLY B CA 1 ATOM 3263 C C . GLY B 1 170 ? 2.194 24.573 -14.306 1.00 14.56 ? 170 GLY B C 1 ATOM 3264 O O . GLY B 1 170 ? 1.365 25.432 -14.563 1.00 17.01 ? 170 GLY B O 1 ATOM 3265 N N . ASP B 1 171 ? 1.890 23.536 -13.487 1.00 14.98 ? 171 ASP B N 1 ATOM 3266 C CA . ASP B 1 171 ? 0.553 23.427 -12.914 1.00 14.78 ? 171 ASP B CA 1 ATOM 3267 C C . ASP B 1 171 ? 0.388 24.412 -11.753 1.00 13.85 ? 171 ASP B C 1 ATOM 3268 O O . ASP B 1 171 ? 1.212 24.418 -10.839 1.00 17.35 ? 171 ASP B O 1 ATOM 3269 C CB . ASP B 1 171 ? 0.354 22.032 -12.350 1.00 17.54 ? 171 ASP B CB 1 ATOM 3270 C CG . ASP B 1 171 ? -1.049 21.595 -12.027 1.00 17.21 ? 171 ASP B CG 1 ATOM 3271 O OD1 . ASP B 1 171 ? -1.972 22.419 -11.923 1.00 18.80 ? 171 ASP B OD1 1 ATOM 3272 O OD2 . ASP B 1 171 ? -1.199 20.350 -11.815 1.00 21.03 ? 171 ASP B OD2 1 ATOM 3273 N N . LEU B 1 172 ? -0.691 25.190 -11.693 1.00 13.65 ? 172 LEU B N 1 ATOM 3274 C CA . LEU B 1 172 ? -0.997 26.193 -10.698 1.00 13.58 ? 172 LEU B CA 1 ATOM 3275 C C . LEU B 1 172 ? -1.673 25.519 -9.512 1.00 11.93 ? 172 LEU B C 1 ATOM 3276 O O . LEU B 1 172 ? -1.737 26.106 -8.438 1.00 12.28 ? 172 LEU B O 1 ATOM 3277 C CB . LEU B 1 172 ? -1.899 27.302 -11.197 1.00 17.19 ? 172 LEU B CB 1 ATOM 3278 C CG . LEU B 1 172 ? -1.531 28.333 -12.241 1.00 26.47 ? 172 LEU B CG 1 ATOM 3279 C CD1 . LEU B 1 172 ? -2.559 29.465 -12.294 1.00 33.78 ? 172 LEU B CD1 1 ATOM 3280 C CD2 . LEU B 1 172 ? -0.153 28.917 -11.984 1.00 37.23 ? 172 LEU B CD2 1 ATOM 3281 N N . ARG B 1 173 ? -2.165 24.304 -9.704 1.00 12.14 ? 173 ARG B N 1 ATOM 3282 C CA . ARG B 1 173 ? -2.855 23.671 -8.582 1.00 13.39 ? 173 ARG B CA 1 ATOM 3283 C C . ARG B 1 173 ? -1.942 23.486 -7.378 1.00 11.96 ? 173 ARG B C 1 ATOM 3284 O O . ARG B 1 173 ? -0.750 23.141 -7.561 1.00 12.09 ? 173 ARG B O 1 ATOM 3285 C CB . ARG B 1 173 ? -3.386 22.301 -9.007 1.00 16.82 ? 173 ARG B CB 1 ATOM 3286 C CG . ARG B 1 173 ? -4.585 22.470 -9.946 1.00 20.99 ? 173 ARG B CG 1 ATOM 3287 C CD . ARG B 1 173 ? -5.137 21.107 -10.322 1.00 21.43 ? 173 ARG B CD 1 ATOM 3288 N NE . ARG B 1 173 ? -4.156 20.352 -11.100 1.00 23.47 ? 173 ARG B NE 1 ATOM 3289 C CZ . ARG B 1 173 ? -4.377 19.131 -11.575 1.00 23.14 ? 173 ARG B CZ 1 ATOM 3290 N NH1 . ARG B 1 173 ? -5.540 18.536 -11.340 1.00 23.85 ? 173 ARG B NH1 1 ATOM 3291 N NH2 . ARG B 1 173 ? -3.441 18.501 -12.281 1.00 24.11 ? 173 ARG B NH2 1 ATOM 3292 N N . ASP B 1 174 ? -2.413 23.711 -6.183 1.00 11.73 ? 174 ASP B N 1 ATOM 3293 C CA . ASP B 1 174 ? -1.713 23.342 -4.957 1.00 10.84 ? 174 ASP B CA 1 ATOM 3294 C C . ASP B 1 174 ? -0.414 24.141 -4.792 1.00 11.07 ? 174 ASP B C 1 ATOM 3295 O O . ASP B 1 174 ? 0.567 23.559 -4.308 1.00 13.03 ? 174 ASP B O 1 ATOM 3296 C CB . ASP B 1 174 ? -1.495 21.829 -4.962 1.00 11.87 ? 174 ASP B CB 1 ATOM 3297 C CG . ASP B 1 174 ? -2.805 21.087 -5.040 1.00 14.09 ? 174 ASP B CG 1 ATOM 3298 O OD1 . ASP B 1 174 ? -3.709 21.262 -4.195 1.00 14.93 ? 174 ASP B OD1 1 ATOM 3299 O OD2 . ASP B 1 174 ? -2.967 20.353 -6.064 1.00 16.98 ? 174 ASP B OD2 1 ATOM 3300 N N . THR B 1 175 ? -0.368 25.380 -5.181 1.00 10.55 ? 175 THR B N 1 ATOM 3301 C CA . THR B 1 175 ? 0.803 26.218 -5.131 1.00 10.14 ? 175 THR B CA 1 ATOM 3302 C C . THR B 1 175 ? 0.625 27.427 -4.228 1.00 9.98 ? 175 THR B C 1 ATOM 3303 O O . THR B 1 175 ? -0.489 27.834 -3.883 1.00 11.43 ? 175 THR B O 1 ATOM 3304 C CB . THR B 1 175 ? 1.213 26.711 -6.535 1.00 11.81 ? 175 THR B CB 1 ATOM 3305 O OG1 . THR B 1 175 ? 0.160 27.419 -7.156 1.00 14.00 ? 175 THR B OG1 1 ATOM 3306 C CG2 . THR B 1 175 ? 1.530 25.563 -7.475 1.00 12.77 ? 175 THR B CG2 1 ATOM 3307 N N . THR B 1 176 ? 1.778 27.999 -3.905 1.00 9.84 ? 176 THR B N 1 ATOM 3308 C CA . THR B 1 176 ? 1.869 29.262 -3.215 1.00 9.44 ? 176 THR B CA 1 ATOM 3309 C C . THR B 1 176 ? 3.091 30.003 -3.747 1.00 9.03 ? 176 THR B C 1 ATOM 3310 O O . THR B 1 176 ? 3.771 29.502 -4.640 1.00 11.13 ? 176 THR B O 1 ATOM 3311 C CB . THR B 1 176 ? 2.020 29.036 -1.687 1.00 10.03 ? 176 THR B CB 1 ATOM 3312 O OG1 . THR B 1 176 ? 2.031 30.265 -1.063 1.00 11.44 ? 176 THR B OG1 1 ATOM 3313 C CG2 . THR B 1 176 ? 3.326 28.396 -1.300 1.00 10.63 ? 176 THR B CG2 1 ATOM 3314 N N . THR B 1 177 ? 3.390 31.170 -3.222 1.00 9.64 ? 177 THR B N 1 ATOM 3315 C CA . THR B 1 177 ? 4.678 31.832 -3.418 1.00 9.75 ? 177 THR B CA 1 ATOM 3316 C C . THR B 1 177 ? 5.338 31.985 -2.045 1.00 8.94 ? 177 THR B C 1 ATOM 3317 O O . THR B 1 177 ? 4.664 32.008 -1.048 1.00 9.90 ? 177 THR B O 1 ATOM 3318 C CB . THR B 1 177 ? 4.565 33.223 -4.064 1.00 10.92 ? 177 THR B CB 1 ATOM 3319 O OG1 . THR B 1 177 ? 3.877 34.092 -3.134 1.00 11.25 ? 177 THR B OG1 1 ATOM 3320 C CG2 . THR B 1 177 ? 3.797 33.172 -5.387 1.00 13.03 ? 177 THR B CG2 1 ATOM 3321 N N . PRO B 1 178 ? 6.661 32.079 -2.051 1.00 8.84 ? 178 PRO B N 1 ATOM 3322 C CA . PRO B 1 178 ? 7.313 32.251 -0.742 1.00 8.63 ? 178 PRO B CA 1 ATOM 3323 C C . PRO B 1 178 ? 6.774 33.449 0.029 1.00 8.22 ? 178 PRO B C 1 ATOM 3324 O O . PRO B 1 178 ? 6.548 33.312 1.260 1.00 8.95 ? 178 PRO B O 1 ATOM 3325 C CB . PRO B 1 178 ? 8.792 32.390 -1.092 1.00 9.64 ? 178 PRO B CB 1 ATOM 3326 C CG . PRO B 1 178 ? 8.880 31.572 -2.356 1.00 9.91 ? 178 PRO B CG 1 ATOM 3327 C CD . PRO B 1 178 ? 7.621 31.898 -3.119 1.00 10.05 ? 178 PRO B CD 1 ATOM 3328 N N . ILE B 1 179 ? 6.585 34.611 -0.613 1.00 8.98 ? 179 ILE B N 1 ATOM 3329 C CA . ILE B 1 179 ? 6.148 35.756 0.162 1.00 9.26 ? 179 ILE B CA 1 ATOM 3330 C C . ILE B 1 179 ? 4.719 35.569 0.642 1.00 9.15 ? 179 ILE B C 1 ATOM 3331 O O . ILE B 1 179 ? 4.397 35.947 1.799 1.00 10.17 ? 179 ILE B O 1 ATOM 3332 C CB . ILE B 1 179 ? 6.311 37.083 -0.602 1.00 9.99 ? 179 ILE B CB 1 ATOM 3333 C CG1 . ILE B 1 179 ? 6.048 38.315 0.279 1.00 11.77 ? 179 ILE B CG1 1 ATOM 3334 C CG2 . ILE B 1 179 ? 5.511 37.117 -1.888 1.00 12.26 ? 179 ILE B CG2 1 ATOM 3335 C CD1 . ILE B 1 179 ? 6.908 38.401 1.492 1.00 12.60 ? 179 ILE B CD1 1 ATOM 3336 N N . ALA B 1 180 ? 3.838 34.993 -0.149 1.00 9.31 ? 180 ALA B N 1 ATOM 3337 C CA . ALA B 1 180 ? 2.467 34.778 0.285 1.00 11.03 ? 180 ALA B CA 1 ATOM 3338 C C . ALA B 1 180 ? 2.411 33.867 1.501 1.00 9.49 ? 180 ALA B C 1 ATOM 3339 O O . ALA B 1 180 ? 1.699 34.132 2.481 1.00 10.55 ? 180 ALA B O 1 ATOM 3340 C CB . ALA B 1 180 ? 1.634 34.221 -0.854 1.00 13.46 ? 180 ALA B CB 1 ATOM 3341 N N . MET B 1 181 ? 3.163 32.797 1.441 1.00 9.06 ? 181 MET B N 1 ATOM 3342 C CA . MET B 1 181 ? 3.152 31.843 2.518 1.00 9.00 ? 181 MET B CA 1 ATOM 3343 C C . MET B 1 181 ? 3.812 32.395 3.799 1.00 8.72 ? 181 MET B C 1 ATOM 3344 O O . MET B 1 181 ? 3.325 32.175 4.887 1.00 8.77 ? 181 MET B O 1 ATOM 3345 C CB . MET B 1 181 ? 3.744 30.480 2.141 1.00 9.53 ? 181 MET B CB 1 ATOM 3346 C CG . MET B 1 181 ? 3.570 29.454 3.222 1.00 9.40 ? 181 MET B CG 1 ATOM 3347 S SD . MET B 1 181 ? 1.849 29.073 3.652 1.00 10.36 ? 181 MET B SD 1 ATOM 3348 C CE . MET B 1 181 ? 1.322 28.122 2.261 1.00 13.88 ? 181 MET B CE 1 ATOM 3349 N N . ALA B 1 182 ? 4.938 33.114 3.627 1.00 8.71 ? 182 ALA B N 1 ATOM 3350 C CA . ALA B 1 182 ? 5.562 33.697 4.794 1.00 8.16 ? 182 ALA B CA 1 ATOM 3351 C C . ALA B 1 182 ? 4.607 34.632 5.500 1.00 8.12 ? 182 ALA B C 1 ATOM 3352 O O . ALA B 1 182 ? 4.551 34.708 6.735 1.00 8.68 ? 182 ALA B O 1 ATOM 3353 C CB . ALA B 1 182 ? 6.860 34.390 4.450 1.00 8.87 ? 182 ALA B CB 1 ATOM 3354 N N . ARG B 1 183 ? 3.880 35.442 4.713 1.00 9.03 ? 183 ARG B N 1 ATOM 3355 C CA . ARG B 1 183 ? 2.921 36.355 5.284 1.00 9.48 ? 183 ARG B CA 1 ATOM 3356 C C . ARG B 1 183 ? 1.740 35.655 5.918 1.00 8.84 ? 183 ARG B C 1 ATOM 3357 O O . ARG B 1 183 ? 1.247 36.104 6.960 1.00 10.37 ? 183 ARG B O 1 ATOM 3358 C CB . ARG B 1 183 ? 2.452 37.373 4.218 1.00 9.95 ? 183 ARG B CB 1 ATOM 3359 C CG . ARG B 1 183 ? 3.578 38.413 4.025 1.00 9.88 ? 183 ARG B CG 1 ATOM 3360 C CD . ARG B 1 183 ? 3.157 39.418 2.987 1.00 13.12 ? 183 ARG B CD 1 ATOM 3361 N NE . ARG B 1 183 ? 4.115 40.526 3.014 1.00 12.84 ? 183 ARG B NE 1 ATOM 3362 C CZ . ARG B 1 183 ? 4.418 41.322 1.979 1.00 11.61 ? 183 ARG B CZ 1 ATOM 3363 N NH1 . ARG B 1 183 ? 3.862 41.120 0.793 1.00 13.02 ? 183 ARG B NH1 1 ATOM 3364 N NH2 . ARG B 1 183 ? 5.305 42.280 2.176 1.00 13.93 ? 183 ARG B NH2 1 ATOM 3365 N N . THR B 1 184 ? 1.358 34.522 5.385 1.00 8.70 ? 184 THR B N 1 ATOM 3366 C CA . THR B 1 184 ? 0.320 33.682 6.006 1.00 9.18 ? 184 THR B CA 1 ATOM 3367 C C . THR B 1 184 ? 0.803 33.112 7.351 1.00 8.82 ? 184 THR B C 1 ATOM 3368 O O . THR B 1 184 ? 0.092 33.147 8.331 1.00 9.56 ? 184 THR B O 1 ATOM 3369 C CB . THR B 1 184 ? -0.105 32.572 5.052 1.00 9.40 ? 184 THR B CB 1 ATOM 3370 O OG1 . THR B 1 184 ? -0.982 33.209 4.092 1.00 13.19 ? 184 THR B OG1 1 ATOM 3371 C CG2 . THR B 1 184 ? -0.808 31.405 5.708 1.00 12.34 ? 184 THR B CG2 1 ATOM 3372 N N . VAL B 1 185 ? 2.050 32.645 7.405 1.00 8.25 ? 185 VAL B N 1 ATOM 3373 C CA . VAL B 1 185 ? 2.610 32.186 8.667 1.00 8.78 ? 185 VAL B CA 1 ATOM 3374 C C . VAL B 1 185 ? 2.600 33.289 9.698 1.00 8.24 ? 185 VAL B C 1 ATOM 3375 O O . VAL B 1 185 ? 2.207 33.109 10.846 1.00 9.27 ? 185 VAL B O 1 ATOM 3376 C CB . VAL B 1 185 ? 4.043 31.630 8.474 1.00 8.94 ? 185 VAL B CB 1 ATOM 3377 C CG1 . VAL B 1 185 ? 4.660 31.342 9.840 1.00 9.95 ? 185 VAL B CG1 1 ATOM 3378 C CG2 . VAL B 1 185 ? 4.006 30.404 7.589 1.00 9.90 ? 185 VAL B CG2 1 ATOM 3379 N N . ALA B 1 186 ? 3.035 34.500 9.304 1.00 8.72 ? 186 ALA B N 1 ATOM 3380 C CA . ALA B 1 186 ? 3.064 35.612 10.205 1.00 9.22 ? 186 ALA B CA 1 ATOM 3381 C C . ALA B 1 186 ? 1.640 35.958 10.646 1.00 9.23 ? 186 ALA B C 1 ATOM 3382 O O . ALA B 1 186 ? 1.483 36.257 11.848 1.00 9.88 ? 186 ALA B O 1 ATOM 3383 C CB . ALA B 1 186 ? 3.709 36.863 9.613 1.00 11.05 ? 186 ALA B CB 1 ATOM 3384 N N . LYS B 1 187 ? 0.656 35.958 9.771 1.00 10.14 ? 187 LYS B N 1 ATOM 3385 C CA . LYS B 1 187 ? -0.708 36.253 10.222 1.00 10.29 ? 187 LYS B CA 1 ATOM 3386 C C . LYS B 1 187 ? -1.210 35.277 11.272 1.00 9.75 ? 187 LYS B C 1 ATOM 3387 O O . LYS B 1 187 ? -1.821 35.660 12.241 1.00 11.86 ? 187 LYS B O 1 ATOM 3388 C CB . LYS B 1 187 ? -1.639 36.174 9.033 1.00 12.96 ? 187 LYS B CB 1 ATOM 3389 C CG . LYS B 1 187 ? -2.925 36.952 9.162 1.00 23.66 ? 187 LYS B CG 1 ATOM 3390 C CD . LYS B 1 187 ? -2.805 38.453 9.270 1.00 28.18 ? 187 LYS B CD 1 ATOM 3391 C CE . LYS B 1 187 ? -2.506 39.214 8.002 1.00 40.45 ? 187 LYS B CE 1 ATOM 3392 N NZ . LYS B 1 187 ? -3.420 40.359 7.731 1.00 43.72 ? 187 LYS B NZ 1 ATOM 3393 N N . VAL B 1 188 ? -0.937 33.978 11.088 1.00 10.19 ? 188 VAL B N 1 ATOM 3394 C CA . VAL B 1 188 ? -1.357 32.938 11.978 1.00 10.24 ? 188 VAL B CA 1 ATOM 3395 C C . VAL B 1 188 ? -0.627 33.023 13.328 1.00 10.12 ? 188 VAL B C 1 ATOM 3396 O O . VAL B 1 188 ? -1.264 32.839 14.365 1.00 11.90 ? 188 VAL B O 1 ATOM 3397 C CB . VAL B 1 188 ? -1.159 31.548 11.339 1.00 11.09 ? 188 VAL B CB 1 ATOM 3398 C CG1 . VAL B 1 188 ? -1.334 30.445 12.377 1.00 11.01 ? 188 VAL B CG1 1 ATOM 3399 C CG2 . VAL B 1 188 ? -2.060 31.377 10.140 1.00 14.52 ? 188 VAL B CG2 1 ATOM 3400 N N . LEU B 1 189 ? 0.681 33.293 13.333 1.00 9.31 ? 189 LEU B N 1 ATOM 3401 C CA . LEU B 1 189 ? 1.404 33.275 14.593 1.00 10.11 ? 189 LEU B CA 1 ATOM 3402 C C . LEU B 1 189 ? 1.507 34.589 15.315 1.00 11.42 ? 189 LEU B C 1 ATOM 3403 O O . LEU B 1 189 ? 1.623 34.596 16.523 1.00 12.09 ? 189 LEU B O 1 ATOM 3404 C CB . LEU B 1 189 ? 2.820 32.747 14.307 1.00 10.27 ? 189 LEU B CB 1 ATOM 3405 C CG . LEU B 1 189 ? 2.884 31.289 13.815 1.00 10.61 ? 189 LEU B CG 1 ATOM 3406 C CD1 . LEU B 1 189 ? 4.328 30.945 13.478 1.00 12.38 ? 189 LEU B CD1 1 ATOM 3407 C CD2 . LEU B 1 189 ? 2.259 30.335 14.826 1.00 15.30 ? 189 LEU B CD2 1 ATOM 3408 N N . TYR B 1 190 ? 1.451 35.684 14.561 1.00 11.01 ? 190 TYR B N 1 ATOM 3409 C CA . TYR B 1 190 ? 1.698 36.996 15.118 1.00 11.16 ? 190 TYR B CA 1 ATOM 3410 C C . TYR B 1 190 ? 0.632 38.028 14.782 1.00 12.53 ? 190 TYR B C 1 ATOM 3411 O O . TYR B 1 190 ? 0.599 39.076 15.454 1.00 16.18 ? 190 TYR B O 1 ATOM 3412 C CB . TYR B 1 190 ? 3.031 37.534 14.568 1.00 10.86 ? 190 TYR B CB 1 ATOM 3413 C CG . TYR B 1 190 ? 4.228 36.633 14.742 1.00 12.42 ? 190 TYR B CG 1 ATOM 3414 C CD1 . TYR B 1 190 ? 4.974 36.219 13.644 1.00 13.42 ? 190 TYR B CD1 1 ATOM 3415 C CD2 . TYR B 1 190 ? 4.638 36.208 15.999 1.00 15.96 ? 190 TYR B CD2 1 ATOM 3416 C CE1 . TYR B 1 190 ? 6.075 35.420 13.720 1.00 17.61 ? 190 TYR B CE1 1 ATOM 3417 C CE2 . TYR B 1 190 ? 5.749 35.394 16.085 1.00 17.61 ? 190 TYR B CE2 1 ATOM 3418 C CZ . TYR B 1 190 ? 6.446 35.006 14.974 1.00 19.17 ? 190 TYR B CZ 1 ATOM 3419 O OH . TYR B 1 190 ? 7.541 34.195 15.148 1.00 23.81 ? 190 TYR B OH 1 ATOM 3420 N N . GLY B 1 191 ? -0.223 37.803 13.798 1.00 13.52 ? 191 GLY B N 1 ATOM 3421 C CA . GLY B 1 191 ? -1.110 38.784 13.302 1.00 15.12 ? 191 GLY B CA 1 ATOM 3422 C C . GLY B 1 191 ? -2.549 38.645 13.722 1.00 16.10 ? 191 GLY B C 1 ATOM 3423 O O . GLY B 1 191 ? -3.457 39.251 13.140 1.00 18.48 ? 191 GLY B O 1 ATOM 3424 N N . GLY B 1 192 ? -2.811 37.868 14.762 1.00 14.98 ? 192 GLY B N 1 ATOM 3425 C CA . GLY B 1 192 ? -4.125 37.808 15.346 1.00 17.61 ? 192 GLY B CA 1 ATOM 3426 C C . GLY B 1 192 ? -5.139 36.929 14.643 1.00 16.61 ? 192 GLY B C 1 ATOM 3427 O O . GLY B 1 192 ? -6.351 37.040 14.936 1.00 18.38 ? 192 GLY B O 1 ATOM 3428 N N . ALA B 1 193 ? -4.748 36.057 13.729 1.00 13.08 ? 193 ALA B N 1 ATOM 3429 C CA . ALA B 1 193 ? -5.723 35.167 13.093 1.00 13.27 ? 193 ALA B CA 1 ATOM 3430 C C . ALA B 1 193 ? -6.369 34.225 14.094 1.00 13.41 ? 193 ALA B C 1 ATOM 3431 O O . ALA B 1 193 ? -7.527 33.805 13.841 1.00 13.29 ? 193 ALA B O 1 ATOM 3432 C CB . ALA B 1 193 ? -4.995 34.442 11.966 1.00 15.22 ? 193 ALA B CB 1 ATOM 3433 N N . LEU B 1 194 ? -5.660 33.877 15.166 1.00 12.21 ? 194 LEU B N 1 ATOM 3434 C CA . LEU B 1 194 ? -6.146 32.910 16.127 1.00 10.72 ? 194 LEU B CA 1 ATOM 3435 C C . LEU B 1 194 ? -6.146 33.526 17.521 1.00 11.30 ? 194 LEU B C 1 ATOM 3436 O O . LEU B 1 194 ? -5.419 34.467 17.809 1.00 11.85 ? 194 LEU B O 1 ATOM 3437 C CB . LEU B 1 194 ? -5.285 31.652 16.140 1.00 11.09 ? 194 LEU B CB 1 ATOM 3438 C CG . LEU B 1 194 ? -5.153 30.916 14.796 1.00 11.03 ? 194 LEU B CG 1 ATOM 3439 C CD1 . LEU B 1 194 ? -4.212 29.752 14.914 1.00 11.03 ? 194 LEU B CD1 1 ATOM 3440 C CD2 . LEU B 1 194 ? -6.522 30.418 14.340 1.00 13.45 ? 194 LEU B CD2 1 ATOM 3441 N N . THR B 1 195 ? -6.965 32.971 18.401 1.00 11.72 ? 195 THR B N 1 ATOM 3442 C CA . THR B 1 195 ? -6.982 33.404 19.788 1.00 12.39 ? 195 THR B CA 1 ATOM 3443 C C . THR B 1 195 ? -5.604 33.125 20.399 1.00 13.46 ? 195 THR B C 1 ATOM 3444 O O . THR B 1 195 ? -4.845 32.331 19.874 1.00 10.93 ? 195 THR B O 1 ATOM 3445 C CB . THR B 1 195 ? -8.020 32.683 20.641 1.00 13.60 ? 195 THR B CB 1 ATOM 3446 O OG1 . THR B 1 195 ? -7.711 31.264 20.620 1.00 13.26 ? 195 THR B OG1 1 ATOM 3447 C CG2 . THR B 1 195 ? -9.460 32.876 20.194 1.00 20.06 ? 195 THR B CG2 1 ATOM 3448 N N . SER B 1 196 ? -5.300 33.735 21.528 1.00 15.36 ? 196 SER B N 1 ATOM 3449 C CA . SER B 1 196 ? -4.038 33.523 22.234 1.00 14.04 ? 196 SER B CA 1 ATOM 3450 C C . SER B 1 196 ? -3.818 32.038 22.484 1.00 12.46 ? 196 SER B C 1 ATOM 3451 O O . SER B 1 196 ? -2.734 31.496 22.249 1.00 13.07 ? 196 SER B O 1 ATOM 3452 C CB A SER B 1 196 ? -3.983 34.297 23.555 0.57 20.00 ? 196 SER B CB 1 ATOM 3453 C CB B SER B 1 196 ? -4.047 34.314 23.543 0.43 18.78 ? 196 SER B CB 1 ATOM 3454 O OG A SER B 1 196 ? -2.773 33.988 24.249 0.57 31.56 ? 196 SER B OG 1 ATOM 3455 O OG B SER B 1 196 ? -5.203 34.116 24.338 0.43 25.85 ? 196 SER B OG 1 ATOM 3456 N N . THR B 1 197 ? -4.850 31.364 22.985 1.00 12.86 ? 197 THR B N 1 ATOM 3457 C CA . THR B 1 197 ? -4.701 29.942 23.323 1.00 13.12 ? 197 THR B CA 1 ATOM 3458 C C . THR B 1 197 ? -4.404 29.112 22.098 1.00 11.40 ? 197 THR B C 1 ATOM 3459 O O . THR B 1 197 ? -3.478 28.276 22.112 1.00 11.76 ? 197 THR B O 1 ATOM 3460 C CB . THR B 1 197 ? -5.962 29.457 24.070 1.00 20.25 ? 197 THR B CB 1 ATOM 3461 O OG1 . THR B 1 197 ? -6.048 30.195 25.285 1.00 26.50 ? 197 THR B OG1 1 ATOM 3462 C CG2 . THR B 1 197 ? -5.736 27.999 24.374 1.00 23.76 ? 197 THR B CG2 1 ATOM 3463 N N . SER B 1 198 ? -5.156 29.317 21.029 1.00 10.64 ? 198 SER B N 1 ATOM 3464 C CA . SER B 1 198 ? -4.941 28.534 19.801 1.00 10.23 ? 198 SER B CA 1 ATOM 3465 C C . SER B 1 198 ? -3.580 28.835 19.173 1.00 9.47 ? 198 SER B C 1 ATOM 3466 O O . SER B 1 198 ? -2.920 27.927 18.652 1.00 9.77 ? 198 SER B O 1 ATOM 3467 C CB . SER B 1 198 ? -6.069 28.785 18.790 1.00 10.59 ? 198 SER B CB 1 ATOM 3468 O OG . SER B 1 198 ? -7.261 28.229 19.331 1.00 11.97 ? 198 SER B OG 1 ATOM 3469 N N . THR B 1 199 ? -3.170 30.107 19.222 1.00 9.46 ? 199 THR B N 1 ATOM 3470 C CA . THR B 1 199 ? -1.887 30.516 18.714 1.00 9.21 ? 199 THR B CA 1 ATOM 3471 C C . THR B 1 199 ? -0.782 29.789 19.444 1.00 9.28 ? 199 THR B C 1 ATOM 3472 O O . THR B 1 199 ? 0.171 29.274 18.836 1.00 9.95 ? 199 THR B O 1 ATOM 3473 C CB . THR B 1 199 ? -1.685 32.050 18.815 1.00 9.53 ? 199 THR B CB 1 ATOM 3474 O OG1 . THR B 1 199 ? -2.739 32.751 18.140 1.00 10.41 ? 199 THR B OG1 1 ATOM 3475 C CG2 . THR B 1 199 ? -0.409 32.456 18.112 1.00 12.08 ? 199 THR B CG2 1 ATOM 3476 N N . HIS B 1 200 ? -0.866 29.775 20.760 1.00 9.56 ? 200 HIS B N 1 ATOM 3477 C CA . HIS B 1 200 ? 0.167 29.093 21.547 1.00 9.90 ? 200 HIS B CA 1 ATOM 3478 C C . HIS B 1 200 ? 0.202 27.608 21.237 1.00 9.54 ? 200 HIS B C 1 ATOM 3479 O O . HIS B 1 200 ? 1.314 27.065 21.097 1.00 10.60 ? 200 HIS B O 1 ATOM 3480 C CB . HIS B 1 200 ? -0.022 29.368 23.030 1.00 11.58 ? 200 HIS B CB 1 ATOM 3481 C CG . HIS B 1 200 ? 1.055 28.761 23.866 1.00 16.16 ? 200 HIS B CG 1 ATOM 3482 N ND1 . HIS B 1 200 ? 2.299 29.323 24.017 1.00 24.87 ? 200 HIS B ND1 1 ATOM 3483 C CD2 . HIS B 1 200 ? 1.056 27.632 24.619 1.00 21.28 ? 200 HIS B CD2 1 ATOM 3484 C CE1 . HIS B 1 200 ? 3.030 28.582 24.809 1.00 23.30 ? 200 HIS B CE1 1 ATOM 3485 N NE2 . HIS B 1 200 ? 2.300 27.551 25.191 1.00 24.48 ? 200 HIS B NE2 1 ATOM 3486 N N . THR B 1 201 ? -0.962 26.991 21.110 1.00 9.21 ? 201 THR B N 1 ATOM 3487 C CA . THR B 1 201 ? -0.965 25.557 20.822 1.00 9.63 ? 201 THR B CA 1 ATOM 3488 C C . THR B 1 201 ? -0.309 25.241 19.477 1.00 8.58 ? 201 THR B C 1 ATOM 3489 O O . THR B 1 201 ? 0.504 24.339 19.398 1.00 8.50 ? 201 THR B O 1 ATOM 3490 C CB . THR B 1 201 ? -2.400 25.015 20.875 1.00 11.41 ? 201 THR B CB 1 ATOM 3491 O OG1 . THR B 1 201 ? -2.852 25.157 22.229 1.00 13.52 ? 201 THR B OG1 1 ATOM 3492 C CG2 . THR B 1 201 ? -2.458 23.549 20.539 1.00 12.08 ? 201 THR B CG2 1 ATOM 3493 N N . ILE B 1 202 ? -0.698 25.967 18.433 1.00 7.76 ? 202 ILE B N 1 ATOM 3494 C CA . ILE B 1 202 ? -0.107 25.675 17.145 1.00 8.29 ? 202 ILE B CA 1 ATOM 3495 C C . ILE B 1 202 ? 1.382 25.953 17.090 1.00 8.56 ? 202 ILE B C 1 ATOM 3496 O O . ILE B 1 202 ? 2.123 25.269 16.453 1.00 8.73 ? 202 ILE B O 1 ATOM 3497 C CB . ILE B 1 202 ? -0.921 26.338 16.016 1.00 9.48 ? 202 ILE B CB 1 ATOM 3498 C CG1 . ILE B 1 202 ? -0.760 25.607 14.716 1.00 11.45 ? 202 ILE B CG1 1 ATOM 3499 C CG2 . ILE B 1 202 ? -0.638 27.796 15.924 1.00 10.99 ? 202 ILE B CG2 1 ATOM 3500 C CD1 . ILE B 1 202 ? -1.665 26.091 13.599 1.00 13.09 ? 202 ILE B CD1 1 ATOM 3501 N N . GLU B 1 203 ? 1.822 26.982 17.806 1.00 8.36 ? 203 GLU B N 1 ATOM 3502 C CA . GLU B 1 203 ? 3.269 27.263 17.922 1.00 8.59 ? 203 GLU B CA 1 ATOM 3503 C C . GLU B 1 203 ? 4.001 26.082 18.541 1.00 7.54 ? 203 GLU B C 1 ATOM 3504 O O . GLU B 1 203 ? 5.056 25.644 18.054 1.00 8.47 ? 203 GLU B O 1 ATOM 3505 C CB . GLU B 1 203 ? 3.526 28.503 18.785 1.00 12.08 ? 203 GLU B CB 1 ATOM 3506 C CG . GLU B 1 203 ? 4.942 28.930 18.869 1.00 16.75 ? 203 GLU B CG 1 ATOM 3507 C CD . GLU B 1 203 ? 5.391 29.766 20.036 0.50 17.60 ? 203 GLU B CD 1 ATOM 3508 O OE1 . GLU B 1 203 ? 6.156 30.723 19.756 0.50 19.41 ? 203 GLU B OE1 1 ATOM 3509 O OE2 . GLU B 1 203 ? 5.104 29.501 21.212 0.50 26.33 ? 203 GLU B OE2 1 ATOM 3510 N N . ARG B 1 204 ? 3.446 25.554 19.629 1.00 7.92 ? 204 ARG B N 1 ATOM 3511 C CA . ARG B 1 204 ? 4.037 24.389 20.288 1.00 7.56 ? 204 ARG B CA 1 ATOM 3512 C C . ARG B 1 204 ? 4.059 23.194 19.365 1.00 7.81 ? 204 ARG B C 1 ATOM 3513 O O . ARG B 1 204 ? 5.038 22.447 19.312 1.00 8.03 ? 204 ARG B O 1 ATOM 3514 C CB . ARG B 1 204 ? 3.320 24.027 21.564 1.00 9.81 ? 204 ARG B CB 1 ATOM 3515 C CG . ARG B 1 204 ? 3.380 25.027 22.695 1.00 10.12 ? 204 ARG B CG 1 ATOM 3516 C CD . ARG B 1 204 ? 4.737 25.403 23.211 1.00 9.94 ? 204 ARG B CD 1 ATOM 3517 N NE . ARG B 1 204 ? 5.286 24.306 24.027 1.00 9.63 ? 204 ARG B NE 1 ATOM 3518 C CZ . ARG B 1 204 ? 6.514 24.297 24.530 1.00 9.24 ? 204 ARG B CZ 1 ATOM 3519 N NH1 . ARG B 1 204 ? 7.365 25.275 24.259 1.00 9.48 ? 204 ARG B NH1 1 ATOM 3520 N NH2 . ARG B 1 204 ? 6.882 23.273 25.291 1.00 9.56 ? 204 ARG B NH2 1 ATOM 3521 N N . TRP B 1 205 ? 3.015 22.999 18.567 1.00 7.62 ? 205 TRP B N 1 ATOM 3522 C CA . TRP B 1 205 ? 3.013 21.889 17.621 1.00 8.31 ? 205 TRP B CA 1 ATOM 3523 C C . TRP B 1 205 ? 4.149 22.027 16.598 1.00 8.01 ? 205 TRP B C 1 ATOM 3524 O O . TRP B 1 205 ? 4.804 21.050 16.273 1.00 8.72 ? 205 TRP B O 1 ATOM 3525 C CB . TRP B 1 205 ? 1.684 21.790 16.902 1.00 8.42 ? 205 TRP B CB 1 ATOM 3526 C CG . TRP B 1 205 ? 0.557 21.273 17.712 1.00 9.63 ? 205 TRP B CG 1 ATOM 3527 C CD1 . TRP B 1 205 ? 0.546 20.917 19.008 1.00 10.43 ? 205 TRP B CD1 1 ATOM 3528 C CD2 . TRP B 1 205 ? -0.789 21.064 17.229 1.00 9.08 ? 205 TRP B CD2 1 ATOM 3529 N NE1 . TRP B 1 205 ? -0.721 20.489 19.394 1.00 11.21 ? 205 TRP B NE1 1 ATOM 3530 C CE2 . TRP B 1 205 ? -1.534 20.573 18.296 1.00 10.05 ? 205 TRP B CE2 1 ATOM 3531 C CE3 . TRP B 1 205 ? -1.381 21.247 15.980 1.00 8.87 ? 205 TRP B CE3 1 ATOM 3532 C CZ2 . TRP B 1 205 ? -2.900 20.255 18.156 1.00 11.43 ? 205 TRP B CZ2 1 ATOM 3533 C CZ3 . TRP B 1 205 ? -2.724 20.934 15.826 1.00 12.02 ? 205 TRP B CZ3 1 ATOM 3534 C CH2 . TRP B 1 205 ? -3.433 20.454 16.909 1.00 11.83 ? 205 TRP B CH2 1 ATOM 3535 N N . LEU B 1 206 ? 4.380 23.239 16.107 1.00 7.38 ? 206 LEU B N 1 ATOM 3536 C CA . LEU B 1 206 ? 5.456 23.464 15.169 1.00 6.85 ? 206 LEU B CA 1 ATOM 3537 C C . LEU B 1 206 ? 6.817 23.212 15.807 1.00 6.40 ? 206 LEU B C 1 ATOM 3538 O O . LEU B 1 206 ? 7.717 22.653 15.171 1.00 7.21 ? 206 LEU B O 1 ATOM 3539 C CB . LEU B 1 206 ? 5.368 24.887 14.639 1.00 7.30 ? 206 LEU B CB 1 ATOM 3540 C CG . LEU B 1 206 ? 4.235 25.195 13.667 1.00 9.47 ? 206 LEU B CG 1 ATOM 3541 C CD1 . LEU B 1 206 ? 4.264 26.690 13.353 1.00 14.69 ? 206 LEU B CD1 1 ATOM 3542 C CD2 . LEU B 1 206 ? 4.382 24.470 12.354 1.00 10.68 ? 206 LEU B CD2 1 ATOM 3543 N N . ILE B 1 207 ? 7.014 23.708 17.040 1.00 7.58 ? 207 ILE B N 1 ATOM 3544 C CA . ILE B 1 207 ? 8.264 23.420 17.715 1.00 6.90 ? 207 ILE B CA 1 ATOM 3545 C C . ILE B 1 207 ? 8.537 21.916 17.865 1.00 6.93 ? 207 ILE B C 1 ATOM 3546 O O . ILE B 1 207 ? 9.653 21.442 17.661 1.00 8.62 ? 207 ILE B O 1 ATOM 3547 C CB . ILE B 1 207 ? 8.302 24.126 19.092 1.00 7.74 ? 207 ILE B CB 1 ATOM 3548 C CG1 . ILE B 1 207 ? 8.277 25.640 18.928 1.00 8.05 ? 207 ILE B CG1 1 ATOM 3549 C CG2 . ILE B 1 207 ? 9.520 23.664 19.887 1.00 10.11 ? 207 ILE B CG2 1 ATOM 3550 C CD1 . ILE B 1 207 ? 8.017 26.386 20.232 1.00 8.67 ? 207 ILE B CD1 1 ATOM 3551 N N . GLY B 1 208 ? 7.484 21.175 18.189 1.00 7.08 ? 208 GLY B N 1 ATOM 3552 C CA . GLY B 1 208 ? 7.593 19.749 18.406 1.00 7.96 ? 208 GLY B CA 1 ATOM 3553 C C . GLY B 1 208 ? 7.445 18.919 17.165 1.00 7.92 ? 208 GLY B C 1 ATOM 3554 O O . GLY B 1 208 ? 7.385 17.696 17.240 1.00 9.29 ? 208 GLY B O 1 ATOM 3555 N N . ASN B 1 209 ? 7.429 19.521 15.960 1.00 7.73 ? 209 ASN B N 1 ATOM 3556 C CA . ASN B 1 209 ? 7.393 18.799 14.702 1.00 8.69 ? 209 ASN B CA 1 ATOM 3557 C C . ASN B 1 209 ? 8.433 17.693 14.684 1.00 8.05 ? 209 ASN B C 1 ATOM 3558 O O . ASN B 1 209 ? 9.565 17.967 15.097 1.00 9.02 ? 209 ASN B O 1 ATOM 3559 C CB . ASN B 1 209 ? 7.587 19.768 13.534 1.00 11.03 ? 209 ASN B CB 1 ATOM 3560 C CG . ASN B 1 209 ? 7.648 19.038 12.231 1.00 10.60 ? 209 ASN B CG 1 ATOM 3561 O OD1 . ASN B 1 209 ? 6.939 18.082 12.038 1.00 13.00 ? 209 ASN B OD1 1 ATOM 3562 N ND2 . ASN B 1 209 ? 8.560 19.381 11.350 1.00 13.91 ? 209 ASN B ND2 1 ATOM 3563 N N . GLN B 1 210 ? 8.102 16.520 14.230 1.00 7.65 ? 210 GLN B N 1 ATOM 3564 C CA . GLN B 1 210 ? 9.030 15.413 14.226 1.00 8.30 ? 210 GLN B CA 1 ATOM 3565 C C . GLN B 1 210 ? 9.803 15.198 12.940 1.00 8.30 ? 210 GLN B C 1 ATOM 3566 O O . GLN B 1 210 ? 10.643 14.316 12.902 1.00 11.18 ? 210 GLN B O 1 ATOM 3567 C CB . GLN B 1 210 ? 8.310 14.104 14.619 1.00 8.36 ? 210 GLN B CB 1 ATOM 3568 C CG . GLN B 1 210 ? 7.672 14.234 15.967 1.00 9.12 ? 210 GLN B CG 1 ATOM 3569 C CD . GLN B 1 210 ? 7.030 12.947 16.428 1.00 10.36 ? 210 GLN B CD 1 ATOM 3570 O OE1 . GLN B 1 210 ? 7.454 11.890 16.040 1.00 15.25 ? 210 GLN B OE1 1 ATOM 3571 N NE2 . GLN B 1 210 ? 6.073 13.267 17.247 1.00 17.80 ? 210 GLN B NE2 1 ATOM 3572 N N . THR B 1 211 ? 9.470 15.946 11.884 1.00 7.67 ? 211 THR B N 1 ATOM 3573 C CA . THR B 1 211 ? 9.980 15.655 10.567 1.00 8.70 ? 211 THR B CA 1 ATOM 3574 C C . THR B 1 211 ? 11.009 16.631 10.042 1.00 8.59 ? 211 THR B C 1 ATOM 3575 O O . THR B 1 211 ? 11.415 16.471 8.887 1.00 10.65 ? 211 THR B O 1 ATOM 3576 C CB . THR B 1 211 ? 8.800 15.631 9.534 1.00 8.94 ? 211 THR B CB 1 ATOM 3577 O OG1 . THR B 1 211 ? 8.273 16.959 9.436 1.00 10.81 ? 211 THR B OG1 1 ATOM 3578 C CG2 . THR B 1 211 ? 7.682 14.679 9.958 1.00 11.96 ? 211 THR B CG2 1 ATOM 3579 N N . GLY B 1 212 ? 11.372 17.623 10.802 1.00 10.20 ? 212 GLY B N 1 ATOM 3580 C CA . GLY B 1 212 ? 12.230 18.685 10.367 1.00 10.28 ? 212 GLY B CA 1 ATOM 3581 C C . GLY B 1 212 ? 13.647 18.710 10.858 1.00 9.74 ? 212 GLY B C 1 ATOM 3582 O O . GLY B 1 212 ? 14.333 19.704 10.697 1.00 11.84 ? 212 GLY B O 1 ATOM 3583 N N . ASP B 1 213 ? 14.122 17.614 11.461 1.00 10.56 ? 213 ASP B N 1 ATOM 3584 C CA . ASP B 1 213 ? 15.399 17.666 12.103 1.00 12.15 ? 213 ASP B CA 1 ATOM 3585 C C . ASP B 1 213 ? 16.552 17.882 11.114 1.00 13.42 ? 213 ASP B C 1 ATOM 3586 O O . ASP B 1 213 ? 17.588 18.433 11.518 1.00 16.60 ? 213 ASP B O 1 ATOM 3587 C CB . ASP B 1 213 ? 15.634 16.399 12.957 1.00 14.54 ? 213 ASP B CB 1 ATOM 3588 C CG . ASP B 1 213 ? 14.694 16.202 14.142 0.68 15.46 ? 213 ASP B CG 1 ATOM 3589 O OD1 . ASP B 1 213 ? 14.680 15.066 14.677 0.68 20.90 ? 213 ASP B OD1 1 ATOM 3590 O OD2 . ASP B 1 213 ? 13.972 17.131 14.598 0.68 14.44 ? 213 ASP B OD2 1 ATOM 3591 N N . ALA B 1 214 ? 16.375 17.511 9.858 1.00 13.08 ? 214 ALA B N 1 ATOM 3592 C CA . ALA B 1 214 ? 17.452 17.562 8.858 1.00 12.88 ? 214 ALA B CA 1 ATOM 3593 C C . ALA B 1 214 ? 17.307 18.722 7.870 1.00 12.37 ? 214 ALA B C 1 ATOM 3594 O O . ALA B 1 214 ? 18.107 18.840 6.940 1.00 13.97 ? 214 ALA B O 1 ATOM 3595 C CB . ALA B 1 214 ? 17.466 16.227 8.160 1.00 17.41 ? 214 ALA B CB 1 ATOM 3596 N N . THR B 1 215 ? 16.280 19.550 8.035 1.00 11.08 ? 215 THR B N 1 ATOM 3597 C CA . THR B 1 215 ? 16.005 20.624 7.104 1.00 11.79 ? 215 THR B CA 1 ATOM 3598 C C . THR B 1 215 ? 16.347 21.953 7.721 1.00 10.55 ? 215 THR B C 1 ATOM 3599 O O . THR B 1 215 ? 17.497 22.119 8.157 1.00 11.27 ? 215 THR B O 1 ATOM 3600 C CB . THR B 1 215 ? 14.582 20.501 6.519 1.00 13.05 ? 215 THR B CB 1 ATOM 3601 O OG1 . THR B 1 215 ? 13.646 20.331 7.557 1.00 14.69 ? 215 THR B OG1 1 ATOM 3602 C CG2 . THR B 1 215 ? 14.528 19.270 5.610 1.00 16.94 ? 215 THR B CG2 1 ATOM 3603 N N . LEU B 1 216 ? 15.475 22.982 7.677 1.00 11.00 ? 216 LEU B N 1 ATOM 3604 C CA . LEU B 1 216 ? 15.918 24.292 8.135 1.00 11.92 ? 216 LEU B CA 1 ATOM 3605 C C . LEU B 1 216 ? 16.512 24.347 9.523 1.00 12.34 ? 216 LEU B C 1 ATOM 3606 O O . LEU B 1 216 ? 17.528 25.045 9.729 1.00 14.02 ? 216 LEU B O 1 ATOM 3607 C CB . LEU B 1 216 ? 14.794 25.315 8.210 1.00 15.17 ? 216 LEU B CB 1 ATOM 3608 C CG . LEU B 1 216 ? 14.417 25.888 6.867 1.00 15.76 ? 216 LEU B CG 1 ATOM 3609 C CD1 . LEU B 1 216 ? 13.216 26.815 7.098 1.00 12.88 ? 216 LEU B CD1 1 ATOM 3610 C CD2 . LEU B 1 216 ? 15.502 26.588 6.100 1.00 13.09 ? 216 LEU B CD2 1 ATOM 3611 N N . ARG B 1 217 ? 15.899 23.675 10.450 1.00 13.32 ? 217 ARG B N 1 ATOM 3612 C CA . ARG B 1 217 ? 16.419 23.662 11.808 1.00 18.59 ? 217 ARG B CA 1 ATOM 3613 C C . ARG B 1 217 ? 17.871 23.259 11.891 1.00 16.26 ? 217 ARG B C 1 ATOM 3614 O O . ARG B 1 217 ? 18.565 23.718 12.784 1.00 18.98 ? 217 ARG B O 1 ATOM 3615 C CB . ARG B 1 217 ? 15.722 22.594 12.650 1.00 26.93 ? 217 ARG B CB 1 ATOM 3616 C CG A ARG B 1 217 ? 14.258 22.951 12.753 0.63 26.81 ? 217 ARG B CG 1 ATOM 3617 C CG B ARG B 1 217 ? 14.378 22.862 13.232 0.37 22.70 ? 217 ARG B CG 1 ATOM 3618 C CD A ARG B 1 217 ? 13.672 21.728 13.465 0.63 20.38 ? 217 ARG B CD 1 ATOM 3619 C CD B ARG B 1 217 ? 13.806 21.518 13.693 0.37 17.30 ? 217 ARG B CD 1 ATOM 3620 N NE A ARG B 1 217 ? 13.534 21.995 14.910 0.63 16.93 ? 217 ARG B NE 1 ATOM 3621 N NE B ARG B 1 217 ? 12.381 21.634 13.950 0.37 17.79 ? 217 ARG B NE 1 ATOM 3622 C CZ A ARG B 1 217 ? 12.376 21.973 15.566 0.63 15.88 ? 217 ARG B CZ 1 ATOM 3623 C CZ B ARG B 1 217 ? 11.799 22.070 15.059 0.37 18.52 ? 217 ARG B CZ 1 ATOM 3624 N NH1 A ARG B 1 217 ? 11.175 21.738 15.044 0.63 19.15 ? 217 ARG B NH1 1 ATOM 3625 N NH1 B ARG B 1 217 ? 12.565 22.462 16.072 0.37 24.01 ? 217 ARG B NH1 1 ATOM 3626 N NH2 A ARG B 1 217 ? 12.395 22.218 16.874 0.63 14.77 ? 217 ARG B NH2 1 ATOM 3627 N NH2 B ARG B 1 217 ? 10.481 22.137 15.193 0.37 26.08 ? 217 ARG B NH2 1 ATOM 3628 N N . ALA B 1 218 ? 18.280 22.381 11.024 1.00 14.99 ? 218 ALA B N 1 ATOM 3629 C CA . ALA B 1 218 ? 19.670 21.936 10.985 1.00 16.86 ? 218 ALA B CA 1 ATOM 3630 C C . ALA B 1 218 ? 20.620 23.113 10.693 1.00 14.67 ? 218 ALA B C 1 ATOM 3631 O O . ALA B 1 218 ? 21.769 23.037 11.069 1.00 16.48 ? 218 ALA B O 1 ATOM 3632 C CB . ALA B 1 218 ? 19.870 20.754 10.059 1.00 17.91 ? 218 ALA B CB 1 ATOM 3633 N N . GLY B 1 219 ? 20.140 24.113 9.970 1.00 14.29 ? 219 GLY B N 1 ATOM 3634 C CA . GLY B 1 219 ? 20.926 25.243 9.515 1.00 13.37 ? 219 GLY B CA 1 ATOM 3635 C C . GLY B 1 219 ? 20.792 26.473 10.376 1.00 13.48 ? 219 GLY B C 1 ATOM 3636 O O . GLY B 1 219 ? 21.434 27.492 10.126 1.00 15.11 ? 219 GLY B O 1 ATOM 3637 N N . PHE B 1 220 ? 19.955 26.388 11.407 1.00 13.96 ? 220 PHE B N 1 ATOM 3638 C CA . PHE B 1 220 ? 19.735 27.509 12.307 1.00 13.60 ? 220 PHE B CA 1 ATOM 3639 C C . PHE B 1 220 ? 20.403 27.314 13.666 1.00 13.89 ? 220 PHE B C 1 ATOM 3640 O O . PHE B 1 220 ? 20.573 26.201 14.160 1.00 16.07 ? 220 PHE B O 1 ATOM 3641 C CB . PHE B 1 220 ? 18.259 27.693 12.577 1.00 12.03 ? 220 PHE B CB 1 ATOM 3642 C CG . PHE B 1 220 ? 17.363 28.190 11.459 1.00 9.99 ? 220 PHE B CG 1 ATOM 3643 C CD1 . PHE B 1 220 ? 15.986 28.074 11.603 1.00 10.94 ? 220 PHE B CD1 1 ATOM 3644 C CD2 . PHE B 1 220 ? 17.846 28.785 10.323 1.00 11.73 ? 220 PHE B CD2 1 ATOM 3645 C CE1 . PHE B 1 220 ? 15.132 28.574 10.639 1.00 10.80 ? 220 PHE B CE1 1 ATOM 3646 C CE2 . PHE B 1 220 ? 16.971 29.279 9.362 1.00 11.40 ? 220 PHE B CE2 1 ATOM 3647 C CZ . PHE B 1 220 ? 15.603 29.185 9.511 1.00 11.12 ? 220 PHE B CZ 1 ATOM 3648 N N . PRO B 1 221 ? 20.781 28.398 14.322 1.00 13.34 ? 221 PRO B N 1 ATOM 3649 C CA . PRO B 1 221 ? 21.329 28.304 15.683 1.00 14.30 ? 221 PRO B CA 1 ATOM 3650 C C . PRO B 1 221 ? 20.394 27.533 16.596 1.00 15.13 ? 221 PRO B C 1 ATOM 3651 O O . PRO B 1 221 ? 19.183 27.672 16.593 1.00 17.02 ? 221 PRO B O 1 ATOM 3652 C CB . PRO B 1 221 ? 21.489 29.752 16.117 1.00 15.00 ? 221 PRO B CB 1 ATOM 3653 C CG . PRO B 1 221 ? 21.778 30.428 14.822 1.00 13.04 ? 221 PRO B CG 1 ATOM 3654 C CD . PRO B 1 221 ? 20.773 29.807 13.858 1.00 12.72 ? 221 PRO B CD 1 ATOM 3655 N N . LYS B 1 222 ? 21.019 26.664 17.421 1.00 17.51 ? 222 LYS B N 1 ATOM 3656 C CA . LYS B 1 222 ? 20.255 25.784 18.261 1.00 20.02 ? 222 LYS B CA 1 ATOM 3657 C C . LYS B 1 222 ? 19.601 26.478 19.433 1.00 18.41 ? 222 LYS B C 1 ATOM 3658 O O . LYS B 1 222 ? 18.681 25.901 20.005 1.00 20.98 ? 222 LYS B O 1 ATOM 3659 C CB . LYS B 1 222 ? 21.192 24.713 18.843 1.00 26.51 ? 222 LYS B CB 1 ATOM 3660 C CG . LYS B 1 222 ? 20.735 23.335 18.394 1.00 34.97 ? 222 LYS B CG 1 ATOM 3661 C CD . LYS B 1 222 ? 21.079 23.156 16.913 1.00 29.92 ? 222 LYS B CD 1 ATOM 3662 C CE . LYS B 1 222 ? 19.855 22.737 16.096 1.00 40.94 ? 222 LYS B CE 1 ATOM 3663 N NZ . LYS B 1 222 ? 20.160 21.608 15.158 1.00 58.38 ? 222 LYS B NZ 1 ATOM 3664 N N . ASP B 1 223 ? 20.019 27.686 19.750 1.00 20.21 ? 223 ASP B N 1 ATOM 3665 C CA . ASP B 1 223 ? 19.395 28.506 20.786 1.00 22.18 ? 223 ASP B CA 1 ATOM 3666 C C . ASP B 1 223 ? 18.184 29.278 20.294 1.00 16.54 ? 223 ASP B C 1 ATOM 3667 O O . ASP B 1 223 ? 17.427 29.796 21.118 1.00 19.74 ? 223 ASP B O 1 ATOM 3668 C CB . ASP B 1 223 ? 20.533 29.433 21.286 1.00 29.15 ? 223 ASP B CB 1 ATOM 3669 C CG . ASP B 1 223 ? 21.365 29.863 20.068 0.68 29.25 ? 223 ASP B CG 1 ATOM 3670 O OD1 . ASP B 1 223 ? 22.383 29.285 19.576 0.68 22.52 ? 223 ASP B OD1 1 ATOM 3671 O OD2 . ASP B 1 223 ? 20.935 30.927 19.523 0.68 45.55 ? 223 ASP B OD2 1 ATOM 3672 N N . TRP B 1 224 ? 18.015 29.373 18.979 1.00 15.45 ? 224 TRP B N 1 ATOM 3673 C CA . TRP B 1 224 ? 16.793 30.010 18.467 1.00 12.37 ? 224 TRP B CA 1 ATOM 3674 C C . TRP B 1 224 ? 15.582 29.170 18.830 1.00 10.62 ? 224 TRP B C 1 ATOM 3675 O O . TRP B 1 224 ? 15.665 27.933 18.751 1.00 11.52 ? 224 TRP B O 1 ATOM 3676 C CB . TRP B 1 224 ? 16.851 30.207 16.950 1.00 11.54 ? 224 TRP B CB 1 ATOM 3677 C CG . TRP B 1 224 ? 17.808 31.238 16.429 1.00 13.62 ? 224 TRP B CG 1 ATOM 3678 C CD1 . TRP B 1 224 ? 18.674 32.003 17.133 1.00 13.66 ? 224 TRP B CD1 1 ATOM 3679 C CD2 . TRP B 1 224 ? 17.941 31.600 15.068 1.00 12.28 ? 224 TRP B CD2 1 ATOM 3680 N NE1 . TRP B 1 224 ? 19.382 32.835 16.271 1.00 15.20 ? 224 TRP B NE1 1 ATOM 3681 C CE2 . TRP B 1 224 ? 18.930 32.593 14.983 1.00 15.55 ? 224 TRP B CE2 1 ATOM 3682 C CE3 . TRP B 1 224 ? 17.314 31.161 13.896 1.00 12.54 ? 224 TRP B CE3 1 ATOM 3683 C CZ2 . TRP B 1 224 ? 19.274 33.131 13.746 1.00 14.27 ? 224 TRP B CZ2 1 ATOM 3684 C CZ3 . TRP B 1 224 ? 17.662 31.699 12.685 1.00 15.00 ? 224 TRP B CZ3 1 ATOM 3685 C CH2 . TRP B 1 224 ? 18.646 32.687 12.631 1.00 15.88 ? 224 TRP B CH2 1 ATOM 3686 N N . VAL B 1 225 ? 14.468 29.787 19.141 1.00 10.97 ? 225 VAL B N 1 ATOM 3687 C CA . VAL B 1 225 ? 13.232 29.059 19.179 1.00 9.17 ? 225 VAL B CA 1 ATOM 3688 C C . VAL B 1 225 ? 12.675 28.957 17.768 1.00 8.38 ? 225 VAL B C 1 ATOM 3689 O O . VAL B 1 225 ? 12.513 29.970 17.112 1.00 12.44 ? 225 VAL B O 1 ATOM 3690 C CB . VAL B 1 225 ? 12.198 29.681 20.123 1.00 9.31 ? 225 VAL B CB 1 ATOM 3691 C CG1 . VAL B 1 225 ? 10.940 28.877 20.128 1.00 10.31 ? 225 VAL B CG1 1 ATOM 3692 C CG2 . VAL B 1 225 ? 12.801 29.785 21.538 1.00 12.35 ? 225 VAL B CG2 1 ATOM 3693 N N . VAL B 1 226 ? 12.492 27.740 17.278 1.00 7.74 ? 226 VAL B N 1 ATOM 3694 C CA . VAL B 1 226 ? 12.143 27.451 15.907 1.00 8.16 ? 226 VAL B CA 1 ATOM 3695 C C . VAL B 1 226 ? 11.019 26.458 15.875 1.00 7.25 ? 226 VAL B C 1 ATOM 3696 O O . VAL B 1 226 ? 11.024 25.451 16.608 1.00 8.48 ? 226 VAL B O 1 ATOM 3697 C CB . VAL B 1 226 ? 13.369 26.871 15.112 1.00 11.91 ? 226 VAL B CB 1 ATOM 3698 C CG1 . VAL B 1 226 ? 12.996 26.566 13.651 1.00 11.89 ? 226 VAL B CG1 1 ATOM 3699 C CG2 . VAL B 1 226 ? 14.584 27.768 15.224 1.00 13.13 ? 226 VAL B CG2 1 ATOM 3700 N N . GLY B 1 227 ? 10.094 26.662 14.999 1.00 7.62 ? 227 GLY B N 1 ATOM 3701 C CA . GLY B 1 227 ? 9.064 25.671 14.685 1.00 8.19 ? 227 GLY B CA 1 ATOM 3702 C C . GLY B 1 227 ? 8.835 25.703 13.179 1.00 7.31 ? 227 GLY B C 1 ATOM 3703 O O . GLY B 1 227 ? 8.880 26.750 12.566 1.00 9.47 ? 227 GLY B O 1 ATOM 3704 N N . GLU B 1 228 ? 8.505 24.538 12.621 1.00 7.82 ? 228 GLU B N 1 ATOM 3705 C CA . GLU B 1 228 ? 8.331 24.514 11.180 1.00 7.33 ? 228 GLU B CA 1 ATOM 3706 C C . GLU B 1 228 ? 7.509 23.286 10.774 1.00 7.32 ? 228 GLU B C 1 ATOM 3707 O O . GLU B 1 228 ? 7.363 22.348 11.548 1.00 8.54 ? 228 GLU B O 1 ATOM 3708 C CB . GLU B 1 228 ? 9.663 24.656 10.482 1.00 8.71 ? 228 GLU B CB 1 ATOM 3709 C CG . GLU B 1 228 ? 10.791 23.795 10.974 1.00 9.41 ? 228 GLU B CG 1 ATOM 3710 C CD . GLU B 1 228 ? 10.551 22.308 10.898 0.66 7.54 ? 228 GLU B CD 1 ATOM 3711 O OE1 . GLU B 1 228 ? 10.225 21.809 9.802 0.66 7.08 ? 228 GLU B OE1 1 ATOM 3712 O OE2 . GLU B 1 228 ? 10.554 21.619 11.933 0.66 8.12 ? 228 GLU B OE2 1 ATOM 3713 N N . LYS B 1 229 ? 7.126 23.342 9.537 1.00 6.89 ? 229 LYS B N 1 ATOM 3714 C CA . LYS B 1 229 ? 6.398 22.294 8.803 1.00 6.83 ? 229 LYS B CA 1 ATOM 3715 C C . LYS B 1 229 ? 7.128 22.037 7.484 1.00 7.19 ? 229 LYS B C 1 ATOM 3716 O O . LYS B 1 229 ? 7.238 22.945 6.663 1.00 7.48 ? 229 LYS B O 1 ATOM 3717 C CB . LYS B 1 229 ? 4.946 22.656 8.532 1.00 7.47 ? 229 LYS B CB 1 ATOM 3718 C CG . LYS B 1 229 ? 4.205 21.576 7.798 1.00 7.78 ? 229 LYS B CG 1 ATOM 3719 C CD . LYS B 1 229 ? 3.871 20.359 8.610 1.00 8.39 ? 229 LYS B CD 1 ATOM 3720 C CE . LYS B 1 229 ? 3.501 19.133 7.793 1.00 9.11 ? 229 LYS B CE 1 ATOM 3721 N NZ . LYS B 1 229 ? 4.707 18.423 7.281 1.00 9.17 ? 229 LYS B NZ 1 ATOM 3722 N N . THR B 1 230 ? 7.550 20.798 7.286 1.00 7.25 ? 230 THR B N 1 ATOM 3723 C CA . THR B 1 230 ? 8.209 20.395 6.055 1.00 8.34 ? 230 THR B CA 1 ATOM 3724 C C . THR B 1 230 ? 7.266 19.973 4.956 1.00 8.24 ? 230 THR B C 1 ATOM 3725 O O . THR B 1 230 ? 6.081 19.724 5.198 1.00 9.39 ? 230 THR B O 1 ATOM 3726 C CB . THR B 1 230 ? 9.136 19.171 6.377 1.00 9.19 ? 230 THR B CB 1 ATOM 3727 O OG1 . THR B 1 230 ? 8.319 18.211 7.060 1.00 12.74 ? 230 THR B OG1 1 ATOM 3728 C CG2 . THR B 1 230 ? 10.304 19.584 7.232 1.00 13.57 ? 230 THR B CG2 1 ATOM 3729 N N . GLY B 1 231 ? 7.802 19.888 3.740 1.00 9.31 ? 231 GLY B N 1 ATOM 3730 C CA . GLY B 1 231 ? 7.104 19.215 2.655 1.00 10.33 ? 231 GLY B CA 1 ATOM 3731 C C . GLY B 1 231 ? 8.108 18.555 1.734 1.00 10.09 ? 231 GLY B C 1 ATOM 3732 O O . GLY B 1 231 ? 9.218 19.006 1.573 1.00 11.34 ? 231 GLY B O 1 ATOM 3733 N N . THR B 1 232 ? 7.658 17.475 1.096 1.00 12.09 ? 232 THR B N 1 ATOM 3734 C CA . THR B 1 232 ? 8.380 16.758 0.079 1.00 13.20 ? 232 THR B CA 1 ATOM 3735 C C . THR B 1 232 ? 7.370 16.347 -0.970 1.00 15.17 ? 232 THR B C 1 ATOM 3736 O O . THR B 1 232 ? 6.432 15.655 -0.585 1.00 25.35 ? 232 THR B O 1 ATOM 3737 C CB . THR B 1 232 ? 8.928 15.423 0.607 1.00 16.39 ? 232 THR B CB 1 ATOM 3738 O OG1 . THR B 1 232 ? 9.702 15.711 1.766 1.00 17.54 ? 232 THR B OG1 1 ATOM 3739 C CG2 . THR B 1 232 ? 9.789 14.727 -0.441 1.00 22.05 ? 232 THR B CG2 1 ATOM 3740 N N . CYS B 1 233 ? 7.624 16.722 -2.197 1.00 14.46 ? 233 CYS B N 1 ATOM 3741 C CA . CYS B 1 233 ? 6.765 16.265 -3.274 1.00 15.77 ? 233 CYS B CA 1 ATOM 3742 C C . CYS B 1 233 ? 7.557 15.776 -4.466 1.00 15.23 ? 233 CYS B C 1 ATOM 3743 O O . CYS B 1 233 ? 8.768 15.858 -4.522 1.00 15.23 ? 233 CYS B O 1 ATOM 3744 C CB . CYS B 1 233 ? 5.791 17.381 -3.601 1.00 18.04 ? 233 CYS B CB 1 ATOM 3745 S SG . CYS B 1 233 ? 6.538 18.876 -4.159 0.49 16.46 ? 233 CYS B SG 1 ATOM 3746 N N . ALA B 1 234 ? 6.809 15.240 -5.430 1.00 14.37 ? 234 ALA B N 1 ATOM 3747 C CA . ALA B 1 234 ? 7.399 14.677 -6.625 1.00 14.89 ? 234 ALA B CA 1 ATOM 3748 C C . ALA B 1 234 ? 8.136 15.784 -7.367 1.00 13.52 ? 234 ALA B C 1 ATOM 3749 O O . ALA B 1 234 ? 7.973 16.990 -7.166 1.00 15.33 ? 234 ALA B O 1 ATOM 3750 C CB . ALA B 1 234 ? 6.286 14.050 -7.468 1.00 15.34 ? 234 ALA B CB 1 ATOM 3751 N N . ASN B 1 235 ? 8.927 15.319 -8.294 1.00 15.91 ? 235 ASN B N 1 ATOM 3752 C CA . ASN B 1 235 ? 9.715 16.171 -9.196 1.00 16.03 ? 235 ASN B CA 1 ATOM 3753 C C . ASN B 1 235 ? 10.647 17.106 -8.442 1.00 15.80 ? 235 ASN B C 1 ATOM 3754 O O . ASN B 1 235 ? 11.022 18.192 -8.900 1.00 17.59 ? 235 ASN B O 1 ATOM 3755 C CB . ASN B 1 235 ? 8.766 16.942 -10.130 1.00 17.77 ? 235 ASN B CB 1 ATOM 3756 C CG . ASN B 1 235 ? 8.005 15.994 -11.050 1.00 18.43 ? 235 ASN B CG 1 ATOM 3757 O OD1 . ASN B 1 235 ? 8.596 15.029 -11.550 1.00 24.41 ? 235 ASN B OD1 1 ATOM 3758 N ND2 . ASN B 1 235 ? 6.728 16.203 -11.295 1.00 20.77 ? 235 ASN B ND2 1 ATOM 3759 N N . GLY B 1 236 ? 11.094 16.641 -7.273 1.00 13.32 ? 236 GLY B N 1 ATOM 3760 C CA . GLY B 1 236 ? 12.161 17.243 -6.549 1.00 14.47 ? 236 GLY B CA 1 ATOM 3761 C C . GLY B 1 236 ? 11.803 18.370 -5.625 1.00 12.12 ? 236 GLY B C 1 ATOM 3762 O O . GLY B 1 236 ? 12.668 19.159 -5.247 1.00 14.82 ? 236 GLY B O 1 ATOM 3763 N N . GLY B 1 237 ? 10.558 18.469 -5.191 1.00 12.26 ? 237 GLY B N 1 ATOM 3764 C CA . GLY B 1 237 ? 10.169 19.485 -4.234 1.00 12.34 ? 237 GLY B CA 1 ATOM 3765 C C . GLY B 1 237 ? 10.622 19.192 -2.818 1.00 12.13 ? 237 GLY B C 1 ATOM 3766 O O . GLY B 1 237 ? 10.379 18.075 -2.325 1.00 13.80 ? 237 GLY B O 1 ATOM 3767 N N . ARG B 1 238 ? 11.160 20.158 -2.122 1.00 10.25 ? 238 ARG B N 1 ATOM 3768 C CA . ARG B 1 238 ? 11.563 19.998 -0.736 1.00 9.31 ? 238 ARG B CA 1 ATOM 3769 C C . ARG B 1 238 ? 11.432 21.368 -0.061 1.00 8.90 ? 238 ARG B C 1 ATOM 3770 O O . ARG B 1 238 ? 12.120 22.309 -0.441 1.00 11.12 ? 238 ARG B O 1 ATOM 3771 C CB . ARG B 1 238 ? 12.973 19.417 -0.615 1.00 10.99 ? 238 ARG B CB 1 ATOM 3772 C CG . ARG B 1 238 ? 13.306 19.009 0.826 1.00 11.14 ? 238 ARG B CG 1 ATOM 3773 C CD . ARG B 1 238 ? 12.528 17.767 1.192 1.00 15.88 ? 238 ARG B CD 1 ATOM 3774 N NE . ARG B 1 238 ? 12.983 17.093 2.391 1.00 15.44 ? 238 ARG B NE 1 ATOM 3775 C CZ . ARG B 1 238 ? 12.288 16.936 3.513 1.00 14.61 ? 238 ARG B CZ 1 ATOM 3776 N NH1 . ARG B 1 238 ? 11.047 17.396 3.735 1.00 18.71 ? 238 ARG B NH1 1 ATOM 3777 N NH2 . ARG B 1 238 ? 12.797 16.265 4.558 1.00 15.92 ? 238 ARG B NH2 1 ATOM 3778 N N . ASN B 1 239 ? 10.537 21.435 0.920 1.00 8.38 ? 239 ASN B N 1 ATOM 3779 C CA . ASN B 1 239 ? 10.099 22.711 1.452 1.00 8.34 ? 239 ASN B CA 1 ATOM 3780 C C . ASN B 1 239 ? 10.118 22.735 2.992 1.00 7.87 ? 239 ASN B C 1 ATOM 3781 O O . ASN B 1 239 ? 10.055 21.676 3.611 1.00 8.79 ? 239 ASN B O 1 ATOM 3782 C CB . ASN B 1 239 ? 8.696 23.037 0.991 1.00 10.20 ? 239 ASN B CB 1 ATOM 3783 C CG . ASN B 1 239 ? 8.431 22.767 -0.479 1.00 12.45 ? 239 ASN B CG 1 ATOM 3784 O OD1 . ASN B 1 239 ? 9.259 23.129 -1.318 1.00 10.79 ? 239 ASN B OD1 1 ATOM 3785 N ND2 . ASN B 1 239 ? 7.261 22.246 -0.769 1.00 17.51 ? 239 ASN B ND2 1 ATOM 3786 N N . ASP B 1 240 ? 10.124 23.933 3.573 1.00 7.61 ? 240 ASP B N 1 ATOM 3787 C CA . ASP B 1 240 ? 10.041 24.071 5.043 1.00 7.34 ? 240 ASP B CA 1 ATOM 3788 C C . ASP B 1 240 ? 9.553 25.487 5.321 1.00 7.59 ? 240 ASP B C 1 ATOM 3789 O O . ASP B 1 240 ? 10.163 26.439 4.830 1.00 8.57 ? 240 ASP B O 1 ATOM 3790 C CB . ASP B 1 240 ? 11.390 23.741 5.616 1.00 8.50 ? 240 ASP B CB 1 ATOM 3791 C CG . ASP B 1 240 ? 11.445 23.194 7.035 0.63 6.19 ? 240 ASP B CG 1 ATOM 3792 O OD1 . ASP B 1 240 ? 10.330 23.122 7.655 0.63 6.87 ? 240 ASP B OD1 1 ATOM 3793 O OD2 . ASP B 1 240 ? 12.507 22.844 7.539 0.63 7.55 ? 240 ASP B OD2 1 ATOM 3794 N N . ILE B 1 241 ? 8.503 25.587 6.098 1.00 6.89 ? 241 ILE B N 1 ATOM 3795 C CA . ILE B 1 241 ? 7.970 26.902 6.471 1.00 6.68 ? 241 ILE B CA 1 ATOM 3796 C C . ILE B 1 241 ? 7.767 26.971 7.966 1.00 7.32 ? 241 ILE B C 1 ATOM 3797 O O . ILE B 1 241 ? 7.542 25.954 8.609 1.00 8.00 ? 241 ILE B O 1 ATOM 3798 C CB . ILE B 1 241 ? 6.621 27.205 5.744 1.00 7.63 ? 241 ILE B CB 1 ATOM 3799 C CG1 . ILE B 1 241 ? 5.448 26.383 6.242 1.00 8.51 ? 241 ILE B CG1 1 ATOM 3800 C CG2 . ILE B 1 241 ? 6.813 27.050 4.255 1.00 7.84 ? 241 ILE B CG2 1 ATOM 3801 C CD1 . ILE B 1 241 ? 4.094 26.808 5.732 1.00 9.61 ? 241 ILE B CD1 1 ATOM 3802 N N . GLY B 1 242 ? 7.867 28.166 8.546 1.00 7.54 ? 242 GLY B N 1 ATOM 3803 C CA . GLY B 1 242 ? 7.641 28.250 10.006 1.00 7.22 ? 242 GLY B CA 1 ATOM 3804 C C . GLY B 1 242 ? 8.153 29.562 10.524 1.00 7.13 ? 242 GLY B C 1 ATOM 3805 O O . GLY B 1 242 ? 7.983 30.607 9.880 1.00 7.75 ? 242 GLY B O 1 ATOM 3806 N N . PHE B 1 243 ? 8.642 29.513 11.762 1.00 8.36 ? 243 PHE B N 1 ATOM 3807 C CA . PHE B 1 243 ? 9.032 30.703 12.447 1.00 7.72 ? 243 PHE B CA 1 ATOM 3808 C C . PHE B 1 243 ? 10.363 30.477 13.159 1.00 7.10 ? 243 PHE B C 1 ATOM 3809 O O . PHE B 1 243 ? 10.703 29.365 13.473 1.00 8.72 ? 243 PHE B O 1 ATOM 3810 C CB . PHE B 1 243 ? 7.961 31.166 13.439 1.00 8.26 ? 243 PHE B CB 1 ATOM 3811 C CG . PHE B 1 243 ? 7.932 30.352 14.720 1.00 8.69 ? 243 PHE B CG 1 ATOM 3812 C CD1 . PHE B 1 243 ? 7.204 29.196 14.788 1.00 9.18 ? 243 PHE B CD1 1 ATOM 3813 C CD2 . PHE B 1 243 ? 8.628 30.789 15.851 1.00 9.46 ? 243 PHE B CD2 1 ATOM 3814 C CE1 . PHE B 1 243 ? 7.246 28.448 15.986 1.00 11.66 ? 243 PHE B CE1 1 ATOM 3815 C CE2 . PHE B 1 243 ? 8.721 30.026 16.983 1.00 13.89 ? 243 PHE B CE2 1 ATOM 3816 C CZ . PHE B 1 243 ? 7.983 28.874 17.046 1.00 12.48 ? 243 PHE B CZ 1 ATOM 3817 N N . PHE B 1 244 ? 11.017 31.584 13.470 1.00 7.57 ? 244 PHE B N 1 ATOM 3818 C CA . PHE B 1 244 ? 12.132 31.530 14.397 1.00 8.51 ? 244 PHE B CA 1 ATOM 3819 C C . PHE B 1 244 ? 12.189 32.823 15.211 1.00 8.59 ? 244 PHE B C 1 ATOM 3820 O O . PHE B 1 244 ? 11.801 33.905 14.741 1.00 9.08 ? 244 PHE B O 1 ATOM 3821 C CB . PHE B 1 244 ? 13.434 31.266 13.708 1.00 9.02 ? 244 PHE B CB 1 ATOM 3822 C CG . PHE B 1 244 ? 13.854 32.214 12.610 1.00 10.11 ? 244 PHE B CG 1 ATOM 3823 C CD1 . PHE B 1 244 ? 13.507 31.919 11.296 1.00 10.80 ? 244 PHE B CD1 1 ATOM 3824 C CD2 . PHE B 1 244 ? 14.622 33.349 12.869 1.00 10.88 ? 244 PHE B CD2 1 ATOM 3825 C CE1 . PHE B 1 244 ? 13.942 32.750 10.281 1.00 11.22 ? 244 PHE B CE1 1 ATOM 3826 C CE2 . PHE B 1 244 ? 15.006 34.178 11.829 1.00 11.41 ? 244 PHE B CE2 1 ATOM 3827 C CZ . PHE B 1 244 ? 14.666 33.881 10.551 1.00 10.49 ? 244 PHE B CZ 1 ATOM 3828 N N . LYS B 1 245 ? 12.667 32.673 16.430 1.00 10.93 ? 245 LYS B N 1 ATOM 3829 C CA . LYS B 1 245 ? 12.922 33.807 17.322 1.00 11.19 ? 245 LYS B CA 1 ATOM 3830 C C . LYS B 1 245 ? 14.417 33.920 17.536 1.00 12.45 ? 245 LYS B C 1 ATOM 3831 O O . LYS B 1 245 ? 14.992 32.955 18.077 1.00 14.84 ? 245 LYS B O 1 ATOM 3832 C CB . LYS B 1 245 ? 12.162 33.571 18.612 1.00 14.78 ? 245 LYS B CB 1 ATOM 3833 C CG . LYS B 1 245 ? 10.664 33.422 18.358 1.00 19.02 ? 245 LYS B CG 1 ATOM 3834 C CD . LYS B 1 245 ? 9.853 33.185 19.649 1.00 24.29 ? 245 LYS B CD 1 ATOM 3835 C CE . LYS B 1 245 ? 8.391 32.942 19.288 1.00 31.09 ? 245 LYS B CE 1 ATOM 3836 N NZ . LYS B 1 245 ? 7.577 32.637 20.502 1.00 38.48 ? 245 LYS B NZ 1 ATOM 3837 N N . ALA B 1 246 ? 14.990 35.053 17.216 1.00 13.19 ? 246 ALA B N 1 ATOM 3838 C CA . ALA B 1 246 ? 16.409 35.279 17.273 1.00 17.08 ? 246 ALA B CA 1 ATOM 3839 C C . ALA B 1 246 ? 16.765 36.709 17.684 1.00 20.79 ? 246 ALA B C 1 ATOM 3840 O O . ALA B 1 246 ? 16.093 37.601 17.122 1.00 18.98 ? 246 ALA B O 1 ATOM 3841 C CB . ALA B 1 246 ? 17.032 35.107 15.888 1.00 19.44 ? 246 ALA B CB 1 ATOM 3842 N N . GLN B 1 247 ? 17.793 36.916 18.508 1.00 21.64 ? 247 GLN B N 1 ATOM 3843 C CA . GLN B 1 247 ? 18.181 38.266 18.875 1.00 26.47 ? 247 GLN B CA 1 ATOM 3844 C C . GLN B 1 247 ? 16.963 39.078 19.322 1.00 22.88 ? 247 GLN B C 1 ATOM 3845 O O . GLN B 1 247 ? 16.870 40.249 18.945 1.00 26.03 ? 247 GLN B O 1 ATOM 3846 C CB . GLN B 1 247 ? 18.844 39.013 17.718 1.00 29.99 ? 247 GLN B CB 1 ATOM 3847 C CG . GLN B 1 247 ? 20.163 38.455 17.231 1.00 35.76 ? 247 GLN B CG 1 ATOM 3848 C CD . GLN B 1 247 ? 20.743 39.176 16.023 0.54 36.83 ? 247 GLN B CD 1 ATOM 3849 O OE1 . GLN B 1 247 ? 20.095 39.383 14.988 0.54 34.43 ? 247 GLN B OE1 1 ATOM 3850 N NE2 . GLN B 1 247 ? 22.011 39.556 16.145 0.54 32.19 ? 247 GLN B NE2 1 ATOM 3851 N N . GLU B 1 248 ? 16.116 38.467 20.102 1.00 20.04 ? 248 GLU B N 1 ATOM 3852 C CA . GLU B 1 248 ? 14.940 39.000 20.786 1.00 21.85 ? 248 GLU B CA 1 ATOM 3853 C C . GLU B 1 248 ? 13.978 39.527 19.727 1.00 21.23 ? 248 GLU B C 1 ATOM 3854 O O . GLU B 1 248 ? 13.202 40.450 19.982 1.00 24.67 ? 248 GLU B O 1 ATOM 3855 C CB . GLU B 1 248 ? 15.421 40.085 21.744 1.00 27.78 ? 248 GLU B CB 1 ATOM 3856 C CG . GLU B 1 248 ? 16.402 39.576 22.802 1.00 35.16 ? 248 GLU B CG 1 ATOM 3857 C CD . GLU B 1 248 ? 17.866 39.686 22.435 1.00 39.44 ? 248 GLU B CD 1 ATOM 3858 O OE1 . GLU B 1 248 ? 18.287 40.736 21.889 1.00 53.39 ? 248 GLU B OE1 1 ATOM 3859 O OE2 . GLU B 1 248 ? 18.639 38.732 22.684 1.00 53.04 ? 248 GLU B OE2 1 ATOM 3860 N N . ARG B 1 249 ? 13.979 38.983 18.519 1.00 15.31 ? 249 ARG B N 1 ATOM 3861 C CA . ARG B 1 249 ? 13.094 39.349 17.427 1.00 15.77 ? 249 ARG B CA 1 ATOM 3862 C C . ARG B 1 249 ? 12.429 38.118 16.829 1.00 14.36 ? 249 ARG B C 1 ATOM 3863 O O . ARG B 1 249 ? 13.051 37.066 16.799 1.00 15.23 ? 249 ARG B O 1 ATOM 3864 C CB . ARG B 1 249 ? 13.810 40.063 16.305 1.00 17.58 ? 249 ARG B CB 1 ATOM 3865 C CG . ARG B 1 249 ? 14.157 41.512 16.706 1.00 22.48 ? 249 ARG B CG 1 ATOM 3866 C CD . ARG B 1 249 ? 14.539 42.301 15.485 1.00 27.99 ? 249 ARG B CD 1 ATOM 3867 N NE . ARG B 1 249 ? 13.981 42.279 14.185 1.00 37.67 ? 249 ARG B NE 1 ATOM 3868 C CZ . ARG B 1 249 ? 13.201 43.030 13.439 1.00 46.04 ? 249 ARG B CZ 1 ATOM 3869 N NH1 . ARG B 1 249 ? 12.678 44.164 13.895 1.00 55.53 ? 249 ARG B NH1 1 ATOM 3870 N NH2 . ARG B 1 249 ? 12.884 42.684 12.183 1.00 42.28 ? 249 ARG B NH2 1 ATOM 3871 N N . ASP B 1 250 ? 11.189 38.235 16.393 1.00 13.24 ? 250 ASP B N 1 ATOM 3872 C CA . ASP B 1 250 ? 10.453 37.159 15.785 1.00 11.65 ? 250 ASP B CA 1 ATOM 3873 C C . ASP B 1 250 ? 10.344 37.301 14.275 1.00 10.49 ? 250 ASP B C 1 ATOM 3874 O O . ASP B 1 250 ? 10.177 38.406 13.781 1.00 12.10 ? 250 ASP B O 1 ATOM 3875 C CB . ASP B 1 250 ? 9.011 37.170 16.324 1.00 15.23 ? 250 ASP B CB 1 ATOM 3876 C CG . ASP B 1 250 ? 8.827 37.020 17.789 1.00 20.84 ? 250 ASP B CG 1 ATOM 3877 O OD1 . ASP B 1 250 ? 9.815 36.673 18.480 1.00 23.93 ? 250 ASP B OD1 1 ATOM 3878 O OD2 . ASP B 1 250 ? 7.705 37.217 18.324 1.00 31.45 ? 250 ASP B OD2 1 ATOM 3879 N N . TYR B 1 251 ? 10.429 36.182 13.581 1.00 9.86 ? 251 TYR B N 1 ATOM 3880 C CA . TYR B 1 251 ? 10.394 36.110 12.145 1.00 9.31 ? 251 TYR B CA 1 ATOM 3881 C C . TYR B 1 251 ? 9.494 34.962 11.667 1.00 8.76 ? 251 TYR B C 1 ATOM 3882 O O . TYR B 1 251 ? 9.425 33.956 12.336 1.00 12.28 ? 251 TYR B O 1 ATOM 3883 C CB . TYR B 1 251 ? 11.805 35.877 11.604 1.00 9.88 ? 251 TYR B CB 1 ATOM 3884 C CG . TYR B 1 251 ? 12.822 36.937 11.950 1.00 9.77 ? 251 TYR B CG 1 ATOM 3885 C CD1 . TYR B 1 251 ? 13.544 36.863 13.153 1.00 10.87 ? 251 TYR B CD1 1 ATOM 3886 C CD2 . TYR B 1 251 ? 13.048 38.008 11.127 1.00 12.18 ? 251 TYR B CD2 1 ATOM 3887 C CE1 . TYR B 1 251 ? 14.478 37.833 13.491 1.00 12.84 ? 251 TYR B CE1 1 ATOM 3888 C CE2 . TYR B 1 251 ? 13.992 38.972 11.458 1.00 14.44 ? 251 TYR B CE2 1 ATOM 3889 C CZ . TYR B 1 251 ? 14.692 38.886 12.633 1.00 13.14 ? 251 TYR B CZ 1 ATOM 3890 O OH . TYR B 1 251 ? 15.631 39.851 12.931 1.00 16.24 ? 251 TYR B OH 1 ATOM 3891 N N . ALA B 1 252 ? 8.915 35.145 10.493 1.00 8.06 ? 252 ALA B N 1 ATOM 3892 C CA . ALA B 1 252 ? 8.261 34.088 9.757 1.00 7.96 ? 252 ALA B CA 1 ATOM 3893 C C . ALA B 1 252 ? 9.023 33.815 8.467 1.00 7.86 ? 252 ALA B C 1 ATOM 3894 O O . ALA B 1 252 ? 9.573 34.723 7.857 1.00 9.13 ? 252 ALA B O 1 ATOM 3895 C CB . ALA B 1 252 ? 6.831 34.435 9.470 1.00 9.86 ? 252 ALA B CB 1 ATOM 3896 N N . VAL B 1 253 ? 9.124 32.544 8.116 1.00 7.52 ? 253 VAL B N 1 ATOM 3897 C CA . VAL B 1 253 ? 9.963 32.144 6.986 1.00 8.03 ? 253 VAL B CA 1 ATOM 3898 C C . VAL B 1 253 ? 9.265 31.074 6.159 1.00 7.62 ? 253 VAL B C 1 ATOM 3899 O O . VAL B 1 253 ? 8.592 30.207 6.686 1.00 8.24 ? 253 VAL B O 1 ATOM 3900 C CB . VAL B 1 253 ? 11.341 31.668 7.451 1.00 9.00 ? 253 VAL B CB 1 ATOM 3901 C CG1 . VAL B 1 253 ? 11.304 30.523 8.458 1.00 9.86 ? 253 VAL B CG1 1 ATOM 3902 C CG2 . VAL B 1 253 ? 12.247 31.307 6.278 1.00 12.04 ? 253 VAL B CG2 1 ATOM 3903 N N . ALA B 1 254 ? 9.454 31.166 4.853 1.00 7.35 ? 254 ALA B N 1 ATOM 3904 C CA . ALA B 1 254 ? 8.981 30.149 3.945 1.00 7.67 ? 254 ALA B CA 1 ATOM 3905 C C . ALA B 1 254 ? 10.137 29.824 2.990 1.00 7.95 ? 254 ALA B C 1 ATOM 3906 O O . ALA B 1 254 ? 10.662 30.739 2.338 1.00 9.86 ? 254 ALA B O 1 ATOM 3907 C CB . ALA B 1 254 ? 7.719 30.566 3.165 1.00 9.98 ? 254 ALA B CB 1 ATOM 3908 N N . VAL B 1 255 ? 10.487 28.553 2.857 1.00 7.57 ? 255 VAL B N 1 ATOM 3909 C CA . VAL B 1 255 ? 11.516 28.074 1.919 1.00 7.89 ? 255 VAL B CA 1 ATOM 3910 C C . VAL B 1 255 ? 10.876 26.984 1.068 1.00 8.42 ? 255 VAL B C 1 ATOM 3911 O O . VAL B 1 255 ? 10.384 25.967 1.614 1.00 9.03 ? 255 VAL B O 1 ATOM 3912 C CB . VAL B 1 255 ? 12.747 27.533 2.658 1.00 8.52 ? 255 VAL B CB 1 ATOM 3913 C CG1 . VAL B 1 255 ? 13.722 26.895 1.709 1.00 9.99 ? 255 VAL B CG1 1 ATOM 3914 C CG2 . VAL B 1 255 ? 13.380 28.662 3.446 1.00 9.60 ? 255 VAL B CG2 1 ATOM 3915 N N . TYR B 1 256 ? 10.924 27.150 -0.240 1.00 8.76 ? 256 TYR B N 1 ATOM 3916 C CA . TYR B 1 256 ? 10.451 26.220 -1.249 1.00 8.35 ? 256 TYR B CA 1 ATOM 3917 C C . TYR B 1 256 ? 11.632 25.947 -2.164 1.00 10.01 ? 256 TYR B C 1 ATOM 3918 O O . TYR B 1 256 ? 12.286 26.858 -2.656 1.00 10.66 ? 256 TYR B O 1 ATOM 3919 C CB . TYR B 1 256 ? 9.232 26.797 -2.031 1.00 10.75 ? 256 TYR B CB 1 ATOM 3920 C CG . TYR B 1 256 ? 8.042 26.847 -1.115 1.00 8.71 ? 256 TYR B CG 1 ATOM 3921 C CD1 . TYR B 1 256 ? 7.242 25.733 -0.989 1.00 9.88 ? 256 TYR B CD1 1 ATOM 3922 C CD2 . TYR B 1 256 ? 7.691 27.952 -0.357 1.00 9.95 ? 256 TYR B CD2 1 ATOM 3923 C CE1 . TYR B 1 256 ? 6.146 25.686 -0.167 1.00 8.81 ? 256 TYR B CE1 1 ATOM 3924 C CE2 . TYR B 1 256 ? 6.621 27.896 0.475 1.00 10.04 ? 256 TYR B CE2 1 ATOM 3925 C CZ . TYR B 1 256 ? 5.841 26.794 0.609 1.00 8.65 ? 256 TYR B CZ 1 ATOM 3926 O OH . TYR B 1 256 ? 4.762 26.827 1.455 1.00 8.69 ? 256 TYR B OH 1 ATOM 3927 N N . THR B 1 257 ? 11.920 24.664 -2.407 1.00 9.95 ? 257 THR B N 1 ATOM 3928 C CA . THR B 1 257 ? 12.955 24.345 -3.352 1.00 10.78 ? 257 THR B CA 1 ATOM 3929 C C . THR B 1 257 ? 12.504 23.253 -4.299 1.00 11.53 ? 257 THR B C 1 ATOM 3930 O O . THR B 1 257 ? 11.677 22.423 -3.988 1.00 12.33 ? 257 THR B O 1 ATOM 3931 C CB . THR B 1 257 ? 14.271 23.899 -2.665 1.00 11.58 ? 257 THR B CB 1 ATOM 3932 O OG1 . THR B 1 257 ? 14.220 22.540 -2.170 1.00 12.11 ? 257 THR B OG1 1 ATOM 3933 C CG2 . THR B 1 257 ? 14.734 24.783 -1.525 1.00 12.28 ? 257 THR B CG2 1 ATOM 3934 N N . THR B 1 258 ? 13.101 23.309 -5.483 1.00 11.96 ? 258 THR B N 1 ATOM 3935 C CA . THR B 1 258 ? 12.872 22.334 -6.544 1.00 12.55 ? 258 THR B CA 1 ATOM 3936 C C . THR B 1 258 ? 14.232 21.880 -7.048 1.00 13.25 ? 258 THR B C 1 ATOM 3937 O O . THR B 1 258 ? 14.979 22.718 -7.578 1.00 14.15 ? 258 THR B O 1 ATOM 3938 C CB . THR B 1 258 ? 12.047 22.902 -7.721 1.00 16.44 ? 258 THR B CB 1 ATOM 3939 O OG1 . THR B 1 258 ? 10.928 23.613 -7.173 1.00 18.89 ? 258 THR B OG1 1 ATOM 3940 C CG2 . THR B 1 258 ? 11.539 21.809 -8.641 1.00 19.49 ? 258 THR B CG2 1 ATOM 3941 N N . ALA B 1 259 ? 14.553 20.588 -6.884 1.00 14.40 ? 259 ALA B N 1 ATOM 3942 C CA . ALA B 1 259 ? 15.852 20.072 -7.311 1.00 14.95 ? 259 ALA B CA 1 ATOM 3943 C C . ALA B 1 259 ? 15.680 18.668 -7.830 1.00 14.71 ? 259 ALA B C 1 ATOM 3944 O O . ALA B 1 259 ? 15.880 17.674 -7.128 1.00 15.89 ? 259 ALA B O 1 ATOM 3945 C CB . ALA B 1 259 ? 16.796 20.110 -6.125 1.00 17.27 ? 259 ALA B CB 1 ATOM 3946 N N . PRO B 1 260 ? 15.240 18.543 -9.071 1.00 15.77 ? 260 PRO B N 1 ATOM 3947 C CA . PRO B 1 260 ? 14.824 17.230 -9.584 1.00 16.62 ? 260 PRO B CA 1 ATOM 3948 C C . PRO B 1 260 ? 15.980 16.254 -9.644 1.00 16.25 ? 260 PRO B C 1 ATOM 3949 O O . PRO B 1 260 ? 15.760 15.024 -9.571 1.00 22.25 ? 260 PRO B O 1 ATOM 3950 C CB . PRO B 1 260 ? 14.228 17.546 -10.947 1.00 21.34 ? 260 PRO B CB 1 ATOM 3951 C CG . PRO B 1 260 ? 14.141 19.039 -11.066 1.00 24.50 ? 260 PRO B CG 1 ATOM 3952 C CD . PRO B 1 260 ? 15.026 19.630 -10.026 1.00 20.33 ? 260 PRO B CD 1 ATOM 3953 N N . LYS B 1 261 ? 17.219 16.767 -9.761 1.00 18.79 ? 261 LYS B N 1 ATOM 3954 C CA . LYS B 1 261 ? 18.308 15.814 -9.986 1.00 23.01 ? 261 LYS B CA 1 ATOM 3955 C C . LYS B 1 261 ? 18.996 15.401 -8.708 1.00 22.31 ? 261 LYS B C 1 ATOM 3956 O O . LYS B 1 261 ? 19.873 14.532 -8.631 1.00 29.89 ? 261 LYS B O 1 ATOM 3957 C CB . LYS B 1 261 ? 19.328 16.391 -10.964 1.00 30.45 ? 261 LYS B CB 1 ATOM 3958 C CG . LYS B 1 261 ? 18.740 16.632 -12.362 1.00 38.33 ? 261 LYS B CG 1 ATOM 3959 C CD . LYS B 1 261 ? 19.834 16.906 -13.363 1.00 46.00 ? 261 LYS B CD 1 ATOM 3960 C CE . LYS B 1 261 ? 20.787 18.002 -12.900 1.00 52.75 ? 261 LYS B CE 1 ATOM 3961 N NZ . LYS B 1 261 ? 21.041 19.009 -13.977 1.00 53.90 ? 261 LYS B NZ 1 ATOM 3962 N N . LEU B 1 262 ? 18.619 15.987 -7.581 1.00 18.94 ? 262 LEU B N 1 ATOM 3963 C CA . LEU B 1 262 ? 19.259 15.588 -6.334 1.00 18.05 ? 262 LEU B CA 1 ATOM 3964 C C . LEU B 1 262 ? 18.624 14.367 -5.716 1.00 17.94 ? 262 LEU B C 1 ATOM 3965 O O . LEU B 1 262 ? 17.450 14.109 -5.963 1.00 20.04 ? 262 LEU B O 1 ATOM 3966 C CB . LEU B 1 262 ? 19.109 16.740 -5.343 1.00 17.30 ? 262 LEU B CB 1 ATOM 3967 C CG . LEU B 1 262 ? 19.946 17.993 -5.633 1.00 18.89 ? 262 LEU B CG 1 ATOM 3968 C CD1 . LEU B 1 262 ? 19.851 18.906 -4.404 1.00 17.47 ? 262 LEU B CD1 1 ATOM 3969 C CD2 . LEU B 1 262 ? 21.400 17.742 -5.905 1.00 22.56 ? 262 LEU B CD2 1 ATOM 3970 N N . SER B 1 263 ? 19.339 13.631 -4.894 1.00 17.90 ? 263 SER B N 1 ATOM 3971 C CA . SER B 1 263 ? 18.740 12.583 -4.072 1.00 17.92 ? 263 SER B CA 1 ATOM 3972 C C . SER B 1 263 ? 17.960 13.171 -2.899 1.00 17.55 ? 263 SER B C 1 ATOM 3973 O O . SER B 1 263 ? 18.066 14.369 -2.593 1.00 16.45 ? 263 SER B O 1 ATOM 3974 C CB . SER B 1 263 ? 19.791 11.674 -3.462 1.00 20.20 ? 263 SER B CB 1 ATOM 3975 O OG . SER B 1 263 ? 20.545 12.370 -2.483 1.00 21.11 ? 263 SER B OG 1 ATOM 3976 N N . ALA B 1 264 ? 17.167 12.363 -2.188 1.00 17.82 ? 264 ALA B N 1 ATOM 3977 C CA . ALA B 1 264 ? 16.399 12.834 -1.061 1.00 16.56 ? 264 ALA B CA 1 ATOM 3978 C C . ALA B 1 264 ? 17.253 13.434 0.032 1.00 15.78 ? 264 ALA B C 1 ATOM 3979 O O . ALA B 1 264 ? 17.006 14.496 0.621 1.00 14.38 ? 264 ALA B O 1 ATOM 3980 C CB . ALA B 1 264 ? 15.531 11.718 -0.451 1.00 22.35 ? 264 ALA B CB 1 ATOM 3981 N N . VAL B 1 265 ? 18.354 12.725 0.326 1.00 17.94 ? 265 VAL B N 1 ATOM 3982 C CA . VAL B 1 265 ? 19.223 13.250 1.357 1.00 16.33 ? 265 VAL B CA 1 ATOM 3983 C C . VAL B 1 265 ? 19.848 14.566 0.914 1.00 14.74 ? 265 VAL B C 1 ATOM 3984 O O . VAL B 1 265 ? 20.045 15.498 1.680 1.00 15.63 ? 265 VAL B O 1 ATOM 3985 C CB . VAL B 1 265 ? 20.328 12.237 1.695 1.00 19.86 ? 265 VAL B CB 1 ATOM 3986 C CG1 . VAL B 1 265 ? 21.148 11.831 0.489 1.00 42.27 ? 265 VAL B CG1 1 ATOM 3987 C CG2 . VAL B 1 265 ? 21.302 12.796 2.721 1.00 29.63 ? 265 VAL B CG2 1 ATOM 3988 N N . GLU B 1 266 ? 20.232 14.672 -0.349 1.00 14.71 ? 266 GLU B N 1 ATOM 3989 C CA . GLU B 1 266 ? 20.847 15.878 -0.900 1.00 14.73 ? 266 GLU B CA 1 ATOM 3990 C C . GLU B 1 266 ? 19.862 17.050 -0.834 1.00 14.13 ? 266 GLU B C 1 ATOM 3991 O O . GLU B 1 266 ? 20.243 18.211 -0.610 1.00 13.24 ? 266 GLU B O 1 ATOM 3992 C CB . GLU B 1 266 ? 21.310 15.588 -2.320 1.00 15.85 ? 266 GLU B CB 1 ATOM 3993 C CG . GLU B 1 266 ? 22.662 14.868 -2.398 1.00 19.05 ? 266 GLU B CG 1 ATOM 3994 C CD . GLU B 1 266 ? 23.049 14.406 -3.778 1.00 21.75 ? 266 GLU B CD 1 ATOM 3995 O OE1 . GLU B 1 266 ? 24.219 14.039 -3.970 1.00 34.91 ? 266 GLU B OE1 1 ATOM 3996 O OE2 . GLU B 1 266 ? 22.178 14.441 -4.667 1.00 23.63 ? 266 GLU B OE2 1 ATOM 3997 N N . ARG B 1 267 ? 18.592 16.789 -1.011 1.00 12.34 ? 267 ARG B N 1 ATOM 3998 C CA . ARG B 1 267 ? 17.560 17.820 -0.935 1.00 13.15 ? 267 ARG B CA 1 ATOM 3999 C C . ARG B 1 267 ? 17.441 18.311 0.490 1.00 11.32 ? 267 ARG B C 1 ATOM 4000 O O . ARG B 1 267 ? 17.265 19.517 0.762 1.00 11.78 ? 267 ARG B O 1 ATOM 4001 C CB . ARG B 1 267 ? 16.224 17.338 -1.446 1.00 12.38 ? 267 ARG B CB 1 ATOM 4002 C CG . ARG B 1 267 ? 16.257 17.035 -2.920 1.00 14.32 ? 267 ARG B CG 1 ATOM 4003 C CD . ARG B 1 267 ? 14.876 16.642 -3.408 1.00 16.43 ? 267 ARG B CD 1 ATOM 4004 N NE . ARG B 1 267 ? 14.926 16.180 -4.817 1.00 15.13 ? 267 ARG B NE 1 ATOM 4005 C CZ . ARG B 1 267 ? 14.592 14.983 -5.291 1.00 18.03 ? 267 ARG B CZ 1 ATOM 4006 N NH1 . ARG B 1 267 ? 14.183 13.994 -4.519 1.00 18.24 ? 267 ARG B NH1 1 ATOM 4007 N NH2 . ARG B 1 267 ? 14.689 14.747 -6.614 1.00 19.06 ? 267 ARG B NH2 1 ATOM 4008 N N . ASP B 1 268 ? 17.476 17.402 1.485 1.00 12.52 ? 268 ASP B N 1 ATOM 4009 C CA . ASP B 1 268 ? 17.511 17.800 2.865 1.00 12.36 ? 268 ASP B CA 1 ATOM 4010 C C . ASP B 1 268 ? 18.736 18.696 3.158 1.00 12.22 ? 268 ASP B C 1 ATOM 4011 O O . ASP B 1 268 ? 18.619 19.730 3.830 1.00 13.19 ? 268 ASP B O 1 ATOM 4012 C CB . ASP B 1 268 ? 17.594 16.603 3.817 1.00 14.90 ? 268 ASP B CB 1 ATOM 4013 C CG . ASP B 1 268 ? 16.413 15.703 3.931 1.00 18.70 ? 268 ASP B CG 1 ATOM 4014 O OD1 . ASP B 1 268 ? 16.553 14.613 4.533 1.00 24.03 ? 268 ASP B OD1 1 ATOM 4015 O OD2 . ASP B 1 268 ? 15.356 16.105 3.442 1.00 24.95 ? 268 ASP B OD2 1 ATOM 4016 N N . GLU B 1 269 ? 19.893 18.300 2.672 1.00 13.28 ? 269 GLU B N 1 ATOM 4017 C CA . GLU B 1 269 ? 21.127 19.072 2.829 1.00 12.70 ? 269 GLU B CA 1 ATOM 4018 C C . GLU B 1 269 ? 20.968 20.441 2.196 1.00 12.32 ? 269 GLU B C 1 ATOM 4019 O O . GLU B 1 269 ? 21.495 21.423 2.727 1.00 13.90 ? 269 GLU B O 1 ATOM 4020 C CB . GLU B 1 269 ? 22.325 18.321 2.291 1.00 14.27 ? 269 GLU B CB 1 ATOM 4021 C CG . GLU B 1 269 ? 22.746 17.039 2.944 1.00 18.16 ? 269 GLU B CG 1 ATOM 4022 C CD . GLU B 1 269 ? 23.800 16.212 2.237 1.00 25.46 ? 269 GLU B CD 1 ATOM 4023 O OE1 . GLU B 1 269 ? 24.318 16.647 1.191 1.00 36.10 ? 269 GLU B OE1 1 ATOM 4024 O OE2 . GLU B 1 269 ? 24.138 15.103 2.729 1.00 27.05 ? 269 GLU B OE2 1 ATOM 4025 N N . LEU B 1 270 ? 20.289 20.507 1.052 1.00 12.05 ? 270 LEU B N 1 ATOM 4026 C CA . LEU B 1 270 ? 20.106 21.808 0.400 1.00 12.54 ? 270 LEU B CA 1 ATOM 4027 C C . LEU B 1 270 ? 19.285 22.713 1.291 1.00 11.72 ? 270 LEU B C 1 ATOM 4028 O O . LEU B 1 270 ? 19.619 23.931 1.471 1.00 11.25 ? 270 LEU B O 1 ATOM 4029 C CB . LEU B 1 270 ? 19.470 21.592 -0.966 1.00 13.10 ? 270 LEU B CB 1 ATOM 4030 C CG . LEU B 1 270 ? 19.087 22.869 -1.738 1.00 12.88 ? 270 LEU B CG 1 ATOM 4031 C CD1 . LEU B 1 270 ? 20.384 23.649 -2.023 1.00 19.16 ? 270 LEU B CD1 1 ATOM 4032 C CD2 . LEU B 1 270 ? 18.354 22.584 -2.997 1.00 17.28 ? 270 LEU B CD2 1 ATOM 4033 N N . VAL B 1 271 ? 18.179 22.250 1.850 1.00 10.09 ? 271 VAL B N 1 ATOM 4034 C CA . VAL B 1 271 ? 17.345 23.103 2.668 1.00 10.43 ? 271 VAL B CA 1 ATOM 4035 C C . VAL B 1 271 ? 18.103 23.513 3.918 1.00 10.14 ? 271 VAL B C 1 ATOM 4036 O O . VAL B 1 271 ? 18.034 24.661 4.392 1.00 9.78 ? 271 VAL B O 1 ATOM 4037 C CB . VAL B 1 271 ? 16.038 22.422 2.986 1.00 11.77 ? 271 VAL B CB 1 ATOM 4038 C CG1 . VAL B 1 271 ? 15.191 23.319 3.868 1.00 10.64 ? 271 VAL B CG1 1 ATOM 4039 C CG2 . VAL B 1 271 ? 15.255 22.122 1.712 1.00 12.97 ? 271 VAL B CG2 1 ATOM 4040 N N . ALA B 1 272 ? 18.894 22.618 4.526 1.00 10.00 ? 272 ALA B N 1 ATOM 4041 C CA . ALA B 1 272 ? 19.734 22.988 5.655 1.00 10.70 ? 272 ALA B CA 1 ATOM 4042 C C . ALA B 1 272 ? 20.724 24.064 5.219 1.00 10.52 ? 272 ALA B C 1 ATOM 4043 O O . ALA B 1 272 ? 20.981 25.004 6.026 1.00 11.12 ? 272 ALA B O 1 ATOM 4044 C CB . ALA B 1 272 ? 20.479 21.781 6.216 1.00 12.48 ? 272 ALA B CB 1 ATOM 4045 N N . SER B 1 273 ? 21.318 23.962 4.044 1.00 11.21 ? 273 SER B N 1 ATOM 4046 C CA . SER B 1 273 ? 22.235 24.972 3.591 1.00 12.15 ? 273 SER B CA 1 ATOM 4047 C C . SER B 1 273 ? 21.557 26.329 3.436 1.00 10.79 ? 273 SER B C 1 ATOM 4048 O O . SER B 1 273 ? 22.144 27.377 3.715 1.00 11.35 ? 273 SER B O 1 ATOM 4049 C CB . SER B 1 273 ? 22.919 24.577 2.280 1.00 12.58 ? 273 SER B CB 1 ATOM 4050 O OG . SER B 1 273 ? 23.737 23.436 2.452 1.00 15.34 ? 273 SER B OG 1 ATOM 4051 N N . VAL B 1 274 ? 20.324 26.303 2.945 1.00 11.12 ? 274 VAL B N 1 ATOM 4052 C CA . VAL B 1 274 ? 19.547 27.531 2.847 1.00 11.31 ? 274 VAL B CA 1 ATOM 4053 C C . VAL B 1 274 ? 19.322 28.079 4.235 1.00 10.82 ? 274 VAL B C 1 ATOM 4054 O O . VAL B 1 274 ? 19.415 29.300 4.473 1.00 9.97 ? 274 VAL B O 1 ATOM 4055 C CB . VAL B 1 274 ? 18.210 27.280 2.107 1.00 10.97 ? 274 VAL B CB 1 ATOM 4056 C CG1 . VAL B 1 274 ? 17.336 28.524 2.178 1.00 11.22 ? 274 VAL B CG1 1 ATOM 4057 C CG2 . VAL B 1 274 ? 18.467 26.907 0.659 1.00 12.28 ? 274 VAL B CG2 1 ATOM 4058 N N . GLY B 1 275 ? 19.074 27.230 5.235 1.00 10.57 ? 275 GLY B N 1 ATOM 4059 C CA . GLY B 1 275 ? 19.025 27.646 6.614 1.00 9.78 ? 275 GLY B CA 1 ATOM 4060 C C . GLY B 1 275 ? 20.244 28.402 7.060 1.00 9.61 ? 275 GLY B C 1 ATOM 4061 O O . GLY B 1 275 ? 20.162 29.440 7.739 1.00 10.21 ? 275 GLY B O 1 ATOM 4062 N N . GLN B 1 276 ? 21.432 27.907 6.704 1.00 10.61 ? 276 GLN B N 1 ATOM 4063 C CA . GLN B 1 276 ? 22.691 28.538 7.072 1.00 10.81 ? 276 GLN B CA 1 ATOM 4064 C C . GLN B 1 276 ? 22.829 29.888 6.407 1.00 10.25 ? 276 GLN B C 1 ATOM 4065 O O . GLN B 1 276 ? 23.331 30.831 7.003 1.00 12.70 ? 276 GLN B O 1 ATOM 4066 C CB . GLN B 1 276 ? 23.860 27.617 6.748 1.00 16.10 ? 276 GLN B CB 1 ATOM 4067 C CG . GLN B 1 276 ? 25.143 28.073 7.388 1.00 21.14 ? 276 GLN B CG 1 ATOM 4068 C CD . GLN B 1 276 ? 25.192 28.254 8.881 1.00 21.45 ? 276 GLN B CD 1 ATOM 4069 O OE1 . GLN B 1 276 ? 24.459 27.556 9.601 1.00 37.52 ? 276 GLN B OE1 1 ATOM 4070 N NE2 . GLN B 1 276 ? 26.044 29.182 9.333 1.00 29.56 ? 276 GLN B NE2 1 ATOM 4071 N N . VAL B 1 277 ? 22.401 30.012 5.147 1.00 11.58 ? 277 VAL B N 1 ATOM 4072 C CA . VAL B 1 277 ? 22.443 31.300 4.467 1.00 11.54 ? 277 VAL B CA 1 ATOM 4073 C C . VAL B 1 277 ? 21.539 32.300 5.125 1.00 11.18 ? 277 VAL B C 1 ATOM 4074 O O . VAL B 1 277 ? 21.864 33.480 5.284 1.00 11.75 ? 277 VAL B O 1 ATOM 4075 C CB . VAL B 1 277 ? 22.171 31.088 2.964 1.00 12.81 ? 277 VAL B CB 1 ATOM 4076 C CG1 . VAL B 1 277 ? 21.949 32.418 2.275 1.00 16.07 ? 277 VAL B CG1 1 ATOM 4077 C CG2 . VAL B 1 277 ? 23.300 30.287 2.346 1.00 15.75 ? 277 VAL B CG2 1 ATOM 4078 N N . ILE B 1 278 ? 20.357 31.849 5.531 1.00 10.13 ? 278 ILE B N 1 ATOM 4079 C CA . ILE B 1 278 ? 19.446 32.644 6.333 1.00 10.80 ? 278 ILE B CA 1 ATOM 4080 C C . ILE B 1 278 ? 20.070 33.111 7.630 1.00 10.41 ? 278 ILE B C 1 ATOM 4081 O O . ILE B 1 278 ? 20.013 34.306 7.995 1.00 11.54 ? 278 ILE B O 1 ATOM 4082 C CB . ILE B 1 278 ? 18.106 31.926 6.581 1.00 10.37 ? 278 ILE B CB 1 ATOM 4083 C CG1 . ILE B 1 278 ? 17.338 31.803 5.260 1.00 10.84 ? 278 ILE B CG1 1 ATOM 4084 C CG2 . ILE B 1 278 ? 17.297 32.601 7.649 1.00 11.56 ? 278 ILE B CG2 1 ATOM 4085 C CD1 . ILE B 1 278 ? 16.209 30.816 5.308 1.00 10.24 ? 278 ILE B CD1 1 ATOM 4086 N N . THR B 1 279 ? 20.703 32.179 8.343 1.00 11.10 ? 279 THR B N 1 ATOM 4087 C CA . THR B 1 279 ? 21.347 32.521 9.594 1.00 10.30 ? 279 THR B CA 1 ATOM 4088 C C . THR B 1 279 ? 22.370 33.629 9.387 1.00 11.29 ? 279 THR B C 1 ATOM 4089 O O . THR B 1 279 ? 22.441 34.587 10.165 1.00 12.83 ? 279 THR B O 1 ATOM 4090 C CB . THR B 1 279 ? 22.060 31.306 10.207 1.00 11.14 ? 279 THR B CB 1 ATOM 4091 O OG1 . THR B 1 279 ? 21.019 30.347 10.526 1.00 11.47 ? 279 THR B OG1 1 ATOM 4092 C CG2 . THR B 1 279 ? 22.761 31.628 11.514 1.00 12.26 ? 279 THR B CG2 1 ATOM 4093 N N . GLN B 1 280 ? 23.188 33.516 8.348 1.00 11.80 ? 280 GLN B N 1 ATOM 4094 C CA . GLN B 1 280 ? 24.234 34.497 8.061 1.00 13.34 ? 280 GLN B CA 1 ATOM 4095 C C . GLN B 1 280 ? 23.610 35.861 7.843 1.00 13.74 ? 280 GLN B C 1 ATOM 4096 O O . GLN B 1 280 ? 24.145 36.886 8.311 1.00 15.82 ? 280 GLN B O 1 ATOM 4097 C CB . GLN B 1 280 ? 25.072 34.020 6.892 1.00 14.94 ? 280 GLN B CB 1 ATOM 4098 C CG A GLN B 1 280 ? 25.960 32.845 7.300 0.56 17.01 ? 280 GLN B CG 1 ATOM 4099 C CG B GLN B 1 280 ? 26.232 34.943 6.521 0.44 17.99 ? 280 GLN B CG 1 ATOM 4100 C CD A GLN B 1 280 ? 27.019 33.227 8.315 0.56 26.31 ? 280 GLN B CD 1 ATOM 4101 C CD B GLN B 1 280 ? 27.191 34.317 5.535 0.44 19.75 ? 280 GLN B CD 1 ATOM 4102 O OE1 A GLN B 1 280 ? 27.142 32.516 9.316 0.56 36.14 ? 280 GLN B OE1 1 ATOM 4103 O OE1 B GLN B 1 280 ? 27.308 33.093 5.447 0.44 34.28 ? 280 GLN B OE1 1 ATOM 4104 N NE2 A GLN B 1 280 ? 27.732 34.318 8.015 0.56 42.38 ? 280 GLN B NE2 1 ATOM 4105 N NE2 B GLN B 1 280 ? 27.909 35.130 4.772 0.44 26.19 ? 280 GLN B NE2 1 ATOM 4106 N N . LEU B 1 281 ? 22.486 35.924 7.137 1.00 12.78 ? 281 LEU B N 1 ATOM 4107 C CA . LEU B 1 281 ? 21.837 37.213 6.950 1.00 13.60 ? 281 LEU B CA 1 ATOM 4108 C C . LEU B 1 281 ? 21.347 37.748 8.284 1.00 14.04 ? 281 LEU B C 1 ATOM 4109 O O . LEU B 1 281 ? 21.573 38.917 8.606 1.00 17.50 ? 281 LEU B O 1 ATOM 4110 C CB . LEU B 1 281 ? 20.697 37.054 5.971 1.00 15.37 ? 281 LEU B CB 1 ATOM 4111 C CG . LEU B 1 281 ? 19.814 38.196 5.498 1.00 22.07 ? 281 LEU B CG 1 ATOM 4112 C CD1 . LEU B 1 281 ? 18.588 38.438 6.369 1.00 21.23 ? 281 LEU B CD1 1 ATOM 4113 C CD2 . LEU B 1 281 ? 20.579 39.498 5.305 1.00 36.85 ? 281 LEU B CD2 1 ATOM 4114 N N . ILE B 1 282 ? 20.609 36.966 9.048 1.00 12.41 ? 282 ILE B N 1 ATOM 4115 C CA . ILE B 1 282 ? 20.001 37.443 10.276 1.00 14.02 ? 282 ILE B CA 1 ATOM 4116 C C . ILE B 1 282 ? 21.064 37.944 11.230 1.00 14.83 ? 282 ILE B C 1 ATOM 4117 O O . ILE B 1 282 ? 20.913 38.964 11.924 1.00 19.22 ? 282 ILE B O 1 ATOM 4118 C CB . ILE B 1 282 ? 19.102 36.337 10.885 1.00 14.54 ? 282 ILE B CB 1 ATOM 4119 C CG1 . ILE B 1 282 ? 17.961 35.990 9.953 1.00 14.85 ? 282 ILE B CG1 1 ATOM 4120 C CG2 . ILE B 1 282 ? 18.626 36.728 12.269 1.00 16.78 ? 282 ILE B CG2 1 ATOM 4121 C CD1 . ILE B 1 282 ? 16.900 37.071 9.832 1.00 15.80 ? 282 ILE B CD1 1 ATOM 4122 N N . LEU B 1 283 ? 22.181 37.236 11.295 1.00 13.69 ? 283 LEU B N 1 ATOM 4123 C CA . LEU B 1 283 ? 23.233 37.597 12.235 1.00 18.80 ? 283 LEU B CA 1 ATOM 4124 C C . LEU B 1 283 ? 24.158 38.669 11.681 1.00 24.41 ? 283 LEU B C 1 ATOM 4125 O O . LEU B 1 283 ? 24.957 39.177 12.471 1.00 31.04 ? 283 LEU B O 1 ATOM 4126 C CB . LEU B 1 283 ? 24.004 36.340 12.669 1.00 22.23 ? 283 LEU B CB 1 ATOM 4127 C CG . LEU B 1 283 ? 23.213 35.249 13.392 1.00 25.00 ? 283 LEU B CG 1 ATOM 4128 C CD1 . LEU B 1 283 ? 24.124 34.094 13.774 1.00 36.74 ? 283 LEU B CD1 1 ATOM 4129 C CD2 . LEU B 1 283 ? 22.513 35.833 14.605 1.00 32.52 ? 283 LEU B CD2 1 ATOM 4130 N N . SER B 1 284 ? 24.065 39.041 10.412 1.00 22.17 ? 284 SER B N 1 ATOM 4131 C CA . SER B 1 284 ? 24.899 40.052 9.781 1.00 27.45 ? 284 SER B CA 1 ATOM 4132 C C . SER B 1 284 ? 24.667 41.423 10.410 1.00 29.05 ? 284 SER B C 1 ATOM 4133 O O . SER B 1 284 ? 24.980 42.412 9.711 1.00 51.27 ? 284 SER B O 1 ATOM 4134 C CB . SER B 1 284 ? 24.652 40.107 8.263 1.00 28.74 ? 284 SER B CB 1 ATOM 4135 O OG . SER B 1 284 ? 25.744 40.725 7.611 1.00 33.24 ? 284 SER B OG 1 HETATM 4136 S S . SO4 C 2 . ? 11.245 1.799 23.919 0.58 15.77 ? 300 SO4 A S 1 HETATM 4137 O O1 . SO4 C 2 . ? 11.202 0.385 23.928 0.58 14.46 ? 300 SO4 A O1 1 HETATM 4138 O O2 . SO4 C 2 . ? 12.163 2.143 24.823 0.58 30.09 ? 300 SO4 A O2 1 HETATM 4139 O O3 . SO4 C 2 . ? 10.063 2.256 24.222 0.58 18.75 ? 300 SO4 A O3 1 HETATM 4140 O O4 . SO4 C 2 . ? 11.703 2.588 22.825 0.58 31.49 ? 300 SO4 A O4 1 HETATM 4141 S S . SO4 D 2 . ? 7.201 15.749 4.885 0.63 15.89 ? 300 SO4 B S 1 HETATM 4142 O O1 . SO4 D 2 . ? 7.443 14.577 5.691 0.63 33.03 ? 300 SO4 B O1 1 HETATM 4143 O O2 . SO4 D 2 . ? 6.705 16.624 5.741 0.63 20.91 ? 300 SO4 B O2 1 HETATM 4144 O O3 . SO4 D 2 . ? 6.366 15.406 3.952 0.63 28.88 ? 300 SO4 B O3 1 HETATM 4145 O O4 . SO4 D 2 . ? 8.226 16.521 4.301 0.63 17.25 ? 300 SO4 B O4 1 HETATM 4146 O O . HOH E 3 . ? 13.929 2.813 30.412 0.87 37.11 ? 301 HOH A O 1 HETATM 4147 O O . HOH E 3 . ? 13.418 1.653 26.700 0.40 28.32 ? 302 HOH A O 1 HETATM 4148 O O . HOH E 3 . ? 2.997 -3.063 20.181 1.00 11.85 ? 303 HOH A O 1 HETATM 4149 O O . HOH E 3 . ? 3.032 1.749 18.064 1.00 13.96 ? 304 HOH A O 1 HETATM 4150 O O . HOH E 3 . ? 5.304 13.590 22.256 1.00 25.47 ? 305 HOH A O 1 HETATM 4151 O O . HOH E 3 . ? 12.344 24.676 21.509 1.00 9.68 ? 306 HOH A O 1 HETATM 4152 O O . HOH E 3 . ? 15.101 15.478 18.663 1.00 19.93 ? 307 HOH A O 1 HETATM 4153 O O . HOH E 3 . ? 11.604 28.721 31.166 1.00 34.27 ? 308 HOH A O 1 HETATM 4154 O O . HOH E 3 . ? 12.079 -13.555 40.015 1.00 13.84 ? 309 HOH A O 1 HETATM 4155 O O . HOH E 3 . ? -1.699 -20.014 21.977 1.00 16.67 ? 310 HOH A O 1 HETATM 4156 O O . HOH E 3 . ? 18.759 -14.805 23.696 1.00 23.07 ? 311 HOH A O 1 HETATM 4157 O O . HOH E 3 . ? -0.093 16.190 26.037 1.00 17.37 ? 312 HOH A O 1 HETATM 4158 O O . HOH E 3 . ? -6.444 -5.331 38.272 1.00 19.69 ? 313 HOH A O 1 HETATM 4159 O O . HOH E 3 . ? 18.923 -5.358 14.858 1.00 24.62 ? 314 HOH A O 1 HETATM 4160 O O . HOH E 3 . ? 17.108 -5.464 24.436 1.00 14.61 ? 315 HOH A O 1 HETATM 4161 O O . HOH E 3 . ? 8.197 -1.365 17.526 1.00 16.63 ? 316 HOH A O 1 HETATM 4162 O O . HOH E 3 . ? 14.714 -4.600 20.258 1.00 15.56 ? 317 HOH A O 1 HETATM 4163 O O . HOH E 3 . ? 6.899 1.879 16.141 1.00 17.08 ? 318 HOH A O 1 HETATM 4164 O O . HOH E 3 . ? 14.979 -8.495 30.961 1.00 14.17 ? 319 HOH A O 1 HETATM 4165 O O . HOH E 3 . ? 0.583 7.950 16.399 1.00 12.52 ? 320 HOH A O 1 HETATM 4166 O O . HOH E 3 . ? 2.431 20.677 22.434 1.00 14.64 ? 321 HOH A O 1 HETATM 4167 O O . HOH E 3 . ? 2.030 -20.956 30.622 1.00 21.08 ? 322 HOH A O 1 HETATM 4168 O O . HOH E 3 . ? -8.785 -3.823 37.748 1.00 18.82 ? 323 HOH A O 1 HETATM 4169 O O . HOH E 3 . ? 19.575 -9.272 33.079 1.00 24.47 ? 324 HOH A O 1 HETATM 4170 O O . HOH E 3 . ? -2.205 10.452 20.325 1.00 26.84 ? 325 HOH A O 1 HETATM 4171 O O . HOH E 3 . ? 20.344 -10.617 30.809 1.00 19.81 ? 326 HOH A O 1 HETATM 4172 O O . HOH E 3 . ? -5.433 -0.037 18.240 1.00 13.57 ? 327 HOH A O 1 HETATM 4173 O O . HOH E 3 . ? -11.604 10.087 21.236 1.00 22.54 ? 328 HOH A O 1 HETATM 4174 O O . HOH E 3 . ? 15.641 22.929 20.966 1.00 11.09 ? 329 HOH A O 1 HETATM 4175 O O . HOH E 3 . ? -0.439 -21.832 30.158 1.00 26.76 ? 330 HOH A O 1 HETATM 4176 O O . HOH E 3 . ? 5.307 -20.479 33.703 1.00 20.07 ? 331 HOH A O 1 HETATM 4177 O O . HOH E 3 . ? 10.461 28.309 28.796 1.00 19.18 ? 332 HOH A O 1 HETATM 4178 O O . HOH E 3 . ? 0.107 21.041 27.480 1.00 18.67 ? 333 HOH A O 1 HETATM 4179 O O . HOH E 3 . ? -10.549 4.773 21.749 1.00 16.66 ? 334 HOH A O 1 HETATM 4180 O O . HOH E 3 . ? 14.231 -9.798 24.360 1.00 15.15 ? 335 HOH A O 1 HETATM 4181 O O . HOH E 3 . ? -5.596 19.732 37.916 1.00 28.57 ? 336 HOH A O 1 HETATM 4182 O O . HOH E 3 . ? 6.750 4.533 23.908 1.00 16.16 ? 337 HOH A O 1 HETATM 4183 O O . HOH E 3 . ? 14.068 -1.473 34.609 1.00 13.54 ? 338 HOH A O 1 HETATM 4184 O O . HOH E 3 . ? -15.129 9.826 36.185 1.00 35.18 ? 339 HOH A O 1 HETATM 4185 O O . HOH E 3 . ? 17.830 -6.778 36.394 1.00 20.83 ? 340 HOH A O 1 HETATM 4186 O O . HOH E 3 . ? 2.945 -18.257 34.946 1.00 17.23 ? 341 HOH A O 1 HETATM 4187 O O . HOH E 3 . ? 11.714 -6.347 45.317 1.00 19.95 ? 342 HOH A O 1 HETATM 4188 O O . HOH E 3 . ? -0.017 -2.473 47.727 1.00 31.81 ? 343 HOH A O 1 HETATM 4189 O O . HOH E 3 . ? 17.127 14.129 32.628 1.00 21.31 ? 344 HOH A O 1 HETATM 4190 O O . HOH E 3 . ? 3.958 -10.993 41.334 1.00 15.00 ? 345 HOH A O 1 HETATM 4191 O O . HOH E 3 . ? 6.194 -21.205 19.110 1.00 23.22 ? 346 HOH A O 1 HETATM 4192 O O . HOH E 3 . ? 3.189 8.895 45.110 1.00 22.82 ? 347 HOH A O 1 HETATM 4193 O O . HOH E 3 . ? 13.782 13.421 42.462 1.00 26.40 ? 348 HOH A O 1 HETATM 4194 O O . HOH E 3 . ? 19.770 -5.456 25.172 1.00 18.76 ? 349 HOH A O 1 HETATM 4195 O O . HOH E 3 . ? 12.642 -13.643 17.152 1.00 22.22 ? 350 HOH A O 1 HETATM 4196 O O . HOH E 3 . ? 19.981 -3.141 37.327 1.00 19.13 ? 351 HOH A O 1 HETATM 4197 O O . HOH E 3 . ? 10.176 0.282 20.633 1.00 17.57 ? 352 HOH A O 1 HETATM 4198 O O . HOH E 3 . ? 1.403 26.076 29.309 1.00 20.56 ? 353 HOH A O 1 HETATM 4199 O O . HOH E 3 . ? 17.354 -2.317 35.425 1.00 19.94 ? 354 HOH A O 1 HETATM 4200 O O . HOH E 3 . ? -9.437 4.499 35.445 1.00 14.54 ? 355 HOH A O 1 HETATM 4201 O O . HOH E 3 . ? -10.579 12.433 27.325 1.00 31.90 ? 356 HOH A O 1 HETATM 4202 O O . HOH E 3 . ? -11.036 10.112 45.457 1.00 40.22 ? 357 HOH A O 1 HETATM 4203 O O . HOH E 3 . ? 14.719 12.970 37.450 1.00 24.89 ? 358 HOH A O 1 HETATM 4204 O O . HOH E 3 . ? 0.207 -23.168 17.522 1.00 30.77 ? 359 HOH A O 1 HETATM 4205 O O . HOH E 3 . ? -7.547 -14.707 38.793 1.00 29.73 ? 360 HOH A O 1 HETATM 4206 O O . HOH E 3 . ? -9.241 16.548 33.710 1.00 27.41 ? 361 HOH A O 1 HETATM 4207 O O . HOH E 3 . ? 12.806 -6.895 30.897 1.00 16.11 ? 362 HOH A O 1 HETATM 4208 O O . HOH E 3 . ? -7.864 10.037 39.800 1.00 19.45 ? 363 HOH A O 1 HETATM 4209 O O . HOH E 3 . ? 1.265 4.271 49.049 1.00 32.18 ? 364 HOH A O 1 HETATM 4210 O O . HOH E 3 . ? -12.942 6.573 29.929 1.00 24.79 ? 365 HOH A O 1 HETATM 4211 O O . HOH E 3 . ? 3.270 27.216 34.345 1.00 21.60 ? 366 HOH A O 1 HETATM 4212 O O . HOH E 3 . ? 10.529 18.709 36.590 1.00 29.94 ? 367 HOH A O 1 HETATM 4213 O O . HOH E 3 . ? 1.701 -2.788 14.047 1.00 27.90 ? 368 HOH A O 1 HETATM 4214 O O . HOH E 3 . ? 9.646 24.517 36.176 1.00 21.95 ? 369 HOH A O 1 HETATM 4215 O O . HOH E 3 . ? 23.849 -2.576 31.950 1.00 24.09 ? 370 HOH A O 1 HETATM 4216 O O . HOH E 3 . ? 12.068 3.716 45.423 1.00 30.70 ? 371 HOH A O 1 HETATM 4217 O O . HOH E 3 . ? -2.498 -12.560 15.113 1.00 15.29 ? 372 HOH A O 1 HETATM 4218 O O . HOH E 3 . ? -11.546 2.760 34.836 1.00 22.13 ? 373 HOH A O 1 HETATM 4219 O O . HOH E 3 . ? 10.413 11.923 17.277 1.00 21.27 ? 374 HOH A O 1 HETATM 4220 O O . HOH E 3 . ? -10.062 15.265 35.913 1.00 27.20 ? 375 HOH A O 1 HETATM 4221 O O . HOH E 3 . ? -1.228 -7.312 41.917 1.00 33.65 ? 376 HOH A O 1 HETATM 4222 O O . HOH E 3 . ? 13.126 8.868 45.408 1.00 38.15 ? 377 HOH A O 1 HETATM 4223 O O . HOH E 3 . ? 15.062 -12.784 32.760 1.00 22.04 ? 378 HOH A O 1 HETATM 4224 O O . HOH E 3 . ? 8.261 -7.492 14.268 1.00 23.09 ? 379 HOH A O 1 HETATM 4225 O O . HOH E 3 . ? -4.916 6.490 40.640 1.00 22.47 ? 380 HOH A O 1 HETATM 4226 O O . HOH E 3 . ? 16.837 25.262 27.518 1.00 18.15 ? 381 HOH A O 1 HETATM 4227 O O . HOH E 3 . ? 7.646 -12.264 14.461 1.00 25.69 ? 382 HOH A O 1 HETATM 4228 O O . HOH E 3 . ? -7.793 14.612 29.548 1.00 23.18 ? 383 HOH A O 1 HETATM 4229 O O . HOH E 3 . ? 19.351 0.239 29.092 1.00 27.91 ? 384 HOH A O 1 HETATM 4230 O O . HOH E 3 . ? -14.720 -7.412 28.790 1.00 27.76 ? 385 HOH A O 1 HETATM 4231 O O . HOH E 3 . ? 22.344 14.904 32.383 1.00 41.02 ? 386 HOH A O 1 HETATM 4232 O O . HOH E 3 . ? -0.475 -5.252 40.747 1.00 22.89 ? 387 HOH A O 1 HETATM 4233 O O . HOH E 3 . ? 24.983 -3.286 29.617 1.00 37.46 ? 388 HOH A O 1 HETATM 4234 O O . HOH E 3 . ? 22.512 2.627 38.896 1.00 36.18 ? 389 HOH A O 1 HETATM 4235 O O . HOH E 3 . ? 17.470 3.055 30.237 1.00 38.53 ? 390 HOH A O 1 HETATM 4236 O O . HOH E 3 . ? 22.603 -8.527 25.877 1.00 27.96 ? 391 HOH A O 1 HETATM 4237 O O . HOH E 3 . ? 8.495 4.520 48.271 1.00 28.10 ? 392 HOH A O 1 HETATM 4238 O O . HOH E 3 . ? 2.273 -13.179 42.253 1.00 26.61 ? 393 HOH A O 1 HETATM 4239 O O . HOH E 3 . ? 5.832 -11.091 43.423 1.00 20.51 ? 394 HOH A O 1 HETATM 4240 O O . HOH E 3 . ? 17.323 11.789 21.355 1.00 38.86 ? 395 HOH A O 1 HETATM 4241 O O . HOH E 3 . ? -7.650 14.727 32.239 1.00 20.39 ? 396 HOH A O 1 HETATM 4242 O O . HOH E 3 . ? 15.245 -8.396 33.729 1.00 14.56 ? 397 HOH A O 1 HETATM 4243 O O . HOH E 3 . ? 17.019 -4.696 21.767 1.00 15.61 ? 398 HOH A O 1 HETATM 4244 O O . HOH E 3 . ? 10.155 -14.773 16.763 1.00 26.79 ? 399 HOH A O 1 HETATM 4245 O O . HOH E 3 . ? 7.069 -13.427 42.747 1.00 15.32 ? 400 HOH A O 1 HETATM 4246 O O . HOH E 3 . ? 7.468 -9.691 13.365 1.00 28.03 ? 401 HOH A O 1 HETATM 4247 O O . HOH E 3 . ? 1.423 16.655 22.588 1.00 25.98 ? 402 HOH A O 1 HETATM 4248 O O . HOH E 3 . ? 0.130 -6.623 44.920 1.00 37.92 ? 403 HOH A O 1 HETATM 4249 O O . HOH E 3 . ? 20.184 10.910 34.125 1.00 30.89 ? 404 HOH A O 1 HETATM 4250 O O . HOH E 3 . ? -12.344 -7.730 17.020 1.00 46.86 ? 405 HOH A O 1 HETATM 4251 O O . HOH E 3 . ? -1.977 -19.698 31.032 1.00 22.15 ? 406 HOH A O 1 HETATM 4252 O O . HOH E 3 . ? 7.697 5.770 15.138 1.00 36.95 ? 407 HOH A O 1 HETATM 4253 O O . HOH E 3 . ? -13.753 -15.048 42.208 1.00 42.09 ? 408 HOH A O 1 HETATM 4254 O O . HOH E 3 . ? 14.107 -12.810 38.514 1.00 28.99 ? 409 HOH A O 1 HETATM 4255 O O . HOH E 3 . ? -5.011 20.439 34.711 1.00 21.79 ? 410 HOH A O 1 HETATM 4256 O O . HOH E 3 . ? -10.668 16.417 38.478 1.00 27.08 ? 411 HOH A O 1 HETATM 4257 O O . HOH E 3 . ? -5.503 11.471 24.320 1.00 21.74 ? 412 HOH A O 1 HETATM 4258 O O . HOH E 3 . ? -6.276 -12.985 12.878 1.00 26.46 ? 413 HOH A O 1 HETATM 4259 O O . HOH E 3 . ? 17.248 -4.205 37.339 1.00 20.22 ? 414 HOH A O 1 HETATM 4260 O O . HOH E 3 . ? 8.765 23.098 38.146 1.00 22.34 ? 415 HOH A O 1 HETATM 4261 O O . HOH E 3 . ? -3.890 -0.686 16.086 1.00 23.45 ? 416 HOH A O 1 HETATM 4262 O O . HOH E 3 . ? 14.054 -12.369 34.937 1.00 28.08 ? 417 HOH A O 1 HETATM 4263 O O . HOH E 3 . ? 15.098 -20.170 28.236 1.00 24.19 ? 418 HOH A O 1 HETATM 4264 O O . HOH E 3 . ? -4.089 -21.313 22.828 1.00 17.64 ? 419 HOH A O 1 HETATM 4265 O O . HOH E 3 . ? 19.624 2.398 43.715 1.00 27.61 ? 420 HOH A O 1 HETATM 4266 O O . HOH E 3 . ? 1.803 23.542 25.685 1.00 29.49 ? 421 HOH A O 1 HETATM 4267 O O . HOH E 3 . ? 6.138 25.783 36.844 1.00 28.85 ? 422 HOH A O 1 HETATM 4268 O O . HOH E 3 . ? 4.114 15.614 23.831 1.00 22.11 ? 423 HOH A O 1 HETATM 4269 O O . HOH E 3 . ? 22.094 -12.120 15.181 1.00 59.61 ? 424 HOH A O 1 HETATM 4270 O O . HOH E 3 . ? 7.270 -26.546 23.700 1.00 25.38 ? 425 HOH A O 1 HETATM 4271 O O . HOH E 3 . ? -3.052 -9.649 12.000 1.00 22.37 ? 426 HOH A O 1 HETATM 4272 O O . HOH E 3 . ? 4.602 -14.473 43.786 1.00 29.73 ? 427 HOH A O 1 HETATM 4273 O O . HOH E 3 . ? 21.067 -5.565 17.398 1.00 31.60 ? 428 HOH A O 1 HETATM 4274 O O . HOH E 3 . ? -3.702 -12.125 12.876 1.00 21.95 ? 429 HOH A O 1 HETATM 4275 O O . HOH E 3 . ? 10.907 -1.417 16.951 1.00 26.62 ? 430 HOH A O 1 HETATM 4276 O O . HOH E 3 . ? 9.615 29.862 25.388 1.00 30.71 ? 431 HOH A O 1 HETATM 4277 O O . HOH E 3 . ? 11.036 3.118 47.574 1.00 36.98 ? 432 HOH A O 1 HETATM 4278 O O . HOH E 3 . ? -12.532 2.461 32.255 1.00 31.98 ? 433 HOH A O 1 HETATM 4279 O O . HOH E 3 . ? 20.776 -4.390 43.764 1.00 38.22 ? 434 HOH A O 1 HETATM 4280 O O . HOH E 3 . ? 17.948 7.914 40.415 1.00 34.27 ? 435 HOH A O 1 HETATM 4281 O O . HOH E 3 . ? 16.210 -9.157 38.222 1.00 34.42 ? 436 HOH A O 1 HETATM 4282 O O . HOH E 3 . ? -8.923 -1.808 10.203 1.00 42.19 ? 437 HOH A O 1 HETATM 4283 O O . HOH E 3 . ? 11.763 -4.394 13.813 1.00 32.75 ? 438 HOH A O 1 HETATM 4284 O O . HOH E 3 . ? 4.148 27.373 37.442 1.00 27.92 ? 439 HOH A O 1 HETATM 4285 O O . HOH E 3 . ? 18.783 -7.058 44.124 1.00 30.82 ? 440 HOH A O 1 HETATM 4286 O O . HOH E 3 . ? 1.033 -14.994 40.369 1.00 34.10 ? 441 HOH A O 1 HETATM 4287 O O . HOH E 3 . ? 17.852 -22.853 24.447 1.00 40.78 ? 442 HOH A O 1 HETATM 4288 O O . HOH E 3 . ? 23.914 -0.074 30.415 1.00 34.44 ? 443 HOH A O 1 HETATM 4289 O O . HOH E 3 . ? 8.191 -20.874 17.426 1.00 25.83 ? 444 HOH A O 1 HETATM 4290 O O . HOH E 3 . ? 14.156 11.879 40.049 1.00 25.29 ? 445 HOH A O 1 HETATM 4291 O O . HOH E 3 . ? 10.700 -20.294 17.814 1.00 29.96 ? 446 HOH A O 1 HETATM 4292 O O . HOH E 3 . ? 14.724 -14.551 15.901 1.00 45.79 ? 447 HOH A O 1 HETATM 4293 O O . HOH E 3 . ? 24.616 22.266 31.334 1.00 31.49 ? 448 HOH A O 1 HETATM 4294 O O . HOH E 3 . ? 25.862 23.061 29.216 1.00 32.79 ? 449 HOH A O 1 HETATM 4295 O O . HOH E 3 . ? -0.503 18.889 25.930 1.00 16.91 ? 450 HOH A O 1 HETATM 4296 O O . HOH E 3 . ? -4.110 13.981 22.068 1.00 23.03 ? 451 HOH A O 1 HETATM 4297 O O . HOH E 3 . ? 0.230 10.635 16.798 1.00 26.29 ? 452 HOH A O 1 HETATM 4298 O O . HOH E 3 . ? 0.726 13.052 16.330 1.00 23.93 ? 453 HOH A O 1 HETATM 4299 O O . HOH E 3 . ? -10.445 -3.507 39.798 1.00 36.68 ? 454 HOH A O 1 HETATM 4300 O O . HOH E 3 . ? -5.694 22.503 42.239 1.00 41.86 ? 455 HOH A O 1 HETATM 4301 O O . HOH E 3 . ? -13.423 16.348 39.409 1.00 40.45 ? 456 HOH A O 1 HETATM 4302 O O . HOH E 3 . ? -14.109 12.641 33.919 1.00 22.69 ? 457 HOH A O 1 HETATM 4303 O O . HOH E 3 . ? 8.854 -5.379 45.369 1.00 26.76 ? 458 HOH A O 1 HETATM 4304 O O . HOH E 3 . ? 9.070 24.803 40.231 1.00 37.74 ? 459 HOH A O 1 HETATM 4305 O O . HOH E 3 . ? 23.203 -4.744 26.477 1.00 37.48 ? 460 HOH A O 1 HETATM 4306 O O . HOH E 3 . ? 15.562 2.732 46.373 1.00 45.41 ? 461 HOH A O 1 HETATM 4307 O O . HOH E 3 . ? 21.943 9.174 28.680 1.00 33.11 ? 462 HOH A O 1 HETATM 4308 O O . HOH E 3 . ? -11.128 -11.243 16.846 1.00 35.49 ? 463 HOH A O 1 HETATM 4309 O O . HOH E 3 . ? -4.987 -3.554 15.746 1.00 30.03 ? 464 HOH A O 1 HETATM 4310 O O . HOH E 3 . ? 3.812 12.059 20.544 1.00 22.36 ? 465 HOH A O 1 HETATM 4311 O O . HOH E 3 . ? -12.601 -12.347 23.678 1.00 37.40 ? 466 HOH A O 1 HETATM 4312 O O . HOH E 3 . ? 10.144 -17.186 15.682 1.00 31.19 ? 467 HOH A O 1 HETATM 4313 O O . HOH E 3 . ? -3.781 14.435 24.455 1.00 37.76 ? 468 HOH A O 1 HETATM 4314 O O . HOH E 3 . ? -12.716 5.612 35.324 1.00 33.54 ? 469 HOH A O 1 HETATM 4315 O O . HOH E 3 . ? -10.193 -10.501 13.878 1.00 34.00 ? 470 HOH A O 1 HETATM 4316 O O . HOH E 3 . ? 18.744 -2.650 21.764 1.00 33.24 ? 471 HOH A O 1 HETATM 4317 O O . HOH E 3 . ? -9.202 12.603 44.093 1.00 26.83 ? 472 HOH A O 1 HETATM 4318 O O . HOH E 3 . ? -0.924 -9.767 41.919 1.00 30.41 ? 473 HOH A O 1 HETATM 4319 O O . HOH E 3 . ? 14.811 -19.619 15.444 1.00 40.95 ? 474 HOH A O 1 HETATM 4320 O O . HOH E 3 . ? 1.428 29.811 27.654 1.00 34.32 ? 475 HOH A O 1 HETATM 4321 O O . HOH E 3 . ? 5.686 -8.528 46.520 1.00 45.82 ? 476 HOH A O 1 HETATM 4322 O O . HOH E 3 . ? -0.224 -20.204 20.125 1.00 29.69 ? 477 HOH A O 1 HETATM 4323 O O . HOH E 3 . ? -12.442 -9.757 29.305 1.00 33.44 ? 478 HOH A O 1 HETATM 4324 O O . HOH E 3 . ? 17.707 12.912 41.321 1.00 48.72 ? 479 HOH A O 1 HETATM 4325 O O . HOH E 3 . ? 6.722 -27.249 26.199 1.00 36.98 ? 480 HOH A O 1 HETATM 4326 O O . HOH E 3 . ? 19.812 10.228 22.149 1.00 34.65 ? 481 HOH A O 1 HETATM 4327 O O . HOH E 3 . ? 3.223 -22.164 32.194 1.00 32.89 ? 482 HOH A O 1 HETATM 4328 O O . HOH E 3 . ? 6.328 3.152 48.931 1.00 40.14 ? 483 HOH A O 1 HETATM 4329 O O . HOH E 3 . ? -12.820 14.860 35.391 1.00 29.26 ? 484 HOH A O 1 HETATM 4330 O O . HOH E 3 . ? 23.113 3.817 31.825 1.00 43.26 ? 485 HOH A O 1 HETATM 4331 O O . HOH E 3 . ? 6.371 15.562 20.784 1.00 29.60 ? 486 HOH A O 1 HETATM 4332 O O . HOH E 3 . ? 10.922 21.432 35.766 1.00 25.61 ? 487 HOH A O 1 HETATM 4333 O O . HOH E 3 . ? 23.943 0.985 40.685 1.00 46.19 ? 488 HOH A O 1 HETATM 4334 O O . HOH E 3 . ? 17.370 6.698 42.846 1.00 33.48 ? 489 HOH A O 1 HETATM 4335 O O . HOH E 3 . ? -1.615 -14.212 41.559 1.00 34.65 ? 490 HOH A O 1 HETATM 4336 O O . HOH E 3 . ? -1.978 14.071 20.369 1.00 30.43 ? 491 HOH A O 1 HETATM 4337 O O . HOH E 3 . ? 18.567 19.880 21.115 1.00 28.95 ? 492 HOH A O 1 HETATM 4338 O O . HOH E 3 . ? -13.605 4.782 32.014 1.00 31.80 ? 493 HOH A O 1 HETATM 4339 O O . HOH E 3 . ? 5.123 -4.021 11.989 1.00 31.91 ? 494 HOH A O 1 HETATM 4340 O O . HOH E 3 . ? -0.944 -7.566 13.050 1.00 33.81 ? 495 HOH A O 1 HETATM 4341 O O . HOH E 3 . ? -5.350 18.989 32.455 1.00 29.07 ? 496 HOH A O 1 HETATM 4342 O O . HOH E 3 . ? 16.516 -19.426 30.252 1.00 35.41 ? 497 HOH A O 1 HETATM 4343 O O . HOH E 3 . ? 9.433 9.813 49.574 1.00 49.59 ? 498 HOH A O 1 HETATM 4344 O O . HOH E 3 . ? -5.456 16.452 31.661 1.00 22.39 ? 499 HOH A O 1 HETATM 4345 O O . HOH E 3 . ? -14.318 -3.421 22.848 1.00 41.00 ? 500 HOH A O 1 HETATM 4346 O O . HOH E 3 . ? -1.763 -1.081 14.626 1.00 49.26 ? 501 HOH A O 1 HETATM 4347 O O . HOH E 3 . ? -10.128 9.785 39.979 1.00 36.49 ? 502 HOH A O 1 HETATM 4348 O O . HOH E 3 . ? -2.075 -4.486 48.058 1.00 35.64 ? 503 HOH A O 1 HETATM 4349 O O . HOH E 3 . ? 0.634 7.806 45.583 1.00 32.01 ? 504 HOH A O 1 HETATM 4350 O O . HOH E 3 . ? -4.938 -25.330 20.580 1.00 31.75 ? 505 HOH A O 1 HETATM 4351 O O . HOH E 3 . ? 16.553 10.343 41.035 1.00 33.83 ? 506 HOH A O 1 HETATM 4352 O O . HOH E 3 . ? 18.087 -13.035 33.191 1.00 32.05 ? 507 HOH A O 1 HETATM 4353 O O . HOH E 3 . ? -8.354 -17.511 36.009 1.00 41.00 ? 508 HOH A O 1 HETATM 4354 O O . HOH E 3 . ? 16.009 -14.541 13.585 1.00 35.13 ? 509 HOH A O 1 HETATM 4355 O O . HOH E 3 . ? -5.304 22.326 39.769 1.00 31.38 ? 510 HOH A O 1 HETATM 4356 O O . HOH E 3 . ? 6.376 -4.090 48.952 1.00 40.62 ? 511 HOH A O 1 HETATM 4357 O O . HOH E 3 . ? -2.759 -4.996 15.901 1.00 36.38 ? 512 HOH A O 1 HETATM 4358 O O . HOH E 3 . ? 17.148 -14.844 29.104 1.00 35.56 ? 513 HOH A O 1 HETATM 4359 O O . HOH E 3 . ? -3.312 24.143 40.554 1.00 39.21 ? 514 HOH A O 1 HETATM 4360 O O . HOH E 3 . ? -6.078 -6.546 40.746 1.00 30.25 ? 515 HOH A O 1 HETATM 4361 O O . HOH E 3 . ? 19.590 -6.087 12.158 1.00 41.57 ? 516 HOH A O 1 HETATM 4362 O O . HOH E 3 . ? 19.885 -13.395 31.335 1.00 25.07 ? 517 HOH A O 1 HETATM 4363 O O . HOH E 3 . ? 21.698 22.934 32.125 1.00 10.58 ? 518 HOH A O 1 HETATM 4364 O O . HOH E 3 . ? -9.487 14.729 45.610 1.00 22.72 ? 519 HOH A O 1 HETATM 4365 O O . HOH E 3 . ? -7.684 -20.364 18.278 1.00 22.73 ? 520 HOH A O 1 HETATM 4366 O O . HOH E 3 . ? -3.337 19.372 26.054 1.00 36.86 ? 521 HOH A O 1 HETATM 4367 O O . HOH E 3 . ? -11.286 2.207 29.767 1.00 36.78 ? 522 HOH A O 1 HETATM 4368 O O . HOH E 3 . ? -5.799 -22.793 21.420 1.00 26.99 ? 523 HOH A O 1 HETATM 4369 O O . HOH E 3 . ? -5.323 -2.006 12.463 1.00 33.96 ? 524 HOH A O 1 HETATM 4370 O O . HOH E 3 . ? 25.004 -9.784 38.050 1.00 25.99 ? 525 HOH A O 1 HETATM 4371 O O . HOH E 3 . ? 3.289 11.588 44.097 1.00 28.63 ? 526 HOH A O 1 HETATM 4372 O O . HOH E 3 . ? 4.204 -17.191 17.445 1.00 29.94 ? 527 HOH A O 1 HETATM 4373 O O . HOH E 3 . ? 22.752 -1.747 38.076 1.00 33.19 ? 528 HOH A O 1 HETATM 4374 O O . HOH E 3 . ? 1.819 9.899 19.012 1.00 28.78 ? 529 HOH A O 1 HETATM 4375 O O . HOH E 3 . ? -14.572 10.188 25.096 1.00 47.52 ? 530 HOH A O 1 HETATM 4376 O O . HOH E 3 . ? -4.271 16.341 26.970 1.00 41.16 ? 531 HOH A O 1 HETATM 4377 O O . HOH E 3 . ? 16.828 14.648 35.963 1.00 35.06 ? 532 HOH A O 1 HETATM 4378 O O . HOH E 3 . ? 15.657 -10.277 35.523 1.00 40.50 ? 533 HOH A O 1 HETATM 4379 O O . HOH E 3 . ? -5.491 16.193 29.059 1.00 28.05 ? 534 HOH A O 1 HETATM 4380 O O . HOH E 3 . ? -13.116 -3.314 20.147 1.00 39.85 ? 535 HOH A O 1 HETATM 4381 O O . HOH E 3 . ? -1.632 16.479 22.536 1.00 27.80 ? 536 HOH A O 1 HETATM 4382 O O . HOH E 3 . ? -10.648 -14.094 41.236 1.00 38.44 ? 537 HOH A O 1 HETATM 4383 O O . HOH E 3 . ? 9.127 30.371 23.133 1.00 36.95 ? 538 HOH A O 1 HETATM 4384 O O . HOH E 3 . ? 13.587 3.483 20.923 1.00 46.86 ? 539 HOH A O 1 HETATM 4385 O O . HOH E 3 . ? 19.768 -13.380 35.551 1.00 32.19 ? 540 HOH A O 1 HETATM 4386 O O . HOH E 3 . ? -4.515 20.953 30.789 1.00 43.66 ? 541 HOH A O 1 HETATM 4387 O O . HOH E 3 . ? -15.304 -9.049 37.527 1.00 48.08 ? 542 HOH A O 1 HETATM 4388 O O . HOH E 3 . ? -14.401 -6.663 13.404 1.00 34.69 ? 543 HOH A O 1 HETATM 4389 O O . HOH E 3 . ? 2.442 29.682 34.462 1.00 33.27 ? 544 HOH A O 1 HETATM 4390 O O . HOH E 3 . ? -11.385 -0.062 25.666 1.00 42.42 ? 545 HOH A O 1 HETATM 4391 O O . HOH E 3 . ? -5.001 1.881 48.817 1.00 51.59 ? 546 HOH A O 1 HETATM 4392 O O . HOH E 3 . ? 18.679 -17.022 28.051 1.00 53.66 ? 547 HOH A O 1 HETATM 4393 O O . HOH E 3 . ? -6.678 -22.657 18.500 1.00 33.60 ? 548 HOH A O 1 HETATM 4394 O O . HOH E 3 . ? 17.878 13.093 43.603 1.00 49.54 ? 549 HOH A O 1 HETATM 4395 O O . HOH E 3 . ? -13.239 11.806 27.707 1.00 30.66 ? 550 HOH A O 1 HETATM 4396 O O . HOH E 3 . ? 21.878 19.202 25.450 1.00 41.64 ? 551 HOH A O 1 HETATM 4397 O O . HOH E 3 . ? -0.322 0.804 12.369 1.00 39.10 ? 552 HOH A O 1 HETATM 4398 O O . HOH E 3 . ? -13.532 -11.863 21.073 1.00 37.78 ? 553 HOH A O 1 HETATM 4399 O O . HOH E 3 . ? 1.567 -2.803 49.941 1.00 33.97 ? 554 HOH A O 1 HETATM 4400 O O . HOH E 3 . ? 6.054 30.184 26.510 1.00 51.87 ? 555 HOH A O 1 HETATM 4401 O O . HOH E 3 . ? -14.427 14.951 37.501 1.00 28.68 ? 556 HOH A O 1 HETATM 4402 O O . HOH E 3 . ? 19.788 -18.006 19.857 1.00 44.82 ? 557 HOH A O 1 HETATM 4403 O O . HOH E 3 . ? -10.368 -15.120 26.723 1.00 34.48 ? 558 HOH A O 1 HETATM 4404 O O . HOH E 3 . ? 21.663 4.712 42.970 1.00 50.31 ? 559 HOH A O 1 HETATM 4405 O O . HOH E 3 . ? 1.323 -9.493 42.310 1.00 34.92 ? 560 HOH A O 1 HETATM 4406 O O . HOH E 3 . ? 20.540 18.927 23.469 1.00 38.92 ? 561 HOH A O 1 HETATM 4407 O O . HOH E 3 . ? 20.545 21.359 21.040 1.00 44.34 ? 562 HOH A O 1 HETATM 4408 O O . HOH E 3 . ? -10.001 15.749 27.711 1.00 42.94 ? 563 HOH A O 1 HETATM 4409 O O . HOH E 3 . ? 0.987 27.371 32.187 1.00 28.42 ? 564 HOH A O 1 HETATM 4410 O O . HOH E 3 . ? -4.000 22.117 32.845 1.00 28.95 ? 565 HOH A O 1 HETATM 4411 O O . HOH E 3 . ? -17.759 -8.897 27.493 1.00 41.24 ? 566 HOH A O 1 HETATM 4412 O O . HOH E 3 . ? 9.601 -6.360 41.607 1.00 17.47 ? 567 HOH A O 1 HETATM 4413 O O . HOH E 3 . ? 20.802 -16.300 27.548 1.00 38.28 ? 568 HOH A O 1 HETATM 4414 O O . HOH E 3 . ? -12.792 -16.598 17.392 1.00 45.41 ? 569 HOH A O 1 HETATM 4415 O O . HOH E 3 . ? 18.089 21.857 33.746 1.00 33.59 ? 570 HOH A O 1 HETATM 4416 O O . HOH E 3 . ? 10.385 32.632 23.673 1.00 40.10 ? 571 HOH A O 1 HETATM 4417 O O . HOH E 3 . ? -5.647 15.520 47.865 1.00 43.38 ? 572 HOH A O 1 HETATM 4418 O O . HOH E 3 . ? 21.945 5.075 40.684 1.00 36.56 ? 573 HOH A O 1 HETATM 4419 O O . HOH E 3 . ? -3.258 -25.236 17.004 1.00 45.41 ? 574 HOH A O 1 HETATM 4420 O O . HOH E 3 . ? 17.775 1.267 45.210 1.00 33.72 ? 575 HOH A O 1 HETATM 4421 O O . HOH E 3 . ? 23.305 6.967 28.046 1.00 34.53 ? 576 HOH A O 1 HETATM 4422 O O . HOH E 3 . ? -1.439 22.132 41.321 1.00 37.26 ? 577 HOH A O 1 HETATM 4423 O O . HOH E 3 . ? 1.030 -0.031 14.523 1.00 36.30 ? 578 HOH A O 1 HETATM 4424 O O . HOH E 3 . ? -4.527 -1.991 9.574 1.00 36.60 ? 579 HOH A O 1 HETATM 4425 O O . HOH E 3 . ? 1.880 28.243 36.158 1.00 38.51 ? 580 HOH A O 1 HETATM 4426 O O . HOH E 3 . ? 27.645 -3.608 30.344 1.00 40.74 ? 581 HOH A O 1 HETATM 4427 O O . HOH E 3 . ? -0.348 31.059 29.570 1.00 42.75 ? 582 HOH A O 1 HETATM 4428 O O . HOH E 3 . ? 13.230 -22.023 28.643 1.00 31.88 ? 583 HOH A O 1 HETATM 4429 O O . HOH E 3 . ? 23.483 -8.631 17.445 1.00 39.87 ? 584 HOH A O 1 HETATM 4430 O O . HOH E 3 . ? -8.144 -10.018 40.703 1.00 47.90 ? 585 HOH A O 1 HETATM 4431 O O . HOH E 3 . ? 2.620 -7.285 50.019 1.00 58.71 ? 586 HOH A O 1 HETATM 4432 O O . HOH E 3 . ? 23.207 -11.272 30.302 1.00 38.50 ? 587 HOH A O 1 HETATM 4433 O O . HOH E 3 . ? 26.474 18.467 32.676 1.00 49.67 ? 588 HOH A O 1 HETATM 4434 O O . HOH E 3 . ? 18.760 -2.769 14.786 1.00 42.34 ? 589 HOH A O 1 HETATM 4435 O O . HOH E 3 . ? 26.105 -8.092 39.405 1.00 40.96 ? 590 HOH A O 1 HETATM 4436 O O . HOH E 3 . ? 24.640 20.070 26.787 1.00 44.88 ? 591 HOH A O 1 HETATM 4437 O O . HOH E 3 . ? -10.527 10.683 48.903 1.00 53.12 ? 592 HOH A O 1 HETATM 4438 O O . HOH E 3 . ? 12.155 3.780 49.470 1.00 43.13 ? 593 HOH A O 1 HETATM 4439 O O . HOH E 3 . ? 25.498 -2.029 33.594 1.00 49.76 ? 594 HOH A O 1 HETATM 4440 O O . HOH E 3 . ? 12.146 9.996 17.487 1.00 39.78 ? 595 HOH A O 1 HETATM 4441 O O . HOH E 3 . ? -14.121 -10.389 35.992 1.00 46.33 ? 596 HOH A O 1 HETATM 4442 O O . HOH E 3 . ? -0.363 2.163 50.317 1.00 42.14 ? 597 HOH A O 1 HETATM 4443 O O . HOH E 3 . ? -1.498 -3.665 6.620 1.00 34.25 ? 598 HOH A O 1 HETATM 4444 O O . HOH E 3 . ? 10.009 3.290 16.510 1.00 45.07 ? 599 HOH A O 1 HETATM 4445 O O . HOH E 3 . ? -7.352 18.003 46.057 1.00 45.11 ? 600 HOH A O 1 HETATM 4446 O O . HOH E 3 . ? 22.401 10.253 31.019 1.00 36.90 ? 601 HOH A O 1 HETATM 4447 O O . HOH E 3 . ? 8.952 11.371 47.667 1.00 45.10 ? 602 HOH A O 1 HETATM 4448 O O . HOH E 3 . ? 25.182 -1.968 42.914 1.00 36.95 ? 603 HOH A O 1 HETATM 4449 O O . HOH E 3 . ? 17.416 -2.952 46.641 1.00 41.61 ? 604 HOH A O 1 HETATM 4450 O O . HOH E 3 . ? 17.830 -21.069 26.944 1.00 53.82 ? 605 HOH A O 1 HETATM 4451 O O . HOH E 3 . ? -9.893 11.961 24.310 1.00 51.80 ? 606 HOH A O 1 HETATM 4452 O O . HOH E 3 . ? -17.042 -5.370 19.269 1.00 40.07 ? 607 HOH A O 1 HETATM 4453 O O . HOH E 3 . ? -6.120 19.086 28.060 1.00 46.28 ? 608 HOH A O 1 HETATM 4454 O O . HOH E 3 . ? 10.802 14.325 47.811 1.00 56.31 ? 609 HOH A O 1 HETATM 4455 O O . HOH E 3 . ? 13.058 -5.904 9.765 1.00 42.09 ? 610 HOH A O 1 HETATM 4456 O O . HOH E 3 . ? 2.173 16.585 46.288 1.00 79.38 ? 611 HOH A O 1 HETATM 4457 O O . HOH E 3 . ? 24.925 7.217 30.451 1.00 47.65 ? 612 HOH A O 1 HETATM 4458 O O . HOH E 3 . ? 8.811 -4.532 11.066 1.00 48.62 ? 613 HOH A O 1 HETATM 4459 O O . HOH E 3 . ? 22.840 -6.660 19.242 1.00 45.28 ? 614 HOH A O 1 HETATM 4460 O O . HOH E 3 . ? 4.910 -19.432 17.741 1.00 46.49 ? 615 HOH A O 1 HETATM 4461 O O . HOH E 3 . ? -9.936 9.414 42.378 1.00 48.84 ? 616 HOH A O 1 HETATM 4462 O O . HOH E 3 . ? -10.787 17.943 31.558 1.00 45.29 ? 617 HOH A O 1 HETATM 4463 O O . HOH E 3 . ? -1.926 -11.154 44.279 1.00 45.28 ? 618 HOH A O 1 HETATM 4464 O O . HOH E 3 . ? -13.692 -4.723 11.493 1.00 45.11 ? 619 HOH A O 1 HETATM 4465 O O . HOH E 3 . ? -14.700 -21.569 23.332 1.00 54.53 ? 620 HOH A O 1 HETATM 4466 O O . HOH E 3 . ? 21.128 -3.695 20.617 1.00 65.05 ? 621 HOH A O 1 HETATM 4467 O O . HOH E 3 . ? 14.992 -2.086 20.001 1.00 56.98 ? 622 HOH A O 1 HETATM 4468 O O . HOH E 3 . ? 8.345 -18.602 15.578 1.00 43.55 ? 623 HOH A O 1 HETATM 4469 O O . HOH E 3 . ? 6.336 -16.625 15.647 1.00 35.15 ? 624 HOH A O 1 HETATM 4470 O O . HOH E 3 . ? 16.311 2.449 20.266 1.00 66.26 ? 625 HOH A O 1 HETATM 4471 O O . HOH E 3 . ? 8.664 -11.073 10.798 1.00 60.99 ? 626 HOH A O 1 HETATM 4472 O O . HOH E 3 . ? -7.447 13.347 25.126 1.00 37.18 ? 627 HOH A O 1 HETATM 4473 O O . HOH E 3 . ? -16.998 -5.555 16.470 1.00 41.49 ? 628 HOH A O 1 HETATM 4474 O O . HOH E 3 . ? 1.318 -19.228 17.317 1.00 53.10 ? 629 HOH A O 1 HETATM 4475 O O . HOH E 3 . ? -14.324 -0.719 33.263 1.00 52.92 ? 630 HOH A O 1 HETATM 4476 O O . HOH E 3 . ? 2.872 17.122 40.595 1.00 42.97 ? 631 HOH A O 1 HETATM 4477 O O . HOH E 3 . ? 25.441 -0.831 35.552 1.00 41.89 ? 632 HOH A O 1 HETATM 4478 O O . HOH E 3 . ? -12.756 -11.803 30.301 1.00 58.81 ? 633 HOH A O 1 HETATM 4479 O O . HOH E 3 . ? 12.320 15.914 42.778 1.00 43.30 ? 634 HOH A O 1 HETATM 4480 O O . HOH E 3 . ? 1.499 0.812 51.659 1.00 53.85 ? 635 HOH A O 1 HETATM 4481 O O . HOH E 3 . ? 0.967 -6.794 42.796 1.00 39.66 ? 636 HOH A O 1 HETATM 4482 O O . HOH E 3 . ? 5.721 25.107 41.350 1.00 55.23 ? 637 HOH A O 1 HETATM 4483 O O . HOH E 3 . ? -1.220 9.337 44.851 1.00 43.63 ? 638 HOH A O 1 HETATM 4484 O O . HOH E 3 . ? -10.552 -1.656 41.266 1.00 43.27 ? 639 HOH A O 1 HETATM 4485 O O . HOH E 3 . ? 11.203 -6.688 13.828 1.00 34.20 ? 640 HOH A O 1 HETATM 4486 O O . HOH E 3 . ? 2.999 19.233 41.617 1.00 61.70 ? 641 HOH A O 1 HETATM 4487 O O . HOH E 3 . ? -12.361 -5.210 18.067 1.00 32.35 ? 642 HOH A O 1 HETATM 4488 O O . HOH E 3 . ? 8.501 -0.800 12.774 1.00 42.73 ? 643 HOH A O 1 HETATM 4489 O O . HOH E 3 . ? 0.575 29.556 37.670 1.00 51.22 ? 644 HOH A O 1 HETATM 4490 O O . HOH E 3 . ? 8.756 5.476 50.737 1.00 40.14 ? 645 HOH A O 1 HETATM 4491 O O . HOH E 3 . ? 13.300 5.174 26.113 1.00 39.51 ? 646 HOH A O 1 HETATM 4492 O O . HOH E 3 . ? -0.671 -27.122 19.815 1.00 52.82 ? 647 HOH A O 1 HETATM 4493 O O . HOH E 3 . ? -11.203 4.728 28.513 1.00 35.24 ? 648 HOH A O 1 HETATM 4494 O O . HOH E 3 . ? -12.705 -0.313 43.803 1.00 44.27 ? 649 HOH A O 1 HETATM 4495 O O . HOH E 3 . ? 5.833 2.182 12.026 1.00 54.10 ? 650 HOH A O 1 HETATM 4496 O O . HOH E 3 . ? -15.561 12.334 37.932 1.00 52.90 ? 651 HOH A O 1 HETATM 4497 O O . HOH E 3 . ? -17.731 -9.336 21.727 1.00 46.55 ? 652 HOH A O 1 HETATM 4498 O O . HOH E 3 . ? -9.253 -4.159 10.727 1.00 52.51 ? 653 HOH A O 1 HETATM 4499 O O . HOH E 3 . ? 3.924 16.615 37.683 1.00 54.76 ? 654 HOH A O 1 HETATM 4500 O O . HOH E 3 . ? -12.658 0.475 28.717 1.00 53.29 ? 655 HOH A O 1 HETATM 4501 O O . HOH E 3 . ? -17.093 -5.287 33.402 1.00 58.58 ? 656 HOH A O 1 HETATM 4502 O O . HOH E 3 . ? 17.816 -21.136 17.726 1.00 52.30 ? 657 HOH A O 1 HETATM 4503 O O . HOH E 3 . ? 20.337 7.415 39.489 1.00 52.12 ? 658 HOH A O 1 HETATM 4504 O O . HOH F 3 . ? 2.042 16.491 -0.022 1.00 49.74 ? 301 HOH B O 1 HETATM 4505 O O . HOH F 3 . ? 5.336 16.190 1.900 0.65 34.14 ? 302 HOH B O 1 HETATM 4506 O O . HOH F 3 . ? 1.683 38.845 7.569 1.00 13.51 ? 303 HOH B O 1 HETATM 4507 O O . HOH F 3 . ? -6.957 1.826 16.933 1.00 10.05 ? 304 HOH B O 1 HETATM 4508 O O . HOH F 3 . ? 15.986 35.908 20.978 1.00 24.40 ? 305 HOH B O 1 HETATM 4509 O O . HOH F 3 . ? -0.276 36.101 2.294 1.00 20.36 ? 306 HOH B O 1 HETATM 4510 O O . HOH F 3 . ? 11.756 18.508 13.560 1.00 15.07 ? 307 HOH B O 1 HETATM 4511 O O . HOH F 3 . ? -10.243 14.233 1.893 1.00 21.78 ? 308 HOH B O 1 HETATM 4512 O O . HOH F 3 . ? 13.441 22.231 10.109 1.00 11.36 ? 309 HOH B O 1 HETATM 4513 O O . HOH F 3 . ? 5.512 17.328 9.698 1.00 13.82 ? 310 HOH B O 1 HETATM 4514 O O . HOH F 3 . ? 5.706 31.303 -11.022 1.00 16.36 ? 311 HOH B O 1 HETATM 4515 O O . HOH F 3 . ? -4.673 11.281 21.689 1.00 16.33 ? 312 HOH B O 1 HETATM 4516 O O . HOH F 3 . ? -7.229 9.390 3.119 1.00 18.91 ? 313 HOH B O 1 HETATM 4517 O O . HOH F 3 . ? 12.722 25.371 18.837 1.00 11.09 ? 314 HOH B O 1 HETATM 4518 O O . HOH F 3 . ? 14.228 16.325 8.341 1.00 16.84 ? 315 HOH B O 1 HETATM 4519 O O . HOH F 3 . ? 1.194 21.683 -8.603 1.00 15.89 ? 316 HOH B O 1 HETATM 4520 O O . HOH F 3 . ? 1.568 20.976 -3.613 1.00 15.53 ? 317 HOH B O 1 HETATM 4521 O O . HOH F 3 . ? -2.859 34.396 15.941 1.00 10.96 ? 318 HOH B O 1 HETATM 4522 O O . HOH F 3 . ? 14.687 20.077 -3.505 1.00 16.03 ? 319 HOH B O 1 HETATM 4523 O O . HOH F 3 . ? 0.583 19.361 -10.018 1.00 18.77 ? 320 HOH B O 1 HETATM 4524 O O . HOH F 3 . ? -13.271 5.870 5.556 1.00 23.13 ? 321 HOH B O 1 HETATM 4525 O O . HOH F 3 . ? -2.403 27.069 24.605 1.00 23.66 ? 322 HOH B O 1 HETATM 4526 O O . HOH F 3 . ? -7.563 26.220 21.253 1.00 19.92 ? 323 HOH B O 1 HETATM 4527 O O . HOH F 3 . ? 14.213 14.941 0.698 1.00 19.86 ? 324 HOH B O 1 HETATM 4528 O O . HOH F 3 . ? 17.770 25.099 15.045 1.00 21.84 ? 325 HOH B O 1 HETATM 4529 O O . HOH F 3 . ? 22.710 31.128 -13.295 1.00 41.34 ? 326 HOH B O 1 HETATM 4530 O O . HOH F 3 . ? 11.619 15.872 -3.370 1.00 18.11 ? 327 HOH B O 1 HETATM 4531 O O . HOH F 3 . ? 5.151 7.919 14.119 1.00 14.54 ? 328 HOH B O 1 HETATM 4532 O O . HOH F 3 . ? 20.526 17.740 6.406 1.00 21.22 ? 329 HOH B O 1 HETATM 4533 O O . HOH F 3 . ? 11.374 40.910 13.433 1.00 19.65 ? 330 HOH B O 1 HETATM 4534 O O . HOH F 3 . ? 6.878 28.072 23.246 1.00 18.79 ? 331 HOH B O 1 HETATM 4535 O O . HOH F 3 . ? 10.716 15.697 6.335 1.00 20.70 ? 332 HOH B O 1 HETATM 4536 O O . HOH F 3 . ? 23.730 21.820 0.300 1.00 23.54 ? 333 HOH B O 1 HETATM 4537 O O . HOH F 3 . ? 5.395 44.547 0.341 1.00 19.07 ? 334 HOH B O 1 HETATM 4538 O O . HOH F 3 . ? 14.751 14.310 6.546 1.00 23.93 ? 335 HOH B O 1 HETATM 4539 O O . HOH F 3 . ? -1.274 36.515 16.694 1.00 21.78 ? 336 HOH B O 1 HETATM 4540 O O . HOH F 3 . ? -0.417 41.631 10.792 1.00 26.39 ? 337 HOH B O 1 HETATM 4541 O O . HOH F 3 . ? 13.055 14.107 -1.728 1.00 17.95 ? 338 HOH B O 1 HETATM 4542 O O . HOH F 3 . ? 12.786 37.768 -4.470 1.00 21.33 ? 339 HOH B O 1 HETATM 4543 O O . HOH F 3 . ? 17.787 37.519 -3.164 1.00 17.39 ? 340 HOH B O 1 HETATM 4544 O O . HOH F 3 . ? 22.873 19.071 6.221 1.00 24.27 ? 341 HOH B O 1 HETATM 4545 O O . HOH F 3 . ? -18.471 32.682 17.088 1.00 27.29 ? 342 HOH B O 1 HETATM 4546 O O . HOH F 3 . ? 25.587 33.375 3.208 1.00 19.65 ? 343 HOH B O 1 HETATM 4547 O O . HOH F 3 . ? -15.482 17.587 2.362 1.00 27.17 ? 344 HOH B O 1 HETATM 4548 O O . HOH F 3 . ? -2.329 38.176 -0.879 1.00 29.64 ? 345 HOH B O 1 HETATM 4549 O O . HOH F 3 . ? 26.484 25.654 -4.098 1.00 28.69 ? 346 HOH B O 1 HETATM 4550 O O . HOH F 3 . ? 23.910 20.976 4.463 1.00 22.89 ? 347 HOH B O 1 HETATM 4551 O O . HOH F 3 . ? 9.217 12.339 -8.518 1.00 26.93 ? 348 HOH B O 1 HETATM 4552 O O . HOH F 3 . ? 1.636 3.223 11.881 1.00 19.53 ? 349 HOH B O 1 HETATM 4553 O O . HOH F 3 . ? 19.375 25.315 23.615 1.00 30.12 ? 350 HOH B O 1 HETATM 4554 O O . HOH F 3 . ? -8.443 15.061 21.202 1.00 19.21 ? 351 HOH B O 1 HETATM 4555 O O . HOH F 3 . ? 10.241 36.431 -7.730 1.00 16.92 ? 352 HOH B O 1 HETATM 4556 O O . HOH F 3 . ? 6.881 23.526 -7.621 1.00 16.63 ? 353 HOH B O 1 HETATM 4557 O O . HOH F 3 . ? -4.552 14.812 -9.871 1.00 34.79 ? 354 HOH B O 1 HETATM 4558 O O . HOH F 3 . ? -7.163 35.780 22.379 1.00 25.21 ? 355 HOH B O 1 HETATM 4559 O O . HOH F 3 . ? 0.803 36.098 18.612 1.00 22.09 ? 356 HOH B O 1 HETATM 4560 O O . HOH F 3 . ? 3.406 25.729 26.962 1.00 19.77 ? 357 HOH B O 1 HETATM 4561 O O . HOH F 3 . ? -8.104 32.886 11.268 1.00 21.92 ? 358 HOH B O 1 HETATM 4562 O O . HOH F 3 . ? -17.909 13.307 18.285 1.00 26.67 ? 359 HOH B O 1 HETATM 4563 O O . HOH F 3 . ? 4.295 13.748 -10.403 1.00 25.48 ? 360 HOH B O 1 HETATM 4564 O O . HOH F 3 . ? -1.253 6.889 -1.153 1.00 30.88 ? 361 HOH B O 1 HETATM 4565 O O . HOH F 3 . ? 10.879 14.309 -5.622 1.00 22.69 ? 362 HOH B O 1 HETATM 4566 O O . HOH F 3 . ? -17.884 16.682 6.375 1.00 24.48 ? 363 HOH B O 1 HETATM 4567 O O . HOH F 3 . ? 18.820 39.543 -1.566 1.00 19.24 ? 364 HOH B O 1 HETATM 4568 O O . HOH F 3 . ? -15.521 4.007 12.223 1.00 21.32 ? 365 HOH B O 1 HETATM 4569 O O . HOH F 3 . ? 18.399 19.269 -9.117 1.00 22.88 ? 366 HOH B O 1 HETATM 4570 O O . HOH F 3 . ? -13.866 16.546 0.854 1.00 31.81 ? 367 HOH B O 1 HETATM 4571 O O . HOH F 3 . ? 1.711 19.705 -6.677 1.00 18.13 ? 368 HOH B O 1 HETATM 4572 O O . HOH F 3 . ? 22.656 19.472 -1.316 1.00 24.20 ? 369 HOH B O 1 HETATM 4573 O O . HOH F 3 . ? 3.635 22.307 -9.910 1.00 20.08 ? 370 HOH B O 1 HETATM 4574 O O . HOH F 3 . ? -13.200 21.292 -2.343 1.00 34.71 ? 371 HOH B O 1 HETATM 4575 O O . HOH F 3 . ? 7.996 23.006 -3.886 1.00 16.69 ? 372 HOH B O 1 HETATM 4576 O O . HOH F 3 . ? 8.805 22.168 -6.318 1.00 18.68 ? 373 HOH B O 1 HETATM 4577 O O . HOH F 3 . ? -16.201 23.010 -0.491 1.00 25.49 ? 374 HOH B O 1 HETATM 4578 O O . HOH F 3 . ? -5.382 0.181 13.935 1.00 13.50 ? 375 HOH B O 1 HETATM 4579 O O . HOH F 3 . ? 21.443 23.482 13.934 1.00 21.80 ? 376 HOH B O 1 HETATM 4580 O O . HOH F 3 . ? -0.783 16.551 -11.566 1.00 24.60 ? 377 HOH B O 1 HETATM 4581 O O . HOH F 3 . ? 13.041 14.951 11.654 1.00 15.59 ? 378 HOH B O 1 HETATM 4582 O O . HOH F 3 . ? 0.677 40.529 5.649 1.00 26.75 ? 379 HOH B O 1 HETATM 4583 O O . HOH F 3 . ? 18.879 26.657 -11.272 1.00 31.02 ? 380 HOH B O 1 HETATM 4584 O O . HOH F 3 . ? -4.432 20.202 21.690 1.00 30.88 ? 381 HOH B O 1 HETATM 4585 O O . HOH F 3 . ? -11.858 -2.470 14.838 1.00 17.81 ? 382 HOH B O 1 HETATM 4586 O O . HOH F 3 . ? 15.341 32.465 22.845 1.00 18.39 ? 383 HOH B O 1 HETATM 4587 O O . HOH F 3 . ? 16.444 40.009 -0.102 1.00 28.20 ? 384 HOH B O 1 HETATM 4588 O O . HOH F 3 . ? 18.779 9.815 -0.636 1.00 28.50 ? 385 HOH B O 1 HETATM 4589 O O . HOH F 3 . ? -6.161 9.684 -1.675 1.00 33.24 ? 386 HOH B O 1 HETATM 4590 O O . HOH F 3 . ? 23.339 14.693 4.922 1.00 25.92 ? 387 HOH B O 1 HETATM 4591 O O . HOH F 3 . ? -12.111 1.741 11.352 1.00 19.87 ? 388 HOH B O 1 HETATM 4592 O O . HOH F 3 . ? 12.689 14.571 -10.051 1.00 27.60 ? 389 HOH B O 1 HETATM 4593 O O . HOH F 3 . ? 12.801 33.593 22.655 1.00 31.18 ? 390 HOH B O 1 HETATM 4594 O O . HOH F 3 . ? 18.767 13.524 5.445 1.00 29.67 ? 391 HOH B O 1 HETATM 4595 O O . HOH F 3 . ? -0.886 23.378 23.872 1.00 40.18 ? 392 HOH B O 1 HETATM 4596 O O . HOH F 3 . ? -15.362 25.854 0.095 1.00 31.53 ? 393 HOH B O 1 HETATM 4597 O O . HOH F 3 . ? -7.296 32.514 24.076 1.00 26.42 ? 394 HOH B O 1 HETATM 4598 O O . HOH F 3 . ? -2.202 13.073 17.087 1.00 33.37 ? 395 HOH B O 1 HETATM 4599 O O . HOH F 3 . ? 25.895 33.805 -7.295 1.00 26.86 ? 396 HOH B O 1 HETATM 4600 O O . HOH F 3 . ? 18.108 19.687 13.902 1.00 28.10 ? 397 HOH B O 1 HETATM 4601 O O . HOH F 3 . ? 16.252 29.908 23.453 1.00 15.73 ? 398 HOH B O 1 HETATM 4602 O O . HOH F 3 . ? -10.648 29.299 21.345 1.00 35.30 ? 399 HOH B O 1 HETATM 4603 O O . HOH F 3 . ? -3.954 31.899 -6.855 1.00 37.04 ? 400 HOH B O 1 HETATM 4604 O O . HOH F 3 . ? 16.960 38.228 -5.742 1.00 26.70 ? 401 HOH B O 1 HETATM 4605 O O . HOH F 3 . ? -13.800 13.410 8.177 1.00 19.63 ? 402 HOH B O 1 HETATM 4606 O O . HOH F 3 . ? 20.461 32.783 23.390 1.00 33.45 ? 403 HOH B O 1 HETATM 4607 O O . HOH F 3 . ? 10.562 19.636 -11.189 1.00 24.02 ? 404 HOH B O 1 HETATM 4608 O O . HOH F 3 . ? -14.941 5.050 16.736 1.00 21.54 ? 405 HOH B O 1 HETATM 4609 O O . HOH F 3 . ? -13.093 22.477 21.243 1.00 29.94 ? 406 HOH B O 1 HETATM 4610 O O . HOH F 3 . ? 8.630 16.132 19.183 1.00 15.91 ? 407 HOH B O 1 HETATM 4611 O O . HOH F 3 . ? -5.577 25.032 22.502 1.00 19.72 ? 408 HOH B O 1 HETATM 4612 O O . HOH F 3 . ? -13.546 12.428 21.699 1.00 24.03 ? 409 HOH B O 1 HETATM 4613 O O . HOH F 3 . ? -0.183 33.081 21.998 1.00 30.50 ? 410 HOH B O 1 HETATM 4614 O O . HOH F 3 . ? 11.382 11.875 14.055 1.00 25.13 ? 411 HOH B O 1 HETATM 4615 O O . HOH F 3 . ? 7.797 20.625 -11.262 1.00 27.50 ? 412 HOH B O 1 HETATM 4616 O O . HOH F 3 . ? -7.461 37.631 0.250 1.00 38.93 ? 413 HOH B O 1 HETATM 4617 O O . HOH F 3 . ? -1.869 19.552 21.806 1.00 35.40 ? 414 HOH B O 1 HETATM 4618 O O . HOH F 3 . ? -13.015 1.806 4.410 1.00 29.43 ? 415 HOH B O 1 HETATM 4619 O O . HOH F 3 . ? 6.197 24.715 -12.439 1.00 23.41 ? 416 HOH B O 1 HETATM 4620 O O . HOH F 3 . ? 18.416 23.761 21.616 1.00 18.22 ? 417 HOH B O 1 HETATM 4621 O O . HOH F 3 . ? 5.445 15.308 -13.728 1.00 31.83 ? 418 HOH B O 1 HETATM 4622 O O . HOH F 3 . ? -15.228 25.166 19.521 1.00 20.30 ? 419 HOH B O 1 HETATM 4623 O O . HOH F 3 . ? -2.890 32.245 -11.534 1.00 34.23 ? 420 HOH B O 1 HETATM 4624 O O . HOH F 3 . ? 12.262 21.582 -12.199 1.00 37.07 ? 421 HOH B O 1 HETATM 4625 O O . HOH F 3 . ? 11.011 17.774 -13.109 1.00 35.46 ? 422 HOH B O 1 HETATM 4626 O O . HOH F 3 . ? -9.078 16.173 -4.242 1.00 30.64 ? 423 HOH B O 1 HETATM 4627 O O . HOH F 3 . ? 19.118 25.938 26.101 1.00 23.07 ? 424 HOH B O 1 HETATM 4628 O O . HOH F 3 . ? -3.076 41.433 11.474 1.00 25.38 ? 425 HOH B O 1 HETATM 4629 O O . HOH F 3 . ? 17.821 39.017 -9.749 1.00 54.69 ? 426 HOH B O 1 HETATM 4630 O O . HOH F 3 . ? 16.421 33.295 20.381 1.00 19.98 ? 427 HOH B O 1 HETATM 4631 O O . HOH F 3 . ? 24.147 35.809 -8.197 1.00 23.81 ? 428 HOH B O 1 HETATM 4632 O O . HOH F 3 . ? 3.149 33.095 18.243 1.00 34.33 ? 429 HOH B O 1 HETATM 4633 O O . HOH F 3 . ? -15.923 29.406 -1.575 1.00 27.06 ? 430 HOH B O 1 HETATM 4634 O O . HOH F 3 . ? -4.064 17.043 19.540 1.00 20.11 ? 431 HOH B O 1 HETATM 4635 O O . HOH F 3 . ? 7.101 29.164 -10.852 1.00 20.58 ? 432 HOH B O 1 HETATM 4636 O O . HOH F 3 . ? -3.574 30.424 -9.426 1.00 27.32 ? 433 HOH B O 1 HETATM 4637 O O . HOH F 3 . ? -17.164 11.208 11.274 1.00 28.49 ? 434 HOH B O 1 HETATM 4638 O O . HOH F 3 . ? -8.347 12.418 22.202 1.00 33.80 ? 435 HOH B O 1 HETATM 4639 O O . HOH F 3 . ? 7.538 44.680 3.134 1.00 28.88 ? 436 HOH B O 1 HETATM 4640 O O . HOH F 3 . ? 22.576 32.050 -11.192 1.00 39.29 ? 437 HOH B O 1 HETATM 4641 O O . HOH F 3 . ? -6.395 0.112 3.346 1.00 19.59 ? 438 HOH B O 1 HETATM 4642 O O . HOH F 3 . ? -7.972 14.904 -5.823 1.00 39.81 ? 439 HOH B O 1 HETATM 4643 O O . HOH F 3 . ? 19.576 35.096 19.812 1.00 41.85 ? 440 HOH B O 1 HETATM 4644 O O . HOH F 3 . ? -11.597 -2.382 11.947 1.00 31.07 ? 441 HOH B O 1 HETATM 4645 O O . HOH F 3 . ? 5.516 32.107 17.121 1.00 31.99 ? 442 HOH B O 1 HETATM 4646 O O . HOH F 3 . ? 4.045 18.718 20.850 1.00 27.01 ? 443 HOH B O 1 HETATM 4647 O O . HOH F 3 . ? 11.352 37.043 20.490 1.00 33.84 ? 444 HOH B O 1 HETATM 4648 O O . HOH F 3 . ? -15.264 29.536 11.679 1.00 30.71 ? 445 HOH B O 1 HETATM 4649 O O . HOH F 3 . ? 10.201 42.730 14.876 1.00 32.87 ? 446 HOH B O 1 HETATM 4650 O O . HOH F 3 . ? -16.058 2.713 16.314 1.00 46.68 ? 447 HOH B O 1 HETATM 4651 O O . HOH F 3 . ? -5.936 38.952 12.086 1.00 39.51 ? 448 HOH B O 1 HETATM 4652 O O . HOH F 3 . ? -9.575 25.781 -4.382 1.00 34.03 ? 449 HOH B O 1 HETATM 4653 O O . HOH F 3 . ? 2.929 26.633 -10.781 1.00 27.31 ? 450 HOH B O 1 HETATM 4654 O O . HOH F 3 . ? 6.136 12.783 -11.392 1.00 39.69 ? 451 HOH B O 1 HETATM 4655 O O . HOH F 3 . ? -10.979 22.339 -5.973 1.00 41.59 ? 452 HOH B O 1 HETATM 4656 O O . HOH F 3 . ? 16.187 9.943 -3.421 1.00 35.90 ? 453 HOH B O 1 HETATM 4657 O O . HOH F 3 . ? 11.145 45.695 3.955 1.00 34.57 ? 454 HOH B O 1 HETATM 4658 O O . HOH F 3 . ? -8.338 26.452 -6.760 1.00 28.09 ? 455 HOH B O 1 HETATM 4659 O O . HOH F 3 . ? -14.793 21.579 -4.917 1.00 31.01 ? 456 HOH B O 1 HETATM 4660 O O . HOH F 3 . ? -16.431 24.683 4.342 1.00 32.42 ? 457 HOH B O 1 HETATM 4661 O O . HOH F 3 . ? 0.357 43.394 9.042 1.00 26.06 ? 458 HOH B O 1 HETATM 4662 O O . HOH F 3 . ? 5.144 24.786 -10.084 1.00 36.49 ? 459 HOH B O 1 HETATM 4663 O O . HOH F 3 . ? 0.405 22.377 21.620 1.00 19.90 ? 460 HOH B O 1 HETATM 4664 O O . HOH F 3 . ? 20.659 31.106 -10.059 1.00 36.37 ? 461 HOH B O 1 HETATM 4665 O O . HOH F 3 . ? 13.000 30.257 -13.308 1.00 43.26 ? 462 HOH B O 1 HETATM 4666 O O . HOH F 3 . ? 25.904 13.930 -2.023 1.00 40.75 ? 463 HOH B O 1 HETATM 4667 O O . HOH F 3 . ? 9.686 40.611 17.180 1.00 27.95 ? 464 HOH B O 1 HETATM 4668 O O . HOH F 3 . ? 17.264 39.516 15.065 1.00 27.14 ? 465 HOH B O 1 HETATM 4669 O O . HOH F 3 . ? 27.283 27.323 -2.108 1.00 24.46 ? 466 HOH B O 1 HETATM 4670 O O . HOH F 3 . ? 1.055 39.421 10.188 1.00 14.82 ? 467 HOH B O 1 HETATM 4671 O O . HOH F 3 . ? 24.000 37.868 4.319 1.00 16.82 ? 468 HOH B O 1 HETATM 4672 O O . HOH F 3 . ? 15.757 13.611 16.948 1.00 32.41 ? 469 HOH B O 1 HETATM 4673 O O . HOH F 3 . ? -11.037 16.323 0.411 1.00 23.07 ? 470 HOH B O 1 HETATM 4674 O O . HOH F 3 . ? -11.335 16.021 -2.188 1.00 27.18 ? 471 HOH B O 1 HETATM 4675 O O . HOH F 3 . ? 0.320 19.042 23.309 1.00 15.78 ? 472 HOH B O 1 HETATM 4676 O O . HOH F 3 . ? -5.823 15.988 21.252 1.00 17.65 ? 473 HOH B O 1 HETATM 4677 O O . HOH F 3 . ? 14.932 23.979 18.521 1.00 24.59 ? 474 HOH B O 1 HETATM 4678 O O . HOH F 3 . ? 12.811 13.257 10.122 1.00 44.12 ? 475 HOH B O 1 HETATM 4679 O O . HOH F 3 . ? -1.834 29.467 26.310 1.00 42.21 ? 476 HOH B O 1 HETATM 4680 O O . HOH F 3 . ? -9.775 27.215 22.627 1.00 37.25 ? 477 HOH B O 1 HETATM 4681 O O . HOH F 3 . ? 6.252 8.922 12.004 1.00 29.77 ? 478 HOH B O 1 HETATM 4682 O O . HOH F 3 . ? -4.583 -1.267 4.849 1.00 26.61 ? 479 HOH B O 1 HETATM 4683 O O . HOH F 3 . ? 18.224 36.240 22.612 1.00 31.82 ? 480 HOH B O 1 HETATM 4684 O O . HOH F 3 . ? 3.251 36.512 -4.395 1.00 16.78 ? 481 HOH B O 1 HETATM 4685 O O . HOH F 3 . ? -12.943 27.998 5.072 1.00 31.80 ? 482 HOH B O 1 HETATM 4686 O O . HOH F 3 . ? 11.439 28.096 10.584 1.00 36.28 ? 483 HOH B O 1 HETATM 4687 O O . HOH F 3 . ? 1.509 37.728 -2.380 1.00 26.77 ? 484 HOH B O 1 HETATM 4688 O O . HOH F 3 . ? -12.836 34.097 2.417 1.00 22.46 ? 485 HOH B O 1 HETATM 4689 O O . HOH F 3 . ? 1.989 4.978 6.987 1.00 35.31 ? 486 HOH B O 1 HETATM 4690 O O . HOH F 3 . ? 25.164 27.194 3.377 1.00 29.15 ? 487 HOH B O 1 HETATM 4691 O O . HOH F 3 . ? -13.422 19.784 22.295 1.00 33.09 ? 488 HOH B O 1 HETATM 4692 O O . HOH F 3 . ? 2.106 32.006 20.620 1.00 25.15 ? 489 HOH B O 1 HETATM 4693 O O . HOH F 3 . ? 9.932 25.090 -9.185 1.00 32.93 ? 490 HOH B O 1 HETATM 4694 O O . HOH F 3 . ? 15.191 36.375 -6.830 1.00 25.65 ? 491 HOH B O 1 HETATM 4695 O O . HOH F 3 . ? -12.594 28.211 -2.456 1.00 28.82 ? 492 HOH B O 1 HETATM 4696 O O . HOH F 3 . ? 27.212 43.297 11.053 1.00 46.81 ? 493 HOH B O 1 HETATM 4697 O O . HOH F 3 . ? -3.746 36.104 19.093 1.00 33.03 ? 494 HOH B O 1 HETATM 4698 O O . HOH F 3 . ? 17.086 40.995 10.812 1.00 31.96 ? 495 HOH B O 1 HETATM 4699 O O . HOH F 3 . ? 16.168 34.434 -9.280 1.00 35.94 ? 496 HOH B O 1 HETATM 4700 O O . HOH F 3 . ? 22.745 10.996 -2.172 1.00 37.10 ? 497 HOH B O 1 HETATM 4701 O O . HOH F 3 . ? -13.667 0.165 17.168 1.00 27.30 ? 498 HOH B O 1 HETATM 4702 O O . HOH F 3 . ? 9.025 27.857 -14.129 1.00 28.12 ? 499 HOH B O 1 HETATM 4703 O O . HOH F 3 . ? 19.089 28.391 24.424 1.00 23.36 ? 500 HOH B O 1 HETATM 4704 O O . HOH F 3 . ? 2.047 39.236 -0.214 1.00 28.74 ? 501 HOH B O 1 HETATM 4705 O O . HOH F 3 . ? -8.428 23.442 20.925 1.00 24.96 ? 502 HOH B O 1 HETATM 4706 O O . HOH F 3 . ? -15.654 22.610 10.304 1.00 35.06 ? 503 HOH B O 1 HETATM 4707 O O . HOH F 3 . ? 18.773 41.892 -3.186 1.00 33.02 ? 504 HOH B O 1 HETATM 4708 O O . HOH F 3 . ? 10.834 25.804 -13.772 1.00 28.57 ? 505 HOH B O 1 HETATM 4709 O O . HOH F 3 . ? 3.888 13.255 3.739 1.00 44.60 ? 506 HOH B O 1 HETATM 4710 O O . HOH F 3 . ? 10.520 22.347 -14.856 1.00 35.86 ? 507 HOH B O 1 HETATM 4711 O O . HOH F 3 . ? 3.174 4.561 4.202 1.00 41.67 ? 508 HOH B O 1 HETATM 4712 O O . HOH F 3 . ? -7.846 5.472 -0.464 1.00 23.94 ? 509 HOH B O 1 HETATM 4713 O O . HOH F 3 . ? -11.897 13.550 23.473 1.00 43.72 ? 510 HOH B O 1 HETATM 4714 O O . HOH F 3 . ? -18.441 20.055 14.880 1.00 40.12 ? 511 HOH B O 1 HETATM 4715 O O . HOH F 3 . ? 6.734 45.892 11.154 1.00 30.94 ? 512 HOH B O 1 HETATM 4716 O O . HOH F 3 . ? -7.231 35.353 -5.605 1.00 39.36 ? 513 HOH B O 1 HETATM 4717 O O . HOH F 3 . ? -4.665 1.576 1.908 1.00 24.77 ? 514 HOH B O 1 HETATM 4718 O O . HOH F 3 . ? -14.006 13.943 0.362 1.00 51.43 ? 515 HOH B O 1 HETATM 4719 O O . HOH F 3 . ? -6.167 22.295 22.007 1.00 26.73 ? 516 HOH B O 1 HETATM 4720 O O . HOH F 3 . ? 19.258 32.634 20.760 1.00 31.06 ? 517 HOH B O 1 HETATM 4721 O O . HOH F 3 . ? 23.880 29.453 24.301 1.00 35.80 ? 518 HOH B O 1 HETATM 4722 O O . HOH F 3 . ? -11.844 36.680 2.323 1.00 35.85 ? 519 HOH B O 1 HETATM 4723 O O . HOH F 3 . ? 4.429 13.543 -3.688 1.00 38.93 ? 520 HOH B O 1 HETATM 4724 O O . HOH F 3 . ? 2.016 12.869 -5.750 1.00 37.31 ? 521 HOH B O 1 HETATM 4725 O O . HOH F 3 . ? 9.554 9.575 13.320 1.00 42.93 ? 522 HOH B O 1 HETATM 4726 O O . HOH F 3 . ? -9.072 22.836 -8.680 1.00 32.99 ? 523 HOH B O 1 HETATM 4727 O O . HOH F 3 . ? -16.376 4.476 9.584 1.00 36.47 ? 524 HOH B O 1 HETATM 4728 O O . HOH F 3 . ? 17.617 43.202 19.010 1.00 47.75 ? 525 HOH B O 1 HETATM 4729 O O . HOH F 3 . ? 30.674 27.463 -4.595 1.00 31.26 ? 526 HOH B O 1 HETATM 4730 O O . HOH F 3 . ? 12.726 37.703 -7.726 1.00 31.60 ? 527 HOH B O 1 HETATM 4731 O O . HOH F 3 . ? -18.400 19.871 8.496 1.00 43.30 ? 528 HOH B O 1 HETATM 4732 O O . HOH F 3 . ? -8.010 19.506 -10.000 1.00 37.12 ? 529 HOH B O 1 HETATM 4733 O O . HOH F 3 . ? -20.724 33.909 17.602 1.00 25.39 ? 530 HOH B O 1 HETATM 4734 O O . HOH F 3 . ? 0.065 37.997 0.446 1.00 33.09 ? 531 HOH B O 1 HETATM 4735 O O . HOH F 3 . ? 24.781 22.825 6.406 1.00 34.88 ? 532 HOH B O 1 HETATM 4736 O O . HOH F 3 . ? -10.066 16.999 22.564 1.00 37.03 ? 533 HOH B O 1 HETATM 4737 O O . HOH F 3 . ? -9.181 36.270 18.700 1.00 41.16 ? 534 HOH B O 1 HETATM 4738 O O . HOH F 3 . ? -1.338 35.219 20.486 1.00 33.19 ? 535 HOH B O 1 HETATM 4739 O O . HOH F 3 . ? -19.193 20.856 12.833 1.00 57.78 ? 536 HOH B O 1 HETATM 4740 O O . HOH F 3 . ? 9.059 12.520 -3.960 1.00 34.25 ? 537 HOH B O 1 HETATM 4741 O O . HOH F 3 . ? -7.410 38.859 16.231 1.00 49.54 ? 538 HOH B O 1 HETATM 4742 O O . HOH F 3 . ? 26.309 38.761 5.387 1.00 22.11 ? 539 HOH B O 1 HETATM 4743 O O . HOH F 3 . ? 13.243 35.969 21.557 1.00 27.06 ? 540 HOH B O 1 HETATM 4744 O O . HOH F 3 . ? -10.456 11.626 1.312 1.00 26.59 ? 541 HOH B O 1 HETATM 4745 O O . HOH F 3 . ? 16.643 25.680 17.870 1.00 24.22 ? 542 HOH B O 1 HETATM 4746 O O . HOH F 3 . ? -9.647 32.757 15.407 1.00 17.27 ? 543 HOH B O 1 HETATM 4747 O O . HOH F 3 . ? -1.729 36.021 4.688 1.00 24.76 ? 544 HOH B O 1 HETATM 4748 O O . HOH F 3 . ? 27.917 40.067 3.543 1.00 26.19 ? 545 HOH B O 1 HETATM 4749 O O . HOH F 3 . ? -12.057 32.831 14.925 1.00 34.52 ? 546 HOH B O 1 HETATM 4750 O O . HOH F 3 . ? -20.883 18.539 12.868 1.00 33.53 ? 547 HOH B O 1 HETATM 4751 O O . HOH F 3 . ? 0.875 32.153 -10.796 1.00 46.53 ? 548 HOH B O 1 HETATM 4752 O O . HOH F 3 . ? -5.996 39.183 8.261 1.00 43.38 ? 549 HOH B O 1 HETATM 4753 O O . HOH F 3 . ? 20.644 15.233 5.532 1.00 30.77 ? 550 HOH B O 1 HETATM 4754 O O . HOH F 3 . ? -5.369 7.784 -2.769 1.00 37.02 ? 551 HOH B O 1 HETATM 4755 O O . HOH F 3 . ? 10.033 20.206 -16.975 1.00 29.91 ? 552 HOH B O 1 HETATM 4756 O O . HOH F 3 . ? -8.296 9.221 0.606 1.00 35.68 ? 553 HOH B O 1 HETATM 4757 O O . HOH F 3 . ? -12.928 3.107 19.793 1.00 31.63 ? 554 HOH B O 1 HETATM 4758 O O . HOH F 3 . ? 4.566 14.599 18.844 1.00 48.76 ? 555 HOH B O 1 HETATM 4759 O O . HOH F 3 . ? 20.390 41.054 20.455 1.00 48.99 ? 556 HOH B O 1 HETATM 4760 O O . HOH F 3 . ? 15.616 19.059 16.098 1.00 36.95 ? 557 HOH B O 1 HETATM 4761 O O . HOH F 3 . ? 6.305 35.355 19.995 1.00 60.03 ? 558 HOH B O 1 HETATM 4762 O O . HOH F 3 . ? 11.761 11.759 -1.783 1.00 32.70 ? 559 HOH B O 1 HETATM 4763 O O . HOH F 3 . ? 0.041 32.448 24.616 1.00 42.14 ? 560 HOH B O 1 HETATM 4764 O O . HOH F 3 . ? -0.442 9.796 0.845 1.00 35.36 ? 561 HOH B O 1 HETATM 4765 O O . HOH F 3 . ? -17.964 10.090 14.285 1.00 29.81 ? 562 HOH B O 1 HETATM 4766 O O . HOH F 3 . ? 11.334 44.590 9.945 1.00 37.74 ? 563 HOH B O 1 HETATM 4767 O O . HOH F 3 . ? 8.651 44.506 13.666 1.00 41.03 ? 564 HOH B O 1 HETATM 4768 O O . HOH F 3 . ? -4.040 -0.469 7.242 1.00 34.71 ? 565 HOH B O 1 HETATM 4769 O O . HOH F 3 . ? -4.317 32.421 26.413 1.00 50.39 ? 566 HOH B O 1 HETATM 4770 O O . HOH F 3 . ? 23.695 12.261 6.795 1.00 49.05 ? 567 HOH B O 1 HETATM 4771 O O . HOH F 3 . ? -3.136 34.970 -10.921 1.00 41.04 ? 568 HOH B O 1 HETATM 4772 O O . HOH F 3 . ? -5.471 24.301 25.045 1.00 39.23 ? 569 HOH B O 1 HETATM 4773 O O . HOH F 3 . ? 14.698 23.397 -10.372 1.00 40.71 ? 570 HOH B O 1 HETATM 4774 O O . HOH F 3 . ? -4.217 22.958 -13.587 1.00 36.97 ? 571 HOH B O 1 HETATM 4775 O O . HOH F 3 . ? -18.236 14.440 23.070 1.00 41.68 ? 572 HOH B O 1 HETATM 4776 O O . HOH F 3 . ? 27.852 41.358 -0.669 1.00 35.91 ? 573 HOH B O 1 HETATM 4777 O O . HOH F 3 . ? 35.328 30.989 -6.305 1.00 48.91 ? 574 HOH B O 1 HETATM 4778 O O . HOH F 3 . ? -15.503 3.083 5.471 1.00 56.35 ? 575 HOH B O 1 HETATM 4779 O O . HOH F 3 . ? -14.071 17.346 -2.308 1.00 42.69 ? 576 HOH B O 1 HETATM 4780 O O . HOH F 3 . ? 1.761 10.130 -4.675 1.00 60.04 ? 577 HOH B O 1 HETATM 4781 O O . HOH F 3 . ? -12.524 4.788 -0.791 1.00 39.05 ? 578 HOH B O 1 HETATM 4782 O O . HOH F 3 . ? 5.548 39.226 17.492 1.00 40.62 ? 579 HOH B O 1 HETATM 4783 O O . HOH F 3 . ? 2.450 9.549 -2.319 1.00 50.85 ? 580 HOH B O 1 HETATM 4784 O O . HOH F 3 . ? 9.043 27.461 -9.274 1.00 32.42 ? 581 HOH B O 1 HETATM 4785 O O . HOH F 3 . ? -16.283 24.398 1.611 1.00 30.61 ? 582 HOH B O 1 HETATM 4786 O O . HOH F 3 . ? 16.188 32.323 -13.663 1.00 41.21 ? 583 HOH B O 1 HETATM 4787 O O . HOH F 3 . ? 1.085 13.083 -11.856 1.00 51.61 ? 584 HOH B O 1 HETATM 4788 O O . HOH F 3 . ? -19.031 13.667 14.912 1.00 51.35 ? 585 HOH B O 1 HETATM 4789 O O . HOH F 3 . ? 2.097 13.579 -2.116 1.00 41.03 ? 586 HOH B O 1 HETATM 4790 O O . HOH F 3 . ? 24.658 29.322 20.822 1.00 48.31 ? 587 HOH B O 1 HETATM 4791 O O . HOH F 3 . ? 22.231 12.763 -7.077 1.00 50.64 ? 588 HOH B O 1 HETATM 4792 O O . HOH F 3 . ? 34.132 28.772 -6.834 1.00 31.94 ? 589 HOH B O 1 HETATM 4793 O O . HOH F 3 . ? -10.889 30.979 -3.296 1.00 39.42 ? 590 HOH B O 1 HETATM 4794 O O . HOH F 3 . ? -11.492 -0.621 10.174 1.00 32.48 ? 591 HOH B O 1 HETATM 4795 O O . HOH F 3 . ? 28.175 42.774 3.854 1.00 37.98 ? 592 HOH B O 1 HETATM 4796 O O . HOH F 3 . ? 27.270 43.868 6.361 1.00 37.42 ? 593 HOH B O 1 HETATM 4797 O O . HOH F 3 . ? 16.132 22.988 16.070 1.00 34.66 ? 594 HOH B O 1 HETATM 4798 O O . HOH F 3 . ? 16.222 43.395 5.817 1.00 34.05 ? 595 HOH B O 1 HETATM 4799 O O . HOH F 3 . ? 32.307 29.397 -5.590 1.00 44.11 ? 596 HOH B O 1 HETATM 4800 O O . HOH F 3 . ? -22.416 16.745 11.776 1.00 37.39 ? 597 HOH B O 1 HETATM 4801 O O . HOH F 3 . ? -6.236 17.743 23.408 1.00 38.54 ? 598 HOH B O 1 HETATM 4802 O O . HOH F 3 . ? -14.687 1.117 12.634 1.00 29.70 ? 599 HOH B O 1 HETATM 4803 O O . HOH F 3 . ? 13.927 44.465 3.554 1.00 41.53 ? 600 HOH B O 1 HETATM 4804 O O . HOH F 3 . ? -17.312 13.137 1.073 1.00 50.38 ? 601 HOH B O 1 HETATM 4805 O O . HOH F 3 . ? 13.439 9.884 -3.096 1.00 36.07 ? 602 HOH B O 1 HETATM 4806 O O . HOH F 3 . ? 1.832 39.810 17.562 1.00 38.56 ? 603 HOH B O 1 HETATM 4807 O O . HOH F 3 . ? 28.083 38.931 -2.730 1.00 45.86 ? 604 HOH B O 1 HETATM 4808 O O . HOH F 3 . ? -16.105 34.449 16.485 1.00 37.17 ? 605 HOH B O 1 HETATM 4809 O O . HOH F 3 . ? 11.353 46.327 12.265 1.00 48.33 ? 606 HOH B O 1 HETATM 4810 O O . HOH F 3 . ? -4.253 44.677 9.060 1.00 49.34 ? 607 HOH B O 1 HETATM 4811 O O . HOH F 3 . ? -9.578 36.638 12.765 1.00 61.48 ? 608 HOH B O 1 HETATM 4812 O O . HOH F 3 . ? 11.882 10.816 1.367 1.00 50.78 ? 609 HOH B O 1 HETATM 4813 O O . HOH F 3 . ? 21.821 42.205 -3.900 1.00 39.89 ? 610 HOH B O 1 HETATM 4814 O O . HOH F 3 . ? 30.127 28.658 -6.931 1.00 41.62 ? 611 HOH B O 1 HETATM 4815 O O . HOH F 3 . ? 17.267 21.051 16.557 1.00 49.08 ? 612 HOH B O 1 HETATM 4816 O O . HOH F 3 . ? 18.453 43.297 7.637 1.00 45.03 ? 613 HOH B O 1 HETATM 4817 O O . HOH F 3 . ? 18.621 41.046 8.069 1.00 46.24 ? 614 HOH B O 1 HETATM 4818 O O . HOH F 3 . ? 18.455 42.501 -9.511 1.00 55.08 ? 615 HOH B O 1 HETATM 4819 O O . HOH F 3 . ? 18.175 41.913 -6.881 1.00 52.61 ? 616 HOH B O 1 HETATM 4820 O O . HOH F 3 . ? 22.096 42.221 -6.751 1.00 35.25 ? 617 HOH B O 1 HETATM 4821 O O . HOH F 3 . ? 23.472 40.470 -7.929 1.00 38.76 ? 618 HOH B O 1 HETATM 4822 O O . HOH F 3 . ? -13.578 29.319 8.639 1.00 33.78 ? 619 HOH B O 1 HETATM 4823 O O . HOH F 3 . ? 21.141 12.605 -10.536 1.00 44.97 ? 620 HOH B O 1 HETATM 4824 O O . HOH F 3 . ? 14.474 7.950 -0.480 1.00 53.92 ? 621 HOH B O 1 HETATM 4825 O O . HOH F 3 . ? -14.647 -0.866 3.799 1.00 47.57 ? 622 HOH B O 1 HETATM 4826 O O . HOH F 3 . ? 26.577 37.040 9.667 1.00 32.99 ? 623 HOH B O 1 HETATM 4827 O O . HOH F 3 . ? 24.859 35.698 -10.451 1.00 48.43 ? 624 HOH B O 1 HETATM 4828 O O . HOH F 3 . ? -6.438 25.271 -12.625 1.00 61.50 ? 625 HOH B O 1 HETATM 4829 O O . HOH F 3 . ? -10.085 35.082 16.877 1.00 38.95 ? 626 HOH B O 1 HETATM 4830 O O . HOH F 3 . ? 0.598 6.875 -2.937 1.00 34.47 ? 627 HOH B O 1 HETATM 4831 O O . HOH F 3 . ? 4.825 47.128 9.705 1.00 43.62 ? 628 HOH B O 1 HETATM 4832 O O . HOH F 3 . ? -16.861 5.588 14.945 1.00 44.49 ? 629 HOH B O 1 HETATM 4833 O O . HOH F 3 . ? -12.850 1.121 21.249 1.00 45.11 ? 630 HOH B O 1 HETATM 4834 O O . HOH F 3 . ? -3.489 6.135 -1.609 1.00 47.41 ? 631 HOH B O 1 HETATM 4835 O O . HOH F 3 . ? 14.652 40.198 -8.640 1.00 39.39 ? 632 HOH B O 1 HETATM 4836 O O . HOH F 3 . ? -0.774 39.218 4.455 1.00 43.03 ? 633 HOH B O 1 HETATM 4837 O O . HOH F 3 . ? 24.093 24.901 20.938 1.00 41.79 ? 634 HOH B O 1 HETATM 4838 O O . HOH F 3 . ? 14.723 44.108 7.817 1.00 42.12 ? 635 HOH B O 1 HETATM 4839 O O . HOH F 3 . ? 24.115 38.110 -6.762 1.00 42.22 ? 636 HOH B O 1 HETATM 4840 O O . HOH F 3 . ? 20.481 8.070 -3.822 1.00 49.32 ? 637 HOH B O 1 HETATM 4841 O O . HOH F 3 . ? 13.695 42.730 21.019 1.00 40.38 ? 638 HOH B O 1 HETATM 4842 O O . HOH F 3 . ? -14.800 36.928 16.308 1.00 50.64 ? 639 HOH B O 1 HETATM 4843 O O . HOH F 3 . ? -14.216 6.386 22.078 1.00 49.03 ? 640 HOH B O 1 HETATM 4844 O O . HOH F 3 . ? 15.850 42.930 10.697 1.00 52.35 ? 641 HOH B O 1 HETATM 4845 O O . HOH F 3 . ? -10.731 22.605 21.638 1.00 48.52 ? 642 HOH B O 1 HETATM 4846 O O . HOH F 3 . ? -16.940 19.006 3.437 1.00 39.30 ? 643 HOH B O 1 HETATM 4847 O O . HOH F 3 . ? -0.916 36.396 -1.213 1.00 42.97 ? 644 HOH B O 1 HETATM 4848 O O . HOH F 3 . ? -7.845 29.475 27.162 1.00 46.90 ? 645 HOH B O 1 HETATM 4849 O O . HOH F 3 . ? 20.308 19.079 14.736 1.00 69.78 ? 646 HOH B O 1 HETATM 4850 O O . HOH F 3 . ? -14.134 33.834 15.217 1.00 40.49 ? 647 HOH B O 1 HETATM 4851 O O . HOH F 3 . ? 3.090 38.164 19.313 1.00 56.28 ? 648 HOH B O 1 HETATM 4852 O O . HOH F 3 . ? -16.198 14.644 8.627 1.00 32.53 ? 649 HOH B O 1 HETATM 4853 O O . HOH F 3 . ? 11.496 14.797 -11.998 1.00 47.65 ? 650 HOH B O 1 HETATM 4854 O O . HOH F 3 . ? 29.769 31.057 -1.830 1.00 36.32 ? 651 HOH B O 1 HETATM 4855 O O . HOH F 3 . ? 2.927 14.005 17.174 1.00 39.34 ? 652 HOH B O 1 HETATM 4856 O O . HOH F 3 . ? 27.392 34.658 11.036 1.00 45.96 ? 653 HOH B O 1 HETATM 4857 O O . HOH F 3 . ? -6.445 28.954 -12.317 1.00 46.37 ? 654 HOH B O 1 HETATM 4858 O O . HOH F 3 . ? 24.219 20.698 -12.729 1.00 55.99 ? 655 HOH B O 1 HETATM 4859 O O . HOH F 3 . ? -0.677 34.628 -8.309 1.00 45.51 ? 656 HOH B O 1 HETATM 4860 O O . HOH F 3 . ? 5.371 7.914 -3.988 1.00 54.53 ? 657 HOH B O 1 HETATM 4861 O O . HOH F 3 . ? 29.235 29.709 -9.700 1.00 41.97 ? 658 HOH B O 1 HETATM 4862 O O . HOH F 3 . ? 23.526 35.176 3.726 1.00 14.23 ? 659 HOH B O 1 HETATM 4863 O O . HOH F 3 . ? -12.200 38.569 4.010 1.00 56.80 ? 660 HOH B O 1 HETATM 4864 O O . HOH F 3 . ? -20.804 17.201 9.910 1.00 39.31 ? 661 HOH B O 1 HETATM 4865 O O . HOH F 3 . ? 25.266 44.534 5.284 1.00 42.41 ? 662 HOH B O 1 HETATM 4866 O O . HOH F 3 . ? -5.733 39.089 18.499 1.00 54.13 ? 663 HOH B O 1 HETATM 4867 O O . HOH F 3 . ? 6.184 5.656 12.343 1.00 46.45 ? 664 HOH B O 1 HETATM 4868 O O . HOH F 3 . ? -12.952 34.136 12.832 1.00 49.43 ? 665 HOH B O 1 HETATM 4869 O O . HOH F 3 . ? 19.745 28.889 -11.626 1.00 40.32 ? 666 HOH B O 1 HETATM 4870 O O . HOH F 3 . ? 0.152 3.541 4.690 1.00 42.91 ? 667 HOH B O 1 HETATM 4871 O O . HOH F 3 . ? 22.576 24.381 -12.862 1.00 48.86 ? 668 HOH B O 1 HETATM 4872 O O . HOH F 3 . ? -9.563 27.752 25.436 1.00 49.97 ? 669 HOH B O 1 HETATM 4873 O O . HOH F 3 . ? 8.327 22.834 -10.926 1.00 48.19 ? 670 HOH B O 1 # loop_ _atom_site_anisotrop.id _atom_site_anisotrop.type_symbol _atom_site_anisotrop.pdbx_label_atom_id _atom_site_anisotrop.pdbx_label_alt_id _atom_site_anisotrop.pdbx_label_comp_id _atom_site_anisotrop.pdbx_label_asym_id _atom_site_anisotrop.pdbx_label_seq_id _atom_site_anisotrop.pdbx_PDB_ins_code _atom_site_anisotrop.U[1][1] _atom_site_anisotrop.U[2][2] _atom_site_anisotrop.U[3][3] _atom_site_anisotrop.U[1][2] _atom_site_anisotrop.U[1][3] _atom_site_anisotrop.U[2][3] _atom_site_anisotrop.pdbx_auth_seq_id _atom_site_anisotrop.pdbx_auth_comp_id _atom_site_anisotrop.pdbx_auth_asym_id _atom_site_anisotrop.pdbx_auth_atom_id 1 N N . LYS A 21 ? 0.2496 0.1434 0.2788 -0.0504 0.0355 -0.0308 21 LYS A N 2 C CA . LYS A 21 ? 0.3279 0.3714 0.2815 0.0446 0.0024 0.0264 21 LYS A CA 3 C C . LYS A 21 ? 0.4743 0.4416 0.3953 0.1570 -0.0742 -0.0524 21 LYS A C 4 O O . LYS A 21 ? 0.2705 0.2691 0.4085 0.0452 0.0757 0.1531 21 LYS A O 5 C CB . LYS A 21 ? 0.1779 0.2470 0.2088 -0.0729 -0.0162 0.1322 21 LYS A CB 6 C CG . LYS A 21 ? 0.4489 0.2969 0.4507 0.0184 -0.0065 -0.0272 21 LYS A CG 7 C CD . LYS A 21 ? 0.4512 0.3708 0.5622 -0.0445 0.0957 -0.0523 21 LYS A CD 8 C CE . LYS A 21 ? 0.4493 0.3117 0.6030 -0.1855 0.1182 -0.1734 21 LYS A CE 9 N NZ . LYS A 21 ? 0.9204 0.2847 0.5262 -0.2736 -0.0549 -0.0779 21 LYS A NZ 10 N N . LEU A 22 ? 0.4360 0.4595 0.3749 0.1658 -0.0048 -0.0862 22 LEU A N 11 C CA . LEU A 22 ? 0.4724 0.4162 0.2647 0.1879 0.0191 0.1849 22 LEU A CA 12 C C . LEU A 22 ? 0.4108 0.1368 0.2530 0.0913 -0.0093 0.1051 22 LEU A C 13 O O . LEU A 22 ? 0.4092 0.1989 0.2111 0.0423 -0.0431 -0.0342 22 LEU A O 14 C CB . LEU A 22 ? 0.4232 0.4396 0.4140 0.0421 0.0950 0.2854 22 LEU A CB 15 C CG . LEU A 22 ? 0.3594 0.4876 0.4477 0.1460 0.1974 0.3154 22 LEU A CG 16 C CD1 . LEU A 22 ? 0.3230 0.2586 0.4135 -0.0442 0.0575 0.0787 22 LEU A CD1 17 C CD2 . LEU A 22 ? 0.4216 0.4629 0.4872 0.0631 -0.0195 0.2958 22 LEU A CD2 18 N N . THR A 23 ? 0.3995 0.1198 0.1859 0.0427 -0.0249 0.0063 23 THR A N 19 C CA . THR A 23 ? 0.3266 0.1001 0.1811 0.0084 -0.0543 -0.0075 23 THR A CA 20 C C . THR A 23 ? 0.2812 0.1266 0.2220 0.0209 -0.0570 -0.0363 23 THR A C 21 O O . THR A 23 ? 0.2781 0.1636 0.2007 0.0052 -0.0758 -0.0085 23 THR A O 22 C CB . THR A 23 ? 0.3644 0.1583 0.1776 -0.0371 -0.0765 -0.0034 23 THR A CB 23 O OG1 . THR A 23 ? 0.4607 0.1780 0.1388 -0.0639 -0.0694 -0.0116 23 THR A OG1 24 C CG2 . THR A 23 ? 0.6874 0.2514 0.1638 -0.1759 -0.1000 0.0396 23 THR A CG2 25 N N . PHE A 24 ? 0.2904 0.1108 0.2111 0.0244 -0.0890 -0.0377 24 PHE A N 26 C CA . PHE A 24 ? 0.1728 0.1318 0.1572 -0.0200 -0.0403 -0.0125 24 PHE A CA 27 C C . PHE A 24 ? 0.1832 0.1328 0.1783 -0.0102 -0.0202 0.0270 24 PHE A C 28 O O . PHE A 24 ? 0.1518 0.1387 0.1563 0.0119 -0.0193 0.0168 24 PHE A O 29 C CB . PHE A 24 ? 0.2225 0.1240 0.1994 0.0259 -0.0623 -0.0301 24 PHE A CB 30 C CG . PHE A 24 ? 0.2111 0.1054 0.1506 0.0124 -0.0584 0.0056 24 PHE A CG 31 C CD1 . PHE A 24 ? 0.2468 0.1350 0.1297 -0.0069 -0.0456 0.0090 24 PHE A CD1 32 C CD2 . PHE A 24 ? 0.2374 0.1137 0.1809 0.0497 -0.0511 0.0153 24 PHE A CD2 33 C CE1 . PHE A 24 ? 0.2010 0.1512 0.1529 0.0075 -0.0318 -0.0259 24 PHE A CE1 34 C CE2 . PHE A 24 ? 0.2558 0.1056 0.1785 0.0195 0.0264 0.0065 24 PHE A CE2 35 C CZ . PHE A 24 ? 0.2461 0.1198 0.2859 0.0281 -0.0952 -0.0224 24 PHE A CZ 36 N N . LYS A 25 ? 0.2149 0.1309 0.1514 -0.0007 -0.0336 0.0122 25 LYS A N 37 C CA . LYS A 25 ? 0.2168 0.1320 0.1625 -0.0108 -0.0378 0.0145 25 LYS A CA 38 C C . LYS A 25 ? 0.2196 0.1388 0.1702 0.0037 -0.0366 0.0124 25 LYS A C 39 O O . LYS A 25 ? 0.2099 0.1139 0.1919 0.0210 -0.0493 0.0109 25 LYS A O 40 C CB . LYS A 25 ? 0.2240 0.1935 0.1720 0.0315 -0.0356 0.0469 25 LYS A CB 41 C CG . LYS A 25 ? 0.2211 0.2684 0.2087 0.0454 -0.0339 0.0777 25 LYS A CG 42 C CD . LYS A 25 ? 0.2665 0.3751 0.3192 0.0681 -0.0298 0.2019 25 LYS A CD 43 C CE . LYS A 25 ? 0.3274 0.4918 0.3114 0.0914 -0.0754 0.2086 25 LYS A CE 44 N NZ . LYS A 25 ? 0.4508 0.7185 0.7576 0.0223 -0.3033 0.1425 25 LYS A NZ 45 N N . THR A 26 ? 0.2146 0.0992 0.2089 0.0097 -0.0253 0.0167 26 THR A N 46 C CA . THR A 26 ? 0.2929 0.1407 0.1931 0.0294 -0.0055 0.0121 26 THR A CA 47 C C . THR A 26 ? 0.2148 0.1001 0.1750 0.0269 -0.0276 -0.0234 26 THR A C 48 O O . THR A 26 ? 0.2161 0.1180 0.2052 0.0453 -0.0310 -0.0208 26 THR A O 49 C CB . THR A 26 ? 0.3577 0.1555 0.2923 -0.0548 0.1106 -0.0542 26 THR A CB 50 O OG1 . THR A 26 ? 0.5196 0.2048 0.2649 -0.0876 0.0083 0.0101 26 THR A OG1 51 C CG2 . THR A 26 ? 0.5332 0.2269 0.2912 0.1255 0.0568 -0.0649 26 THR A CG2 52 N N . ASP A 27 ? 0.1914 0.1268 0.1395 0.0189 -0.0315 -0.0186 27 ASP A N 53 C CA . ASP A 27 ? 0.2497 0.0984 0.1688 -0.0073 -0.0444 -0.0202 27 ASP A CA 54 C C . ASP A 27 ? 0.2029 0.1217 0.1708 0.0071 -0.0217 -0.0409 27 ASP A C 55 O O . ASP A 27 ? 0.2034 0.1397 0.1371 0.0157 -0.0270 -0.0389 27 ASP A O 56 C CB . ASP A 27 ? 0.2777 0.1420 0.2612 -0.0467 -0.1030 0.0589 27 ASP A CB 57 C CG . ASP A 27 ? 0.4630 0.1726 0.2504 0.1098 -0.2058 -0.0089 27 ASP A CG 58 O OD1 . ASP A 27 ? 0.6849 0.3009 0.3317 0.2655 -0.2222 -0.1002 27 ASP A OD1 59 O OD2 . ASP A 27 ? 0.2810 0.3644 0.3178 0.1165 -0.1300 -0.1187 27 ASP A OD2 60 N N . LEU A 28 ? 0.1763 0.1110 0.1533 0.0140 -0.0297 -0.0269 28 LEU A N 61 C CA . LEU A 28 ? 0.1808 0.1075 0.1433 0.0156 -0.0310 -0.0121 28 LEU A CA 62 C C . LEU A 28 ? 0.1744 0.1228 0.1734 0.0253 -0.0288 -0.0143 28 LEU A C 63 O O . LEU A 28 ? 0.1915 0.1147 0.1503 0.0136 -0.0212 -0.0212 28 LEU A O 64 C CB . LEU A 28 ? 0.2111 0.1128 0.1361 0.0506 -0.0563 -0.0184 28 LEU A CB 65 C CG . LEU A 28 ? 0.2056 0.1212 0.1010 0.0492 -0.0213 0.0138 28 LEU A CG 66 C CD1 . LEU A 28 ? 0.2220 0.1406 0.1102 0.0354 -0.0126 -0.0044 28 LEU A CD1 67 C CD2 . LEU A 28 ? 0.2099 0.1289 0.1136 0.0274 -0.0326 0.0108 28 LEU A CD2 68 N N . GLU A 29 ? 0.1784 0.1323 0.1395 0.0250 -0.0129 0.0020 29 GLU A N 69 C CA . GLU A 29 ? 0.2375 0.1508 0.1705 0.0677 -0.0370 -0.0106 29 GLU A CA 70 C C . GLU A 29 ? 0.2367 0.1556 0.1590 0.1062 -0.0467 -0.0013 29 GLU A C 71 O O . GLU A 29 ? 0.2298 0.1403 0.1703 0.0723 -0.0515 -0.0288 29 GLU A O 72 C CB . GLU A 29 ? 0.2766 0.2030 0.1724 0.0630 -0.0628 0.0361 29 GLU A CB 73 C CG . GLU A 29 ? 0.3995 0.4902 0.1558 0.1214 -0.0172 0.0793 29 GLU A CG 74 C CD . GLU A 29 ? 0.5502 0.6680 0.2898 0.0805 0.0617 0.2050 29 GLU A CD 75 O OE1 . GLU A 29 ? 0.6362 0.4371 0.4828 0.2685 0.1329 0.2950 29 GLU A OE1 76 O OE2 . GLU A 29 ? 0.5125 0.9991 0.2762 -0.0075 0.0994 0.2031 29 GLU A OE2 77 N N . LYS A 30 ? 0.1873 0.1424 0.1889 0.0448 -0.0326 -0.0346 30 LYS A N 78 C CA . LYS A 30 ? 0.2763 0.1415 0.1728 0.0690 -0.0250 -0.0363 30 LYS A CA 79 C C . LYS A 30 ? 0.2573 0.1525 0.1409 0.0578 -0.0092 -0.0484 30 LYS A C 80 O O . LYS A 30 ? 0.2512 0.1889 0.1662 0.0833 -0.0210 -0.0374 30 LYS A O 81 C CB . LYS A 30 ? 0.2914 0.2026 0.2061 0.0277 -0.0201 -0.0743 30 LYS A CB 82 C CG . LYS A 30 ? 0.3636 0.2889 0.1933 0.0781 -0.0275 -0.1031 30 LYS A CG 83 C CD . LYS A 30 ? 0.5133 0.3845 0.2233 -0.0398 -0.0822 -0.0906 30 LYS A CD 84 C CE . LYS A 30 ? 0.5038 0.5218 0.2364 0.0888 -0.1090 -0.2238 30 LYS A CE 85 N NZ . LYS A 30 ? 0.7681 0.5350 0.5701 0.1660 -0.0637 -0.2543 30 LYS A NZ 86 N N . LEU A 31 ? 0.2218 0.1451 0.1283 0.0399 -0.0285 -0.0396 31 LEU A N 87 C CA . LEU A 31 ? 0.2440 0.1472 0.1251 0.0434 -0.0276 -0.0048 31 LEU A CA 88 C C . LEU A 31 ? 0.2176 0.1373 0.1182 0.0189 0.0064 -0.0221 31 LEU A C 89 O O . LEU A 31 ? 0.2136 0.1269 0.1779 0.0360 0.0295 -0.0094 31 LEU A O 90 C CB . LEU A 31 ? 0.3132 0.1543 0.1494 0.0819 -0.0313 -0.0011 31 LEU A CB 91 C CG . LEU A 31 ? 0.3101 0.2051 0.1646 0.0870 -0.0281 0.0446 31 LEU A CG 92 C CD1 . LEU A 31 ? 0.3885 0.3141 0.1191 0.1769 -0.0249 0.0327 31 LEU A CD1 93 C CD2 . LEU A 31 ? 0.4247 0.1827 0.1443 0.1254 0.0124 0.0136 31 LEU A CD2 94 N N . GLU A 32 ? 0.2035 0.1411 0.1220 0.0404 -0.0118 -0.0028 32 GLU A N 95 C CA . GLU A 32 ? 0.1863 0.1367 0.1471 0.0240 -0.0149 -0.0397 32 GLU A CA 96 C C . GLU A 32 ? 0.2006 0.1427 0.1567 0.0419 -0.0205 -0.0261 32 GLU A C 97 O O . GLU A 32 ? 0.1886 0.1657 0.1557 0.0368 -0.0176 -0.0408 32 GLU A O 98 C CB . GLU A 32 ? 0.1939 0.1230 0.1373 0.0440 -0.0330 -0.0125 32 GLU A CB 99 C CG . GLU A 32 ? 0.2045 0.1245 0.1249 0.0354 -0.0242 -0.0234 32 GLU A CG 100 C CD . GLU A 32 ? 0.2673 0.1031 0.1543 0.0195 0.0197 -0.0060 32 GLU A CD 101 O OE1 . GLU A 32 ? 0.5147 0.1469 0.2161 0.1322 0.0886 0.0389 32 GLU A OE1 102 O OE2 . GLU A 32 ? 0.2574 0.1097 0.1062 0.0312 -0.0222 -0.0048 32 GLU A OE2 103 N N . ARG A 33 ? 0.1951 0.1359 0.1553 0.0435 -0.0165 -0.0176 33 ARG A N 104 C CA . ARG A 33 ? 0.2888 0.1398 0.1948 0.0907 0.0043 -0.0099 33 ARG A CA 105 C C . ARG A 33 ? 0.2777 0.1545 0.2078 0.1275 0.0294 -0.0139 33 ARG A C 106 O O . ARG A 33 ? 0.2731 0.2842 0.2994 0.0759 0.0462 -0.1194 33 ARG A O 107 C CB . ARG A 33 ? 0.2435 0.1565 0.3485 0.0867 0.0293 -0.0520 33 ARG A CB 108 C CG . ARG A 33 ? 0.3954 0.1930 0.3832 0.0048 -0.0180 0.0339 33 ARG A CG 109 C CD . ARG A 33 ? 0.6881 0.2348 0.5755 -0.1455 -0.2800 0.0955 33 ARG A CD 110 N NE . ARG A 33 ? 1.0559 0.1883 0.7450 -0.0717 -0.6307 0.1435 33 ARG A NE 111 C CZ . ARG A 33 ? 1.0801 0.1750 0.7533 -0.0467 -0.5777 0.1244 33 ARG A CZ 112 N NH1 . ARG A 33 ? 1.1925 0.2536 0.9433 -0.0737 -0.4239 0.0269 33 ARG A NH1 113 N NH2 . ARG A 33 ? 1.2079 0.3504 0.7321 -0.1766 -0.6491 0.1431 33 ARG A NH2 114 N N . GLU A 34 ? 0.3676 0.1779 0.1805 0.1237 0.0138 -0.0245 34 GLU A N 115 C CA . GLU A 34 ? 0.3948 0.2112 0.1872 0.0908 0.0187 -0.0311 34 GLU A CA 116 C C . GLU A 34 ? 0.2791 0.2215 0.2076 0.1057 0.0069 -0.0293 34 GLU A C 117 O O . GLU A 34 ? 0.3070 0.3122 0.2424 0.1107 0.0478 -0.0225 34 GLU A O 118 C CB . GLU A 34 ? 0.4124 0.3294 0.1595 -0.0096 0.0308 -0.0593 34 GLU A CB 119 C CG . GLU A 34 ? 0.5015 0.2605 0.2246 0.1226 -0.0810 -0.0812 34 GLU A CG 120 C CD . GLU A 34 ? 0.6788 0.1875 0.3229 0.1165 -0.2100 -0.0716 34 GLU A CD 121 O OE1 . GLU A 34 ? 0.9358 0.2924 0.3617 0.2182 -0.3370 0.0226 34 GLU A OE1 122 O OE2 . GLU A 34 ? 0.8242 0.2379 0.4417 0.0745 -0.1908 -0.1617 34 GLU A OE2 123 N N . LYS A 35 ? 0.2874 0.2033 0.1551 0.0776 0.0146 -0.0022 35 LYS A N 124 C CA . LYS A 35 ? 0.3334 0.2084 0.2209 0.0596 0.0067 -0.0145 35 LYS A CA 125 C C . LYS A 35 ? 0.3434 0.2146 0.2179 0.0801 0.0126 -0.0619 35 LYS A C 126 O O . LYS A 35 ? 0.3405 0.2480 0.2135 0.0387 0.0248 -0.0350 35 LYS A O 127 C CB . LYS A 35 ? 0.4398 0.2146 0.2485 0.1193 -0.0294 -0.0044 35 LYS A CB 128 C CG . LYS A 35 ? 0.4355 0.3385 0.2558 0.1818 -0.0328 -0.0519 35 LYS A CG 129 C CD . LYS A 35 ? 0.5476 0.4059 0.2504 0.0891 -0.0175 0.0371 35 LYS A CD 130 C CE . LYS A 35 ? 0.7040 0.4259 0.2632 0.1017 -0.0976 0.1056 35 LYS A CE 131 N NZ . LYS A 35 ? 0.5109 0.8603 0.2722 0.0485 -0.1347 0.0739 35 LYS A NZ 132 N N . ALA A 36 ? 0.2666 0.2192 0.2100 0.0760 0.0103 -0.0578 36 ALA A N 133 C CA . ALA A 36 ? 0.2006 0.2156 0.2295 0.0319 0.0216 -0.0567 36 ALA A CA 134 C C . ALA A 36 ? 0.2102 0.1739 0.2046 0.0349 0.0128 -0.0282 36 ALA A C 135 O O . ALA A 36 ? 0.2292 0.1974 0.2063 0.0127 0.0108 -0.0296 36 ALA A O 136 C CB . ALA A 36 ? 0.2039 0.2456 0.3653 0.0407 0.0533 -0.0416 36 ALA A CB 137 N N . ALA A 37 ? 0.2066 0.1525 0.1663 0.0481 -0.0102 -0.0132 37 ALA A N 138 C CA . ALA A 37 ? 0.1887 0.1314 0.1608 0.0253 -0.0021 0.0035 37 ALA A CA 139 C C . ALA A 37 ? 0.1784 0.1204 0.1335 0.0143 -0.0207 -0.0134 37 ALA A C 140 O O . ALA A 37 ? 0.1850 0.1164 0.1764 0.0358 -0.0100 0.0005 37 ALA A O 141 C CB . ALA A 37 ? 0.2655 0.1562 0.1502 0.0737 0.0150 0.0322 37 ALA A CB 142 N N . GLN A 38 ? 0.1791 0.1351 0.1206 0.0426 -0.0297 -0.0077 38 GLN A N 143 C CA . GLN A 38 ? 0.1797 0.1200 0.1326 0.0413 -0.0197 -0.0022 38 GLN A CA 144 C C . GLN A 38 ? 0.1785 0.0968 0.1236 0.0337 -0.0025 0.0210 38 GLN A C 145 O O . GLN A 38 ? 0.1789 0.1127 0.1635 0.0198 -0.0133 0.0114 38 GLN A O 146 C CB . GLN A 38 ? 0.1984 0.1399 0.1202 0.0350 -0.0118 0.0155 38 GLN A CB 147 C CG . GLN A 38 ? 0.2332 0.1864 0.2136 0.0581 -0.0702 0.0178 38 GLN A CG 148 C CD . GLN A 38 ? 0.2681 0.1957 0.2061 0.0390 -0.0759 0.0441 38 GLN A CD 149 O OE1 . GLN A 38 ? 0.4744 0.3476 0.1628 0.2152 -0.0925 -0.0084 38 GLN A OE1 150 N NE2 . GLN A 38 ? 0.3386 0.2785 0.2686 0.1168 -0.1146 0.0429 38 GLN A NE2 151 N N . ILE A 39 ? 0.1784 0.1087 0.1062 0.0263 -0.0220 0.0404 39 ILE A N 152 C CA . ILE A 39 ? 0.1815 0.0795 0.0962 0.0230 -0.0236 0.0072 39 ILE A CA 153 C C . ILE A 39 ? 0.1785 0.0850 0.0875 0.0102 -0.0256 0.0060 39 ILE A C 154 O O . ILE A 39 ? 0.2503 0.0675 0.1366 0.0098 -0.0033 0.0120 39 ILE A O 155 C CB . ILE A 39 ? 0.2199 0.0955 0.0976 0.0402 -0.0402 -0.0064 39 ILE A CB 156 C CG1 . ILE A 39 ? 0.2209 0.1015 0.1034 0.0425 -0.0405 -0.0089 39 ILE A CG1 157 C CG2 . ILE A 39 ? 0.1893 0.1357 0.1487 0.0237 -0.0490 0.0089 39 ILE A CG2 158 C CD1 . ILE A 39 ? 0.3051 0.1476 0.0925 0.0549 -0.0431 -0.0202 39 ILE A CD1 159 N N . GLY A 40 ? 0.1602 0.0760 0.0904 0.0159 -0.0283 0.0071 40 GLY A N 160 C CA . GLY A 40 ? 0.1724 0.0808 0.0834 0.0090 -0.0292 0.0088 40 GLY A CA 161 C C . GLY A 40 ? 0.1729 0.0689 0.0769 0.0252 -0.0059 0.0075 40 GLY A C 162 O O . GLY A 40 ? 0.2018 0.0802 0.1409 0.0125 -0.0331 0.0357 40 GLY A O 163 N N . VAL A 41 ? 0.1774 0.0918 0.0920 0.0098 -0.0265 0.0160 41 VAL A N 164 C CA . VAL A 41 ? 0.1760 0.0812 0.0865 0.0123 -0.0307 0.0035 41 VAL A CA 165 C C . VAL A 41 ? 0.1730 0.0781 0.0820 0.0028 -0.0327 0.0108 41 VAL A C 166 O O . VAL A 41 ? 0.1845 0.0964 0.1169 0.0232 -0.0179 0.0340 41 VAL A O 167 C CB . VAL A 41 ? 0.2364 0.1158 0.0848 0.0321 -0.0501 -0.0026 41 VAL A CB 168 C CG1 . VAL A 41 ? 0.2104 0.1520 0.1153 0.0083 -0.0611 0.0076 41 VAL A CG1 169 C CG2 . VAL A 41 ? 0.2494 0.1668 0.0970 0.0583 -0.0468 -0.0228 41 VAL A CG2 170 N N . ALA A 42 ? 0.1632 0.0887 0.0707 0.0047 -0.0208 0.0231 42 ALA A N 171 C CA . ALA A 42 ? 0.1648 0.0928 0.0878 -0.0131 -0.0124 0.0284 42 ALA A CA 172 C C . ALA A 42 ? 0.1672 0.0959 0.0958 -0.0156 -0.0232 0.0213 42 ALA A C 173 O O . ALA A 42 ? 0.1828 0.0963 0.0885 -0.0137 -0.0218 0.0250 42 ALA A O 174 C CB . ALA A 42 ? 0.1776 0.1495 0.0822 0.0329 -0.0087 0.0143 42 ALA A CB 175 N N . ILE A 43 ? 0.1638 0.0852 0.1070 -0.0037 -0.0113 0.0318 43 ILE A N 176 C CA . ILE A 43 ? 0.1574 0.0869 0.1289 -0.0136 -0.0184 0.0426 43 ILE A CA 177 C C . ILE A 43 ? 0.1613 0.1091 0.1176 -0.0084 -0.0083 0.0441 43 ILE A C 178 O O . ILE A 43 ? 0.1925 0.0923 0.1413 -0.0243 0.0107 0.0338 43 ILE A O 179 C CB . ILE A 43 ? 0.1884 0.1240 0.1258 -0.0162 -0.0215 0.0197 43 ILE A CB 180 C CG1 . ILE A 43 ? 0.2358 0.1788 0.1345 0.0017 0.0112 0.0444 43 ILE A CG1 181 C CG2 . ILE A 43 ? 0.1855 0.1566 0.1808 -0.0334 -0.0595 0.0299 43 ILE A CG2 182 C CD1 . ILE A 43 ? 0.3267 0.4068 0.1239 -0.0487 0.0483 -0.0645 43 ILE A CD1 183 N N . VAL A 44 ? 0.1586 0.1095 0.1403 -0.0124 -0.0081 0.0442 44 VAL A N 184 C CA . VAL A 44 ? 0.2017 0.1136 0.1409 0.0134 0.0186 0.0454 44 VAL A CA 185 C C . VAL A 44 ? 0.1719 0.1550 0.1665 -0.0019 0.0236 0.0654 44 VAL A C 186 O O . VAL A 44 ? 0.1588 0.1405 0.1840 0.0199 0.0225 0.0702 44 VAL A O 187 C CB . VAL A 44 ? 0.2008 0.1287 0.1520 0.0053 0.0137 0.0391 44 VAL A CB 188 C CG1 . VAL A 44 ? 0.2415 0.1452 0.1612 0.0338 -0.0064 0.0408 44 VAL A CG1 189 C CG2 . VAL A 44 ? 0.2221 0.1193 0.2134 0.0135 -0.0186 0.0185 44 VAL A CG2 190 N N . ASP A 45 ? 0.1860 0.1457 0.1737 0.0015 0.0430 0.0335 45 ASP A N 191 C CA . ASP A 45 ? 0.1865 0.1424 0.2463 0.0165 0.0688 0.0532 45 ASP A CA 192 C C . ASP A 45 ? 0.2206 0.1437 0.1744 0.0267 0.0366 0.0679 45 ASP A C 193 O O . ASP A 45 ? 0.2377 0.1855 0.1772 0.0418 0.0249 0.0522 45 ASP A O 194 C CB . ASP A 45 ? 0.1745 0.1630 0.2617 0.0112 0.0537 0.0589 45 ASP A CB 195 C CG . ASP A 45 ? 0.2125 0.1903 0.2374 0.0226 0.0497 0.1181 45 ASP A CG 196 O OD1 . ASP A 45 ? 0.3027 0.2058 0.2668 -0.0132 0.0715 0.0622 45 ASP A OD1 197 O OD2 . ASP A 45 ? 0.2775 0.2984 0.3058 -0.0627 0.0990 0.0781 45 ASP A OD2 198 N N . PRO A 46 ? 0.2261 0.1329 0.2174 0.0319 0.0173 0.0579 46 PRO A N 199 C CA . PRO A 46 ? 0.2163 0.1412 0.2121 0.0214 0.0289 0.0497 46 PRO A CA 200 C C . PRO A 46 ? 0.2347 0.1503 0.2138 0.0300 0.0115 0.0522 46 PRO A C 201 O O . PRO A 46 ? 0.2465 0.1649 0.2140 0.0286 0.0030 0.0450 46 PRO A O 202 C CB . PRO A 46 ? 0.2485 0.1855 0.2163 0.0710 0.0165 0.0500 46 PRO A CB 203 C CG . PRO A 46 ? 0.2273 0.2185 0.1998 0.0539 0.0230 0.0667 46 PRO A CG 204 C CD . PRO A 46 ? 0.1906 0.1880 0.1924 0.0170 0.0475 0.0437 46 PRO A CD 205 N N . GLN A 47 ? 0.2947 0.1624 0.2221 0.0351 0.0508 0.0604 47 GLN A N 206 C CA . GLN A 47 ? 0.3119 0.2193 0.2142 0.0692 0.0965 0.0495 47 GLN A CA 207 C C . GLN A 47 ? 0.2831 0.2666 0.1737 0.0277 0.0647 0.0323 47 GLN A C 208 O O . GLN A 47 ? 0.3391 0.3707 0.1722 0.0491 0.0618 0.0176 47 GLN A O 209 C CB . GLN A 47 ? 0.2840 0.2775 0.2680 0.0850 0.0680 0.1330 47 GLN A CB 210 C CG . GLN A 47 ? 0.2866 0.3423 0.3886 0.1021 0.0341 0.1562 47 GLN A CG 211 C CD . GLN A 47 ? 0.2506 0.5382 0.3993 0.0452 0.0223 0.1885 47 GLN A CD 212 O OE1 . GLN A 47 ? 0.4528 0.6750 0.4210 0.0375 -0.0121 0.0487 47 GLN A OE1 213 N NE2 . GLN A 47 ? 0.5500 0.6551 0.6244 0.1117 -0.1543 0.3271 47 GLN A NE2 214 N N . GLY A 48 ? 0.2556 0.2567 0.1567 0.0409 0.0360 0.0544 48 GLY A N 215 C CA . GLY A 48 ? 0.2464 0.2634 0.1637 0.0188 -0.0028 0.0439 48 GLY A CA 216 C C . GLY A 48 ? 0.2711 0.2754 0.2026 0.0255 0.0228 0.1191 48 GLY A C 217 O O . GLY A 48 ? 0.3100 0.3286 0.1865 0.0715 0.0233 0.1080 48 GLY A O 218 N N . GLU A 49 ? 0.2432 0.2386 0.2461 0.0328 0.0975 0.0617 49 GLU A N 219 C CA . GLU A 49 ? 0.2525 0.2443 0.2844 0.0397 0.1088 0.1327 49 GLU A CA 220 C C . GLU A 49 ? 0.3013 0.1518 0.2651 0.0146 0.0985 0.1158 49 GLU A C 221 O O . GLU A 49 ? 0.2696 0.1608 0.2449 -0.0048 0.0473 0.0963 49 GLU A O 222 C CB . GLU A 49 ? 0.2716 0.2594 0.3414 0.0048 0.0798 0.1688 49 GLU A CB 223 C CG . GLU A 49 ? 0.2333 0.4510 0.3990 -0.0235 0.1241 0.1217 49 GLU A CG 224 C CD . GLU A 49 ? 0.2576 0.4722 0.3008 -0.1748 0.0825 -0.0333 49 GLU A CD 225 O OE1 . GLU A 49 ? 0.6144 0.6322 0.3247 -0.1738 -0.1151 -0.0027 49 GLU A OE1 226 O OE2 . GLU A 49 ? 0.2257 0.4934 0.3480 -0.0702 0.1087 0.0746 49 GLU A OE2 227 N N . ILE A 50 ? 0.2917 0.1949 0.2455 0.0333 0.0850 0.1185 50 ILE A N 228 C CA . ILE A 50 ? 0.2207 0.2015 0.2138 0.0017 0.0517 0.0995 50 ILE A CA 229 C C . ILE A 50 ? 0.1761 0.2030 0.2378 -0.0223 0.0430 0.1125 50 ILE A C 230 O O . ILE A 50 ? 0.2499 0.2505 0.2654 -0.0740 0.0614 0.1209 50 ILE A O 231 C CB . ILE A 50 ? 0.2518 0.1883 0.2237 0.0040 0.0274 0.0863 50 ILE A CB 232 C CG1 . ILE A 50 ? 0.3095 0.2171 0.2401 0.0294 -0.0040 0.0494 50 ILE A CG1 233 C CG2 . ILE A 50 ? 0.2343 0.2449 0.2119 0.0337 -0.0101 0.0605 50 ILE A CG2 234 C CD1 . ILE A 50 ? 0.4092 0.3287 0.2861 -0.0385 -0.0692 0.1477 50 ILE A CD1 235 N N . VAL A 51 ? 0.1992 0.1425 0.2179 -0.0214 0.0453 0.0749 51 VAL A N 236 C CA . VAL A 51 ? 0.1638 0.1647 0.2525 -0.0257 0.0077 0.0627 51 VAL A CA 237 C C . VAL A 51 ? 0.1801 0.1483 0.2548 -0.0275 -0.0106 0.0353 51 VAL A C 238 O O . VAL A 51 ? 0.1863 0.1643 0.4223 -0.0436 0.0011 -0.0045 51 VAL A O 239 C CB . VAL A 51 ? 0.1903 0.1725 0.2241 -0.0039 0.0126 0.0524 51 VAL A CB 240 C CG1 . VAL A 51 ? 0.1371 0.2449 0.2331 -0.0255 0.0241 0.0215 51 VAL A CG1 241 C CG2 . VAL A 51 ? 0.1782 0.1450 0.2701 -0.0201 0.0132 0.0337 51 VAL A CG2 242 N N . ALA A 52 ? 0.1742 0.1357 0.1973 -0.0179 -0.0185 0.0448 52 ALA A N 243 C CA . ALA A 52 ? 0.1770 0.1403 0.1715 -0.0324 -0.0113 0.0227 52 ALA A CA 244 C C . ALA A 52 ? 0.1766 0.1048 0.1883 -0.0272 -0.0152 0.0278 52 ALA A C 245 O O . ALA A 52 ? 0.1849 0.1025 0.2059 -0.0182 -0.0103 0.0234 52 ALA A O 246 C CB . ALA A 52 ? 0.2560 0.2841 0.1814 -0.0380 -0.0124 -0.0246 52 ALA A CB 247 N N . GLY A 53 ? 0.2130 0.0968 0.1631 -0.0224 -0.0620 0.0163 53 GLY A N 248 C CA . GLY A 53 ? 0.2039 0.0998 0.2774 0.0087 -0.0846 -0.0413 53 GLY A CA 249 C C . GLY A 53 ? 0.2102 0.0827 0.1411 -0.0009 -0.0458 -0.0145 53 GLY A C 250 O O . GLY A 53 ? 0.2113 0.0896 0.2050 -0.0055 -0.0541 -0.0236 53 GLY A O 251 N N . HIS A 54 ? 0.1983 0.0921 0.1009 0.0042 -0.0570 0.0093 54 HIS A N 252 C CA . HIS A 54 ? 0.2074 0.0981 0.1071 0.0072 -0.0535 -0.0088 54 HIS A CA 253 C C . HIS A 54 ? 0.1905 0.0841 0.0842 0.0035 -0.0360 0.0119 54 HIS A C 254 O O . HIS A 54 ? 0.2179 0.0954 0.0782 -0.0018 -0.0496 0.0211 54 HIS A O 255 C CB . HIS A 54 ? 0.2363 0.1175 0.1043 0.0215 -0.0536 -0.0076 54 HIS A CB 256 C CG . HIS A 54 ? 0.2268 0.1088 0.1104 0.0194 -0.0585 -0.0175 54 HIS A CG 257 N ND1 . HIS A 54 ? 0.2676 0.1128 0.1885 0.0191 -0.0328 -0.0189 54 HIS A ND1 258 C CD2 . HIS A 54 ? 0.2277 0.1557 0.1154 0.0058 -0.0643 -0.0106 54 HIS A CD2 259 C CE1 . HIS A 54 ? 0.3046 0.1396 0.1510 0.0681 -0.0592 -0.0416 54 HIS A CE1 260 N NE2 . HIS A 54 ? 0.2541 0.2246 0.2035 0.0646 -0.0208 -0.0084 54 HIS A NE2 261 N N . ARG A 55 ? 0.2096 0.0788 0.1025 0.0009 -0.0566 0.0129 55 ARG A N 262 C CA . ARG A 55 ? 0.2184 0.1084 0.0707 -0.0053 -0.0380 0.0042 55 ARG A CA 263 C C . ARG A 55 ? 0.1948 0.0897 0.0797 0.0085 -0.0640 0.0170 55 ARG A C 264 O O . ARG A 55 ? 0.1944 0.0929 0.0951 0.0082 -0.0559 0.0116 55 ARG A O 265 C CB . ARG A 55 ? 0.1922 0.1144 0.1064 0.0101 -0.0499 0.0274 55 ARG A CB 266 C CG . ARG A 55 ? 0.2249 0.1523 0.1152 0.0395 -0.0462 0.0207 55 ARG A CG 267 C CD . ARG A 55 ? 0.1719 0.2119 0.1525 0.0196 -0.0636 -0.0302 55 ARG A CD 268 N NE . ARG A 55 ? 0.2435 0.2435 0.1395 0.0712 -0.0457 -0.0110 55 ARG A NE 269 C CZ . ARG A 55 ? 0.2866 0.1507 0.1757 0.0670 -0.0805 0.0127 55 ARG A CZ 270 N NH1 . ARG A 55 ? 0.4470 0.3056 0.2376 0.1758 -0.1886 -0.0690 55 ARG A NH1 271 N NH2 . ARG A 55 ? 0.2949 0.2052 0.2123 0.0814 -0.0485 -0.0056 55 ARG A NH2 272 N N . MET A 56 ? 0.2063 0.0907 0.0804 -0.0011 -0.0453 0.0052 56 MET A N 273 C CA . MET A 56 ? 0.2138 0.0768 0.1094 0.0080 -0.0530 0.0151 56 MET A CA 274 C C . MET A 56 ? 0.1974 0.0951 0.0845 0.0179 -0.0279 0.0154 56 MET A C 275 O O . MET A 56 ? 0.2261 0.0839 0.1151 0.0175 -0.0580 0.0035 56 MET A O 276 C CB . MET A 56 ? 0.2059 0.1217 0.1426 0.0063 -0.0525 0.0283 56 MET A CB 277 C CG . MET A 56 ? 0.2261 0.1704 0.1443 -0.0293 -0.0629 0.0377 56 MET A CG 278 S SD . MET A 56 ? 0.2451 0.3466 0.2492 -0.0878 -0.0112 0.0363 56 MET A SD 279 C CE . MET A 56 ? 0.3292 0.2434 0.2979 -0.1019 -0.1665 0.0438 56 MET A CE 280 N N . ALA A 57 ? 0.2154 0.0762 0.0977 0.0038 -0.0523 0.0041 57 ALA A N 281 C CA . ALA A 57 ? 0.2314 0.0832 0.0976 0.0073 -0.0504 -0.0082 57 ALA A CA 282 C C . ALA A 57 ? 0.2353 0.0975 0.0807 -0.0098 -0.0563 0.0164 57 ALA A C 283 O O . ALA A 57 ? 0.2338 0.1212 0.0719 0.0122 -0.0409 0.0121 57 ALA A O 284 C CB . ALA A 57 ? 0.2278 0.1334 0.1093 0.0292 -0.0293 0.0158 57 ALA A CB 285 N N . GLN A 58 ? 0.2164 0.0852 0.0797 -0.0077 -0.0645 0.0007 58 GLN A N 286 C CA . GLN A 58 ? 0.2158 0.0857 0.0892 0.0080 -0.0741 0.0137 58 GLN A CA 287 C C . GLN A 58 ? 0.2152 0.0883 0.0905 -0.0107 -0.0664 0.0118 58 GLN A C 288 O O . GLN A 58 ? 0.2150 0.0904 0.0814 -0.0027 -0.0560 0.0166 58 GLN A O 289 C CB . GLN A 58 ? 0.2316 0.0982 0.0783 0.0131 -0.0543 0.0229 58 GLN A CB 290 C CG . GLN A 58 ? 0.2174 0.1042 0.1642 0.0330 -0.0663 -0.0136 58 GLN A CG 291 C CD . GLN A 58 ? 0.2477 0.1132 0.1305 0.0641 -0.0570 0.0188 58 GLN A CD 292 O OE1 . GLN A 58 ? 0.2736 0.1624 0.1548 0.0539 -0.0879 -0.0510 58 GLN A OE1 293 N NE2 . GLN A 58 ? 0.2238 0.2219 0.1969 0.0631 -0.0451 0.0012 58 GLN A NE2 294 N N . ARG A 59 ? 0.1849 0.0887 0.0752 0.0039 -0.0468 0.0110 59 ARG A N 295 C CA . ARG A 59 ? 0.1952 0.0869 0.0811 -0.0036 -0.0394 -0.0006 59 ARG A CA 296 C C . ARG A 59 ? 0.1702 0.0782 0.1056 0.0071 -0.0320 0.0134 59 ARG A C 297 O O . ARG A 59 ? 0.2139 0.1065 0.1018 0.0463 -0.0353 0.0126 59 ARG A O 298 C CB . ARG A 59 ? 0.1951 0.1101 0.1044 -0.0160 -0.0532 0.0092 59 ARG A CB 299 C CG A ARG A 59 ? 0.2488 0.1712 0.1166 -0.0211 -0.0470 -0.0680 59 ARG A CG 300 C CG B ARG A 59 ? 0.2482 0.1643 0.0400 0.0036 -0.0902 0.0307 59 ARG A CG 301 C CD A ARG A 59 ? 0.3427 0.2759 0.1207 0.0042 -0.0169 -0.0029 59 ARG A CD 302 C CD B ARG A 59 ? 0.2119 0.1335 0.0529 0.0378 -0.0494 0.0024 59 ARG A CD 303 N NE A ARG A 59 ? 0.3765 0.1432 0.1583 -0.0381 0.0142 -0.0370 59 ARG A NE 304 N NE B ARG A 59 ? 0.1914 0.1136 0.0644 0.0269 -0.0467 0.0023 59 ARG A NE 305 C CZ A ARG A 59 ? 0.4067 0.1467 0.2449 -0.0718 0.0766 -0.0578 59 ARG A CZ 306 C CZ B ARG A 59 ? 0.1664 0.0888 0.0935 0.0009 -0.0652 -0.0030 59 ARG A CZ 307 N NH1 A ARG A 59 ? 0.2562 0.0733 0.0677 0.0379 -0.1005 0.0459 59 ARG A NH1 308 N NH1 B ARG A 59 ? 0.1962 0.1163 0.0732 0.0045 -0.0431 -0.0037 59 ARG A NH1 309 N NH2 A ARG A 59 ? 0.2338 0.1102 0.1141 -0.0089 -0.0750 -0.0202 59 ARG A NH2 310 N NH2 B ARG A 59 ? 0.1358 0.1470 0.0703 0.0310 -0.0102 0.0234 59 ARG A NH2 311 N N . PHE A 60 ? 0.1744 0.0879 0.0673 0.0178 -0.0325 0.0021 60 PHE A N 312 C CA . PHE A 60 ? 0.2129 0.0946 0.0611 0.0072 -0.0185 0.0002 60 PHE A CA 313 C C . PHE A 60 ? 0.1974 0.0855 0.0839 0.0145 -0.0274 0.0095 60 PHE A C 314 O O . PHE A 60 ? 0.2105 0.0963 0.0958 0.0290 -0.0331 0.0061 60 PHE A O 315 C CB . PHE A 60 ? 0.1858 0.1022 0.0775 0.0066 -0.0363 0.0098 60 PHE A CB 316 C CG . PHE A 60 ? 0.2088 0.0949 0.0686 0.0021 -0.0284 0.0155 60 PHE A CG 317 C CD1 . PHE A 60 ? 0.1940 0.1054 0.0675 0.0124 -0.0285 0.0229 60 PHE A CD1 318 C CD2 . PHE A 60 ? 0.1872 0.0999 0.1220 0.0184 -0.0159 0.0066 60 PHE A CD2 319 C CE1 . PHE A 60 ? 0.2055 0.1043 0.1059 -0.0098 -0.0696 0.0282 60 PHE A CE1 320 C CE2 . PHE A 60 ? 0.2073 0.1094 0.1341 0.0378 -0.0471 -0.0156 60 PHE A CE2 321 C CZ . PHE A 60 ? 0.2543 0.0882 0.1262 0.0129 -0.0703 0.0028 60 PHE A CZ 322 N N . ALA A 61 ? 0.1846 0.1015 0.0879 0.0086 -0.0451 0.0117 61 ALA A N 323 C CA . ALA A 61 ? 0.1856 0.0903 0.0922 0.0147 -0.0396 -0.0020 61 ALA A CA 324 C C . ALA A 61 ? 0.1719 0.0992 0.0998 0.0077 -0.0388 0.0120 61 ALA A C 325 O O . ALA A 61 ? 0.2264 0.0959 0.1145 0.0178 -0.0614 0.0107 61 ALA A O 326 C CB . ALA A 61 ? 0.1692 0.1193 0.1681 0.0084 -0.0462 0.0166 61 ALA A CB 327 N N . MET A 62 ? 0.2040 0.0903 0.1279 0.0159 -0.0354 0.0076 62 MET A N 328 C CA . MET A 62 ? 0.2053 0.1161 0.1521 0.0178 -0.0663 -0.0032 62 MET A CA 329 C C . MET A 62 ? 0.2231 0.1000 0.1636 0.0040 -0.0874 0.0223 62 MET A C 330 O O . MET A 62 ? 0.2458 0.0954 0.2001 0.0012 -0.1222 0.0128 62 MET A O 331 C CB . MET A 62 ? 0.2221 0.1378 0.2288 0.0457 -0.0182 0.0005 62 MET A CB 332 C CG . MET A 62 ? 0.2253 0.1748 0.2087 -0.0009 -0.0210 -0.0283 62 MET A CG 333 S SD . MET A 62 ? 0.2787 0.1183 0.1344 0.0178 -0.0243 0.0197 62 MET A SD 334 C CE . MET A 62 ? 0.3360 0.2696 0.1832 0.0762 -0.1297 -0.0812 62 MET A CE 335 N N A CYS A 63 ? 0.2263 0.1218 0.2015 -0.0112 -0.1023 0.0433 63 CYS A N 336 N N B CYS A 63 ? 0.2452 0.1013 0.1911 -0.0205 -0.1118 0.0343 63 CYS A N 337 C CA A CYS A 63 ? 0.2304 0.0985 0.1781 -0.0362 -0.1257 0.0239 63 CYS A CA 338 C CA B CYS A 63 ? 0.2037 0.1269 0.1828 0.0346 -0.0378 0.0464 63 CYS A CA 339 C C A CYS A 63 ? 0.2625 0.0987 0.1448 -0.0102 -0.1053 0.0049 63 CYS A C 340 C C B CYS A 63 ? 0.1997 0.0730 0.1225 0.0175 -0.0764 -0.0254 63 CYS A C 341 O O A CYS A 63 ? 0.2942 0.1224 0.1193 -0.0118 -0.1178 0.0127 63 CYS A O 342 O O B CYS A 63 ? 0.1984 0.0710 0.1222 0.0167 -0.0666 0.0149 63 CYS A O 343 C CB A CYS A 63 ? 0.2598 0.0966 0.2370 -0.0138 -0.0423 0.0137 63 CYS A CB 344 C CB B CYS A 63 ? 0.1941 0.1852 0.2692 0.0436 -0.0296 -0.0275 63 CYS A CB 345 S SG A CYS A 63 ? 0.2733 0.1230 0.3046 0.0084 -0.1146 0.0188 63 CYS A SG 346 S SG B CYS A 63 ? 0.2693 0.2280 0.2716 0.0561 -0.0433 -0.0575 63 CYS A SG 347 N N . SER A 64 ? 0.1947 0.1064 0.1391 0.0178 -0.0389 0.0191 64 SER A N 348 C CA . SER A 64 ? 0.1994 0.0844 0.1267 0.0015 -0.0505 0.0097 64 SER A CA 349 C C . SER A 64 ? 0.1942 0.0831 0.1085 0.0126 -0.0459 0.0278 64 SER A C 350 O O . SER A 64 ? 0.2078 0.0795 0.1155 0.0148 -0.0387 0.0248 64 SER A O 351 C CB . SER A 64 ? 0.1985 0.1290 0.1314 -0.0189 -0.0506 0.0290 64 SER A CB 352 O OG . SER A 64 ? 0.2194 0.1375 0.1917 -0.0328 -0.0251 0.0088 64 SER A OG 353 N N . THR A 65 ? 0.1650 0.0876 0.1178 0.0174 -0.0336 0.0213 65 THR A N 354 C CA . THR A 65 ? 0.1754 0.0871 0.0861 0.0206 -0.0259 0.0177 65 THR A CA 355 C C . THR A 65 ? 0.1785 0.0819 0.1037 0.0055 -0.0169 -0.0001 65 THR A C 356 O O . THR A 65 ? 0.1861 0.1052 0.0974 0.0121 -0.0190 0.0086 65 THR A O 357 C CB . THR A 65 ? 0.1633 0.0834 0.1004 0.0218 -0.0354 0.0022 65 THR A CB 358 O OG1 . THR A 65 ? 0.2139 0.0803 0.1123 0.0111 -0.0508 0.0172 65 THR A OG1 359 C CG2 . THR A 65 ? 0.1668 0.0886 0.1126 0.0344 -0.0260 0.0043 65 THR A CG2 360 N N . PHE A 66 ? 0.2088 0.0911 0.0891 0.0152 -0.0306 0.0175 66 PHE A N 361 C CA . PHE A 66 ? 0.2330 0.1114 0.0782 0.0212 -0.0399 0.0106 66 PHE A CA 362 C C . PHE A 66 ? 0.2327 0.0926 0.0861 0.0161 -0.0364 0.0028 66 PHE A C 363 O O . PHE A 66 ? 0.2312 0.1028 0.0862 0.0023 -0.0291 -0.0078 66 PHE A O 364 C CB . PHE A 66 ? 0.2295 0.1137 0.1060 0.0325 -0.0467 -0.0121 66 PHE A CB 365 C CG . PHE A 66 ? 0.3047 0.0972 0.1023 0.0124 -0.0832 -0.0010 66 PHE A CG 366 C CD1 . PHE A 66 ? 0.2711 0.1260 0.1236 -0.0152 -0.1077 0.0301 66 PHE A CD1 367 C CD2 . PHE A 66 ? 0.3799 0.1132 0.1474 0.0416 -0.1291 -0.0277 66 PHE A CD2 368 C CE1 . PHE A 66 ? 0.3989 0.2135 0.1613 -0.1164 -0.1497 0.0872 66 PHE A CE1 369 C CE2 . PHE A 66 ? 0.4951 0.0935 0.2562 0.0079 -0.2224 -0.0138 66 PHE A CE2 370 C CZ . PHE A 66 ? 0.4656 0.1260 0.2652 -0.0975 -0.2544 0.0783 66 PHE A CZ 371 N N . LYS A 67 ? 0.1802 0.0834 0.0899 0.0074 -0.0403 0.0007 67 LYS A N 372 C CA . LYS A 67 ? 0.1822 0.0728 0.1026 0.0105 -0.0375 0.0053 67 LYS A CA 373 C C . LYS A 67 ? 0.1860 0.0925 0.1161 0.0083 -0.0357 -0.0201 67 LYS A C 374 O O . LYS A 67 ? 0.1796 0.0968 0.0974 0.0129 -0.0249 0.0001 67 LYS A O 375 C CB . LYS A 67 ? 0.1833 0.0830 0.1036 -0.0043 -0.0418 0.0019 67 LYS A CB 376 C CG . LYS A 67 ? 0.1744 0.0789 0.1132 0.0206 -0.0404 0.0015 67 LYS A CG 377 C CD . LYS A 67 ? 0.1864 0.1075 0.1046 0.0081 -0.0388 -0.0078 67 LYS A CD 378 C CE . LYS A 67 ? 0.1762 0.1002 0.1640 -0.0213 -0.0413 0.0247 67 LYS A CE 379 N NZ . LYS A 67 ? 0.1726 0.1279 0.1498 -0.0173 -0.0595 0.0206 67 LYS A NZ 380 N N . PHE A 68 ? 0.1751 0.1050 0.1036 0.0000 -0.0061 -0.0302 68 PHE A N 381 C CA . PHE A 68 ? 0.1771 0.0966 0.0920 0.0012 0.0132 -0.0040 68 PHE A CA 382 C C . PHE A 68 ? 0.1725 0.0956 0.0752 -0.0041 -0.0250 -0.0095 68 PHE A C 383 O O . PHE A 68 ? 0.1956 0.1041 0.0826 0.0037 -0.0189 -0.0150 68 PHE A O 384 C CB . PHE A 68 ? 0.1653 0.1100 0.0874 0.0063 -0.0096 -0.0090 68 PHE A CB 385 C CG . PHE A 68 ? 0.1622 0.1539 0.1077 -0.0032 -0.0157 0.0037 68 PHE A CG 386 C CD1 . PHE A 68 ? 0.2181 0.1311 0.3132 -0.0343 0.0062 0.0529 68 PHE A CD1 387 C CD2 . PHE A 68 ? 0.1715 0.2366 0.2478 0.0249 -0.0310 -0.0904 68 PHE A CD2 388 C CE1 . PHE A 68 ? 0.2232 0.1590 0.2931 -0.0357 -0.0359 0.0392 68 PHE A CE1 389 C CE2 . PHE A 68 ? 0.1519 0.3491 0.2831 0.0224 -0.0324 -0.1984 68 PHE A CE2 390 C CZ . PHE A 68 ? 0.2247 0.2774 0.3188 -0.0300 0.0333 0.0052 68 PHE A CZ 391 N N . PRO A 69 ? 0.2282 0.0832 0.0878 -0.0053 -0.0032 -0.0007 69 PRO A N 392 C CA . PRO A 69 ? 0.2473 0.0993 0.0890 0.0046 0.0048 0.0043 69 PRO A CA 393 C C . PRO A 69 ? 0.2364 0.0977 0.0801 0.0123 -0.0174 0.0029 69 PRO A C 394 O O . PRO A 69 ? 0.2680 0.1217 0.0886 0.0152 -0.0073 -0.0189 69 PRO A O 395 C CB . PRO A 69 ? 0.3910 0.1077 0.1121 0.0315 -0.0137 0.0258 69 PRO A CB 396 C CG . PRO A 69 ? 0.3917 0.1136 0.1294 0.0517 0.0001 0.0311 69 PRO A CG 397 C CD . PRO A 69 ? 0.2412 0.0839 0.1235 0.0015 0.0066 0.0098 69 PRO A CD 398 N N . LEU A 70 ? 0.2341 0.0852 0.0808 0.0179 -0.0173 0.0060 70 LEU A N 399 C CA . LEU A 70 ? 0.2379 0.0956 0.0893 0.0092 -0.0211 -0.0074 70 LEU A CA 400 C C . LEU A 70 ? 0.2161 0.0807 0.0897 0.0030 -0.0131 -0.0135 70 LEU A C 401 O O . LEU A 70 ? 0.2333 0.0924 0.1006 -0.0062 -0.0137 -0.0238 70 LEU A O 402 C CB . LEU A 70 ? 0.2234 0.1002 0.0930 0.0169 -0.0220 -0.0224 70 LEU A CB 403 C CG . LEU A 70 ? 0.2409 0.0946 0.1173 0.0119 -0.0202 -0.0215 70 LEU A CG 404 C CD1 . LEU A 70 ? 0.2644 0.1230 0.1296 0.0135 -0.0520 -0.0386 70 LEU A CD1 405 C CD2 . LEU A 70 ? 0.2248 0.1149 0.1678 0.0128 -0.0254 0.0115 70 LEU A CD2 406 N N . ALA A 71 ? 0.2079 0.0896 0.0912 -0.0073 -0.0222 -0.0128 71 ALA A N 407 C CA . ALA A 71 ? 0.2199 0.0903 0.0796 0.0196 0.0025 -0.0200 71 ALA A CA 408 C C . ALA A 71 ? 0.2172 0.0957 0.0672 0.0164 -0.0136 -0.0123 71 ALA A C 409 O O . ALA A 71 ? 0.1966 0.1049 0.0908 0.0111 -0.0121 -0.0197 71 ALA A O 410 C CB . ALA A 71 ? 0.2208 0.1148 0.0791 0.0161 -0.0021 -0.0174 71 ALA A CB 411 N N . ALA A 72 ? 0.1876 0.1065 0.0985 0.0088 -0.0087 -0.0155 72 ALA A N 412 C CA . ALA A 72 ? 0.1798 0.1085 0.1119 0.0015 -0.0102 -0.0144 72 ALA A CA 413 C C . ALA A 72 ? 0.1951 0.1208 0.0897 0.0055 -0.0010 0.0026 72 ALA A C 414 O O . ALA A 72 ? 0.2021 0.1503 0.1283 0.0162 0.0151 -0.0140 72 ALA A O 415 C CB . ALA A 72 ? 0.1622 0.1131 0.1426 0.0126 0.0087 -0.0068 72 ALA A CB 416 N N . LEU A 73 ? 0.2126 0.1030 0.1078 0.0108 -0.0178 -0.0150 73 LEU A N 417 C CA . LEU A 73 ? 0.2485 0.1206 0.0947 0.0148 -0.0257 -0.0082 73 LEU A CA 418 C C . LEU A 73 ? 0.2337 0.1083 0.0972 0.0115 0.0078 -0.0110 73 LEU A C 419 O O . LEU A 73 ? 0.2433 0.1434 0.0960 0.0037 0.0087 -0.0313 73 LEU A O 420 C CB . LEU A 73 ? 0.2412 0.1314 0.1282 0.0161 -0.0372 -0.0348 73 LEU A CB 421 C CG A LEU A 73 ? 0.2877 0.1342 0.0800 0.0274 -0.0417 0.0036 73 LEU A CG 422 C CG B LEU A 73 ? 0.3219 0.1775 0.0867 0.0643 -0.0727 -0.0365 73 LEU A CG 423 C CD1 A LEU A 73 ? 0.2551 0.0782 0.0887 -0.0146 -0.0302 0.0036 73 LEU A CD1 424 C CD1 B LEU A 73 ? 0.3632 0.1411 0.1019 -0.0100 -0.0483 -0.0239 73 LEU A CD1 425 C CD2 A LEU A 73 ? 0.2854 0.1002 0.1416 0.0674 -0.0026 -0.0788 73 LEU A CD2 426 C CD2 B LEU A 73 ? 0.3093 0.1228 0.1653 -0.0122 -0.1077 0.0433 73 LEU A CD2 427 N N . VAL A 74 ? 0.2165 0.1124 0.0955 0.0182 0.0007 -0.0122 74 VAL A N 428 C CA . VAL A 74 ? 0.1915 0.1180 0.1245 0.0096 -0.0004 0.0040 74 VAL A CA 429 C C . VAL A 74 ? 0.1787 0.0930 0.1264 0.0012 0.0130 -0.0090 74 VAL A C 430 O O . VAL A 74 ? 0.2361 0.0958 0.1364 0.0126 0.0084 -0.0205 74 VAL A O 431 C CB . VAL A 74 ? 0.1859 0.0993 0.1502 0.0014 0.0236 -0.0148 74 VAL A CB 432 C CG1 . VAL A 74 ? 0.2658 0.1010 0.1712 0.0064 0.0555 0.0140 74 VAL A CG1 433 C CG2 . VAL A 74 ? 0.1886 0.1715 0.1899 -0.0138 0.0056 -0.0303 74 VAL A CG2 434 N N . PHE A 75 ? 0.1871 0.1076 0.1152 -0.0143 0.0251 -0.0150 75 PHE A N 435 C CA . PHE A 75 ? 0.1818 0.1022 0.1205 -0.0154 0.0279 -0.0176 75 PHE A CA 436 C C . PHE A 75 ? 0.1856 0.1233 0.1258 0.0051 0.0256 -0.0358 75 PHE A C 437 O O . PHE A 75 ? 0.1846 0.1454 0.1870 0.0039 0.0382 -0.0524 75 PHE A O 438 C CB . PHE A 75 ? 0.1981 0.1074 0.1270 -0.0149 0.0074 -0.0137 75 PHE A CB 439 C CG . PHE A 75 ? 0.1826 0.1384 0.1199 -0.0178 -0.0003 -0.0121 75 PHE A CG 440 C CD1 . PHE A 75 ? 0.2086 0.2334 0.1412 0.0612 0.0106 0.0154 75 PHE A CD1 441 C CD2 . PHE A 75 ? 0.2295 0.1346 0.1553 -0.0025 0.0247 0.0109 75 PHE A CD2 442 C CE1 . PHE A 75 ? 0.2340 0.2725 0.1548 0.0649 0.0571 0.0227 75 PHE A CE1 443 C CE2 . PHE A 75 ? 0.2154 0.1766 0.1673 -0.0037 0.0192 0.0357 75 PHE A CE2 444 C CZ . PHE A 75 ? 0.2619 0.2508 0.1469 0.0295 0.0330 0.0414 75 PHE A CZ 445 N N . GLU A 76 ? 0.2176 0.1526 0.1144 -0.0141 0.0340 -0.0155 76 GLU A N 446 C CA . GLU A 76 ? 0.1929 0.1712 0.1255 -0.0194 0.0469 -0.0332 76 GLU A CA 447 C C . GLU A 76 ? 0.1907 0.1743 0.1178 -0.0192 0.0215 -0.0345 76 GLU A C 448 O O . GLU A 76 ? 0.2307 0.1737 0.1762 -0.0170 0.0694 -0.0403 76 GLU A O 449 C CB . GLU A 76 ? 0.3247 0.1740 0.1413 -0.0186 0.0668 -0.0033 76 GLU A CB 450 C CG . GLU A 76 ? 0.4893 0.2599 0.1935 -0.0928 0.1480 0.0139 76 GLU A CG 451 C CD . GLU A 76 ? 0.5320 0.5856 0.1577 -0.1041 0.1403 0.0252 76 GLU A CD 452 O OE1 . GLU A 76 ? 0.4957 0.8241 0.4780 0.0892 0.1665 0.3814 76 GLU A OE1 453 O OE2 . GLU A 76 ? 0.5877 1.1080 0.3191 -0.3029 0.0686 0.0104 76 GLU A OE2 454 N N . ARG A 77 ? 0.1996 0.1406 0.1139 -0.0093 0.0244 -0.0143 77 ARG A N 455 C CA . ARG A 77 ? 0.2383 0.1410 0.1257 -0.0234 0.0248 -0.0169 77 ARG A CA 456 C C . ARG A 77 ? 0.2364 0.1444 0.1209 -0.0042 0.0218 -0.0383 77 ARG A C 457 O O . ARG A 77 ? 0.3094 0.1440 0.1432 -0.0010 0.0336 -0.0549 77 ARG A O 458 C CB . ARG A 77 ? 0.2429 0.1613 0.1377 -0.0275 -0.0078 -0.0324 77 ARG A CB 459 C CG . ARG A 77 ? 0.3125 0.3001 0.1037 0.0444 -0.0292 -0.0237 77 ARG A CG 460 C CD . ARG A 77 ? 0.2731 0.4714 0.3950 0.0348 -0.0791 -0.0637 77 ARG A CD 461 N NE . ARG A 77 ? 0.5074 0.5171 0.4256 -0.1359 -0.2429 -0.0072 77 ARG A NE 462 C CZ . ARG A 77 ? 0.7336 0.6257 0.4238 -0.1222 -0.2590 -0.0509 77 ARG A CZ 463 N NH1 . ARG A 77 ? 1.1438 0.5971 0.4614 -0.2586 -0.5283 -0.0591 77 ARG A NH1 464 N NH2 . ARG A 77 ? 0.6752 0.6941 0.3035 -0.4254 -0.2210 0.0636 77 ARG A NH2 465 N N . ILE A 78 ? 0.2255 0.1493 0.1208 -0.0081 0.0337 -0.0177 78 ILE A N 466 C CA . ILE A 78 ? 0.2184 0.1409 0.1393 -0.0049 0.0254 -0.0214 78 ILE A CA 467 C C . ILE A 78 ? 0.2209 0.1422 0.1412 -0.0150 0.0297 -0.0618 78 ILE A C 468 O O . ILE A 78 ? 0.2240 0.1707 0.1806 0.0166 0.0182 -0.0614 78 ILE A O 469 C CB . ILE A 78 ? 0.2457 0.1583 0.1336 0.0092 0.0340 -0.0004 78 ILE A CB 470 C CG1 . ILE A 78 ? 0.2201 0.1728 0.1422 0.0099 0.0173 -0.0124 78 ILE A CG1 471 C CG2 . ILE A 78 ? 0.2160 0.2677 0.1390 0.0157 0.0357 -0.0056 78 ILE A CG2 472 C CD1 . ILE A 78 ? 0.2532 0.1787 0.1304 0.0051 0.0284 0.0106 78 ILE A CD1 473 N N . ASP A 79 ? 0.2348 0.1623 0.1668 -0.0240 0.0481 -0.0428 79 ASP A N 474 C CA . ASP A 79 ? 0.2360 0.1552 0.1843 -0.0101 0.0554 -0.0224 79 ASP A CA 475 C C . ASP A 79 ? 0.2049 0.1794 0.2030 -0.0123 0.0584 -0.0526 79 ASP A C 476 O O . ASP A 79 ? 0.2156 0.1749 0.2837 0.0000 0.0620 -0.0614 79 ASP A O 477 C CB . ASP A 79 ? 0.2144 0.1536 0.1655 -0.0013 0.0301 -0.0134 79 ASP A CB 478 C CG . ASP A 79 ? 0.2383 0.1621 0.1702 0.0186 0.0313 -0.0248 79 ASP A CG 479 O OD1 . ASP A 79 ? 0.2919 0.1647 0.1724 0.0224 0.0046 -0.0238 79 ASP A OD1 480 O OD2 . ASP A 79 ? 0.1856 0.1595 0.1782 -0.0020 0.0072 -0.0160 79 ASP A OD2 481 N N . SER A 80 ? 0.2061 0.2648 0.2085 0.0066 0.0516 -0.1017 80 SER A N 482 C CA . SER A 80 ? 0.2477 0.2796 0.1774 -0.0470 0.0919 -0.0620 80 SER A CA 483 C C . SER A 80 ? 0.3720 0.2678 0.1378 -0.0203 0.0164 -0.0588 80 SER A C 484 O O . SER A 80 ? 0.3560 0.3116 0.2086 0.0005 0.1016 -0.0900 80 SER A O 485 C CB . SER A 80 ? 0.5444 0.3037 0.2003 0.1115 0.0080 -0.1062 80 SER A CB 486 O OG . SER A 80 ? 0.7716 0.2913 0.3272 0.0703 0.1113 -0.0429 80 SER A OG 487 N N . GLY A 81 ? 0.3489 0.2272 0.1709 -0.0223 0.0546 -0.0777 81 GLY A N 488 C CA . GLY A 81 ? 0.4440 0.2269 0.2253 -0.0238 0.0054 -0.0804 81 GLY A CA 489 C C . GLY A 81 ? 0.4668 0.2063 0.1725 -0.0581 -0.0009 -0.0779 81 GLY A C 490 O O . GLY A 81 ? 0.6397 0.2260 0.3166 -0.0725 -0.0877 -0.1497 81 GLY A O 491 N N . THR A 82 ? 0.3643 0.2494 0.1760 -0.0601 0.0952 -0.0872 82 THR A N 492 C CA . THR A 82 ? 0.3724 0.2564 0.1825 -0.0743 0.0995 -0.0965 82 THR A CA 493 C C . THR A 82 ? 0.3493 0.2939 0.1639 -0.0671 0.0715 -0.0764 82 THR A C 494 O O . THR A 82 ? 0.3552 0.3039 0.2022 -0.0925 0.0578 -0.0277 82 THR A O 495 C CB . THR A 82 ? 0.3989 0.3349 0.1559 -0.0798 0.0702 -0.0694 82 THR A CB 496 O OG1 . THR A 82 ? 0.3792 0.2950 0.1939 0.0049 0.0283 -0.0506 82 THR A OG1 497 C CG2 . THR A 82 ? 0.4014 0.3588 0.1924 -0.1000 0.0943 -0.0637 82 THR A CG2 498 N N . GLU A 83 ? 0.3921 0.2425 0.1658 -0.1165 0.0741 -0.0906 83 GLU A N 499 C CA . GLU A 83 ? 0.2627 0.2478 0.1579 -0.0734 0.0321 -0.0774 83 GLU A CA 500 C C . GLU A 83 ? 0.2451 0.1616 0.1949 -0.0532 0.0499 -0.0813 83 GLU A C 501 O O . GLU A 83 ? 0.2389 0.2086 0.2149 -0.0476 0.0515 -0.0512 83 GLU A O 502 C CB . GLU A 83 ? 0.3724 0.2122 0.1058 -0.0057 0.0170 -0.0038 83 GLU A CB 503 C CG . GLU A 83 ? 0.2996 0.1884 0.1466 0.0251 0.0129 -0.0196 83 GLU A CG 504 C CD . GLU A 83 ? 0.3071 0.2307 0.2111 0.0021 -0.0052 -0.0270 83 GLU A CD 505 O OE1 . GLU A 83 ? 0.2421 0.2176 0.2097 -0.0217 0.0012 -0.0421 83 GLU A OE1 506 O OE2 . GLU A 83 ? 0.2910 0.2449 0.3235 -0.0233 -0.0156 0.0340 83 GLU A OE2 507 N N . ARG A 84 ? 0.2564 0.2041 0.1779 -0.0700 0.0515 -0.0763 84 ARG A N 508 C CA . ARG A 84 ? 0.2203 0.1570 0.2268 -0.0357 0.0639 -0.0624 84 ARG A CA 509 C C . ARG A 84 ? 0.1767 0.0924 0.1919 0.0136 0.0328 -0.0099 84 ARG A C 510 O O . ARG A 84 ? 0.1884 0.1349 0.2153 -0.0050 0.0339 -0.0331 84 ARG A O 511 C CB . ARG A 84 ? 0.2062 0.1569 0.3823 -0.0053 0.1472 -0.0963 84 ARG A CB 512 C CG . ARG A 84 ? 0.2267 0.1551 0.6996 -0.0283 0.0316 -0.0450 84 ARG A CG 513 C CD . ARG A 84 ? 0.2710 0.1294 0.7609 -0.0275 0.0264 -0.0260 84 ARG A CD 514 N NE A ARG A 84 ? 0.2282 0.1134 0.7529 0.0167 0.1092 -0.0958 84 ARG A NE 515 N NE B ARG A 84 ? 0.2529 0.1490 0.7306 -0.0197 0.0658 -0.0741 84 ARG A NE 516 C CZ A ARG A 84 ? 0.2838 0.1829 0.7636 0.0545 0.1277 -0.0363 84 ARG A CZ 517 C CZ B ARG A 84 ? 0.2002 0.1570 0.8005 0.0484 0.0776 -0.1892 84 ARG A CZ 518 N NH1 A ARG A 84 ? 0.3141 0.4078 0.7841 0.0306 0.2117 -0.2025 84 ARG A NH1 519 N NH1 B ARG A 84 ? 0.2309 0.2475 0.7574 -0.1616 0.0730 -0.2942 84 ARG A NH1 520 N NH2 A ARG A 84 ? 0.3105 0.1634 0.7537 0.0236 0.2327 -0.1221 84 ARG A NH2 521 N NH2 B ARG A 84 ? 0.2816 0.2357 0.7160 -0.0362 0.1239 -0.2839 84 ARG A NH2 522 N N . GLY A 85 ? 0.1773 0.1436 0.2101 -0.0076 0.0500 -0.0496 85 GLY A N 523 C CA . GLY A 85 ? 0.1579 0.1279 0.2176 -0.0036 0.0420 -0.0518 85 GLY A CA 524 C C . GLY A 85 ? 0.1297 0.1377 0.1812 0.0273 0.0155 -0.0266 85 GLY A C 525 O O . GLY A 85 ? 0.1551 0.1239 0.1793 0.0148 0.0279 -0.0343 85 GLY A O 526 N N . ASP A 86 ? 0.1313 0.1243 0.2292 0.0057 0.0414 -0.0384 86 ASP A N 527 C CA . ASP A 86 ? 0.1689 0.1446 0.1759 -0.0060 0.0254 -0.0309 86 ASP A CA 528 C C . ASP A 86 ? 0.2108 0.0887 0.1919 -0.0088 0.0009 -0.0367 86 ASP A C 529 O O . ASP A 86 ? 0.2453 0.1201 0.1952 -0.0363 -0.0329 -0.0101 86 ASP A O 530 C CB A ASP A 86 ? 0.1817 0.2357 0.2176 0.0226 0.0415 0.0381 86 ASP A CB 531 C CB B ASP A 86 ? 0.1703 0.2197 0.2545 0.0073 0.0195 0.0242 86 ASP A CB 532 C CG A ASP A 86 ? 0.2103 0.2093 0.2538 0.0415 0.0454 -0.0096 86 ASP A CG 533 C CG B ASP A 86 ? 0.2288 0.2537 0.3348 0.0733 -0.0678 -0.0339 86 ASP A CG 534 O OD1 A ASP A 86 ? 0.2365 0.1244 0.2784 0.1010 0.1020 0.0186 86 ASP A OD1 535 O OD1 B ASP A 86 ? 0.3581 0.2567 0.3568 0.1111 -0.0993 -0.0455 86 ASP A OD1 536 O OD2 A ASP A 86 ? 0.1859 0.1842 0.2288 0.0003 0.0331 -0.0158 86 ASP A OD2 537 O OD2 B ASP A 86 ? 0.2558 0.4097 0.3125 0.1289 -0.0851 -0.0621 86 ASP A OD2 538 N N . ARG A 87 ? 0.1583 0.1109 0.1741 -0.0301 0.0340 -0.0370 87 ARG A N 539 C CA . ARG A 87 ? 0.1773 0.1065 0.1667 -0.0203 0.0223 -0.0435 87 ARG A CA 540 C C . ARG A 87 ? 0.1483 0.1040 0.1233 -0.0216 -0.0099 -0.0315 87 ARG A C 541 O O . ARG A 87 ? 0.1830 0.0971 0.1369 -0.0013 -0.0052 -0.0250 87 ARG A O 542 C CB . ARG A 87 ? 0.2510 0.1313 0.1449 -0.0461 0.0402 -0.0547 87 ARG A CB 543 C CG . ARG A 87 ? 0.2941 0.1406 0.1745 -0.0450 -0.0198 -0.0323 87 ARG A CG 544 C CD . ARG A 87 ? 0.2325 0.1676 0.1776 -0.0275 -0.0107 -0.0343 87 ARG A CD 545 N NE . ARG A 87 ? 0.2397 0.1963 0.1700 -0.0017 -0.0175 -0.0159 87 ARG A NE 546 C CZ . ARG A 87 ? 0.2535 0.2004 0.1149 0.0023 -0.0249 -0.0671 87 ARG A CZ 547 N NH1 . ARG A 87 ? 0.2554 0.2979 0.1707 -0.0474 -0.0010 -0.1372 87 ARG A NH1 548 N NH2 . ARG A 87 ? 0.3571 0.2290 0.1604 0.0749 -0.0447 -0.0438 87 ARG A NH2 549 N N . LYS A 88 ? 0.1512 0.1066 0.1596 -0.0193 0.0101 -0.0542 88 LYS A N 550 C CA . LYS A 88 ? 0.1394 0.1002 0.1612 -0.0177 0.0038 -0.0415 88 LYS A CA 551 C C . LYS A 88 ? 0.1602 0.1314 0.1331 -0.0193 -0.0102 -0.0376 88 LYS A C 552 O O . LYS A 88 ? 0.2190 0.1768 0.1464 -0.0176 -0.0114 -0.0868 88 LYS A O 553 C CB . LYS A 88 ? 0.1913 0.1007 0.1340 -0.0228 0.0035 -0.0387 88 LYS A CB 554 C CG . LYS A 88 ? 0.1857 0.1083 0.2021 -0.0004 -0.0134 -0.0310 88 LYS A CG 555 C CD . LYS A 88 ? 0.2056 0.1089 0.2307 0.0003 -0.0225 -0.0147 88 LYS A CD 556 C CE . LYS A 88 ? 0.2105 0.1529 0.2342 -0.0233 -0.0295 0.0113 88 LYS A CE 557 N NZ . LYS A 88 ? 0.2094 0.1841 0.3395 0.0220 -0.0344 -0.0041 88 LYS A NZ 558 N N . LEU A 89 ? 0.1711 0.1217 0.1146 -0.0086 -0.0265 -0.0383 89 LEU A N 559 C CA . LEU A 89 ? 0.1866 0.1280 0.0893 -0.0090 -0.0348 -0.0080 89 LEU A CA 560 C C . LEU A 89 ? 0.1746 0.1335 0.0963 -0.0153 -0.0394 -0.0306 89 LEU A C 561 O O . LEU A 89 ? 0.1773 0.1329 0.0947 -0.0259 -0.0324 -0.0330 89 LEU A O 562 C CB . LEU A 89 ? 0.1708 0.1304 0.1160 -0.0072 -0.0298 -0.0235 89 LEU A CB 563 C CG . LEU A 89 ? 0.2005 0.1552 0.0935 -0.0288 -0.0155 -0.0217 89 LEU A CG 564 C CD1 . LEU A 89 ? 0.2022 0.1534 0.1442 -0.0293 -0.0047 -0.0253 89 LEU A CD1 565 C CD2 . LEU A 89 ? 0.3053 0.1761 0.1025 -0.0662 0.0116 -0.0347 89 LEU A CD2 566 N N . SER A 90 ? 0.1839 0.1464 0.1095 -0.0190 -0.0341 -0.0445 90 SER A N 567 C CA . SER A 90 ? 0.1521 0.1710 0.1278 -0.0126 -0.0368 -0.0543 90 SER A CA 568 C C . SER A 90 ? 0.1774 0.1363 0.0951 -0.0107 -0.0430 -0.0493 90 SER A C 569 O O . SER A 90 ? 0.2155 0.1767 0.0990 -0.0134 -0.0273 -0.0233 90 SER A O 570 C CB . SER A 90 ? 0.1877 0.1343 0.2038 -0.0087 -0.0436 -0.0425 90 SER A CB 571 O OG . SER A 90 ? 0.2465 0.1730 0.4662 0.0420 -0.0583 -0.0195 90 SER A OG 572 N N . TYR A 91 ? 0.1669 0.1118 0.0967 0.0019 -0.0460 -0.0354 91 TYR A N 573 C CA . TYR A 91 ? 0.1627 0.1112 0.1133 -0.0050 -0.0473 -0.0329 91 TYR A CA 574 C C . TYR A 91 ? 0.1533 0.0895 0.1196 -0.0092 -0.0504 -0.0359 91 TYR A C 575 O O . TYR A 91 ? 0.1787 0.0778 0.1663 -0.0147 -0.0609 -0.0078 91 TYR A O 576 C CB . TYR A 91 ? 0.1846 0.0941 0.1145 -0.0053 -0.0404 -0.0085 91 TYR A CB 577 C CG . TYR A 91 ? 0.1645 0.0782 0.1215 -0.0148 -0.0486 -0.0134 91 TYR A CG 578 C CD1 . TYR A 91 ? 0.1530 0.0926 0.1107 -0.0102 -0.0213 -0.0197 91 TYR A CD1 579 C CD2 . TYR A 91 ? 0.1344 0.1005 0.1190 -0.0193 -0.0403 0.0003 91 TYR A CD2 580 C CE1 . TYR A 91 ? 0.1550 0.0867 0.1200 -0.0135 -0.0378 -0.0242 91 TYR A CE1 581 C CE2 . TYR A 91 ? 0.1479 0.0836 0.1167 -0.0045 -0.0495 -0.0060 91 TYR A CE2 582 C CZ . TYR A 91 ? 0.1542 0.0861 0.0946 -0.0013 -0.0471 0.0059 91 TYR A CZ 583 O OH . TYR A 91 ? 0.1629 0.1075 0.0922 -0.0242 -0.0546 -0.0024 91 TYR A OH 584 N N . GLY A 92 ? 0.1675 0.1027 0.0978 -0.0006 -0.0380 -0.0085 92 GLY A N 585 C CA . GLY A 92 ? 0.1409 0.1014 0.1750 -0.0037 -0.0330 -0.0070 92 GLY A CA 586 C C . GLY A 92 ? 0.1539 0.0994 0.1227 -0.0107 -0.0392 -0.0163 92 GLY A C 587 O O . GLY A 92 ? 0.1531 0.1125 0.1202 -0.0251 -0.0596 -0.0114 92 GLY A O 588 N N . PRO A 93 ? 0.1584 0.1032 0.1091 -0.0078 -0.0460 -0.0019 93 PRO A N 589 C CA . PRO A 93 ? 0.1777 0.1248 0.1219 -0.0018 -0.0269 -0.0169 93 PRO A CA 590 C C . PRO A 93 ? 0.1449 0.1094 0.1625 -0.0069 -0.0542 -0.0219 93 PRO A C 591 O O . PRO A 93 ? 0.2092 0.1284 0.1585 -0.0033 -0.0456 -0.0274 93 PRO A O 592 C CB . PRO A 93 ? 0.1415 0.1854 0.2324 0.0223 -0.0152 0.0403 93 PRO A CB 593 C CG . PRO A 93 ? 0.2578 0.1573 0.2042 -0.0709 0.0184 -0.0253 93 PRO A CG 594 C CD . PRO A 93 ? 0.1802 0.1133 0.1746 -0.0414 -0.0440 -0.0108 93 PRO A CD 595 N N . ASP A 94 ? 0.1945 0.1223 0.1589 0.0038 -0.0781 -0.0124 94 ASP A N 596 C CA . ASP A 94 ? 0.1964 0.1171 0.2018 0.0041 -0.0944 -0.0013 94 ASP A CA 597 C C . ASP A 94 ? 0.2084 0.1045 0.1770 0.0120 -0.0900 0.0045 94 ASP A C 598 O O . ASP A 94 ? 0.2603 0.1128 0.3026 0.0092 -0.1107 0.0499 94 ASP A O 599 C CB A ASP A 94 ? 0.2482 0.1211 0.2129 -0.0135 -0.1403 0.0317 94 ASP A CB 600 C CB B ASP A 94 ? 0.3361 0.1614 0.1999 -0.0417 -0.1621 0.0170 94 ASP A CB 601 C CG A ASP A 94 ? 0.2376 0.1135 0.2434 0.0101 -0.1295 -0.0199 94 ASP A CG 602 C CG B ASP A 94 ? 0.4335 0.0944 0.1839 -0.1084 -0.0566 -0.0522 94 ASP A CG 603 O OD1 A ASP A 94 ? 0.2846 0.2084 0.2981 -0.0110 -0.0709 -0.0243 94 ASP A OD1 604 O OD1 B ASP A 94 ? 0.5627 0.3080 0.2213 -0.1918 0.0077 -0.0423 94 ASP A OD1 605 O OD2 A ASP A 94 ? 0.3009 0.2152 0.3057 -0.0252 -0.1643 -0.1190 94 ASP A OD2 606 O OD2 B ASP A 94 ? 0.4292 0.1250 0.2691 -0.0412 -0.1251 -0.0782 94 ASP A OD2 607 N N . MET A 95 ? 0.1831 0.0943 0.1733 0.0006 -0.0639 -0.0177 95 MET A N 608 C CA . MET A 95 ? 0.2278 0.1054 0.2043 -0.0321 -0.0759 -0.0098 95 MET A CA 609 C C . MET A 95 ? 0.2153 0.0884 0.2177 -0.0019 -0.0752 -0.0220 95 MET A C 610 O O . MET A 95 ? 0.2440 0.1039 0.2576 -0.0222 -0.0616 -0.0290 95 MET A O 611 C CB . MET A 95 ? 0.2114 0.1742 0.3090 -0.0455 0.0612 -0.0527 95 MET A CB 612 C CG . MET A 95 ? 0.4411 0.2565 0.2250 0.0795 0.0698 0.0661 95 MET A CG 613 S SD . MET A 95 ? 0.6642 0.1790 0.4220 0.0844 0.2458 0.0842 95 MET A SD 614 C CE . MET A 95 ? 0.5210 0.2136 0.4396 0.1271 0.2551 0.1211 95 MET A CE 615 N N . ILE A 96 ? 0.2037 0.0886 0.1920 0.0081 -0.1037 -0.0106 96 ILE A N 616 C CA . ILE A 96 ? 0.1783 0.0880 0.2218 -0.0117 -0.0704 -0.0293 96 ILE A CA 617 C C . ILE A 96 ? 0.2142 0.1061 0.2555 0.0053 -0.1382 -0.0603 96 ILE A C 618 O O . ILE A 96 ? 0.2009 0.1762 0.3544 0.0273 -0.1295 -0.0660 96 ILE A O 619 C CB . ILE A 96 ? 0.1853 0.1325 0.2166 -0.0033 -0.0515 -0.0349 96 ILE A CB 620 C CG1 . ILE A 96 ? 0.2081 0.1516 0.1993 -0.0064 -0.0813 0.0042 96 ILE A CG1 621 C CG2 . ILE A 96 ? 0.3288 0.1686 0.2008 -0.0167 -0.0795 -0.0429 96 ILE A CG2 622 C CD1 . ILE A 96 ? 0.2079 0.1694 0.2382 0.0011 -0.0986 -0.0072 96 ILE A CD1 623 N N . VAL A 97 ? 0.2258 0.0914 0.2072 0.0012 -0.0743 0.0029 97 VAL A N 624 C CA . VAL A 97 ? 0.2068 0.1098 0.2241 0.0080 -0.1160 0.0036 97 VAL A CA 625 C C . VAL A 97 ? 0.1709 0.0851 0.2264 -0.0123 -0.0693 0.0111 97 VAL A C 626 O O . VAL A 97 ? 0.2515 0.1341 0.1957 0.0381 -0.0966 -0.0272 97 VAL A O 627 C CB . VAL A 97 ? 0.2373 0.1060 0.2374 0.0213 -0.0847 0.0078 97 VAL A CB 628 C CG1 . VAL A 97 ? 0.2575 0.2506 0.2237 -0.0341 -0.0895 -0.0076 97 VAL A CG1 629 C CG2 . VAL A 97 ? 0.2292 0.1534 0.2084 0.0168 -0.1078 0.0254 97 VAL A CG2 630 N N . GLU A 98 ? 0.1590 0.1218 0.2350 0.0042 -0.0296 0.0089 98 GLU A N 631 C CA . GLU A 98 ? 0.1637 0.1772 0.2740 0.0582 -0.0614 -0.0402 98 GLU A CA 632 C C . GLU A 98 ? 0.1738 0.1143 0.2417 0.0250 -0.0655 0.0235 98 GLU A C 633 O O . GLU A 98 ? 0.2224 0.1833 0.2177 -0.0550 -0.0760 0.0264 98 GLU A O 634 C CB . GLU A 98 ? 0.2030 0.1941 0.3062 0.0925 -0.0170 -0.0279 98 GLU A CB 635 C CG . GLU A 98 ? 0.3772 0.2311 0.3784 -0.0263 -0.1155 0.0495 98 GLU A CG 636 C CD . GLU A 98 ? 0.4692 0.2701 0.3299 0.0451 -0.0295 0.0710 98 GLU A CD 637 O OE1 . GLU A 98 ? 0.6739 0.2698 0.1786 0.1614 -0.0105 0.0602 98 GLU A OE1 638 O OE2 . GLU A 98 ? 0.5252 0.3442 0.4623 0.0906 0.1026 0.1580 98 GLU A OE2 639 N N . TRP A 99 ? 0.1407 0.1517 0.2224 0.0401 -0.0266 -0.0040 99 TRP A N 640 C CA . TRP A 99 ? 0.1702 0.1331 0.1805 0.0334 -0.0432 -0.0633 99 TRP A CA 641 C C . TRP A 99 ? 0.1323 0.1116 0.1705 0.0271 -0.0418 -0.0206 99 TRP A C 642 O O . TRP A 99 ? 0.2354 0.1098 0.1803 0.0465 0.0140 -0.0023 99 TRP A O 643 C CB . TRP A 99 ? 0.1926 0.1329 0.2612 0.0315 -0.0530 -0.0793 99 TRP A CB 644 C CG . TRP A 99 ? 0.1579 0.1759 0.2345 0.0022 -0.0211 -0.0832 99 TRP A CG 645 C CD1 . TRP A 99 ? 0.1745 0.1946 0.2595 -0.0196 0.0021 -0.0881 99 TRP A CD1 646 C CD2 . TRP A 99 ? 0.1801 0.4184 0.2331 0.0096 -0.0174 -0.1283 99 TRP A CD2 647 N NE1 . TRP A 99 ? 0.1517 0.2329 0.3254 0.0317 -0.0339 -0.0451 99 TRP A NE1 648 C CE2 . TRP A 99 ? 0.2019 0.3775 0.2684 -0.0059 -0.0620 -0.1379 99 TRP A CE2 649 C CE3 . TRP A 99 ? 0.2436 0.5354 0.2321 -0.0463 0.0033 -0.1781 99 TRP A CE3 650 C CZ2 . TRP A 99 ? 0.3254 0.6040 0.2978 0.0390 -0.1275 -0.1747 99 TRP A CZ2 651 C CZ3 . TRP A 99 ? 0.4035 0.7051 0.2270 -0.0575 -0.0225 -0.1169 99 TRP A CZ3 652 C CH2 . TRP A 99 ? 0.4260 0.7605 0.2416 0.0330 -0.1121 -0.0900 99 TRP A CH2 653 N N . SER A 100 ? 0.1268 0.1064 0.1804 0.0201 -0.0382 -0.0349 100 SER A N 654 C CA . SER A 100 ? 0.1622 0.1108 0.1530 0.0285 -0.0431 -0.0299 100 SER A CA 655 C C . SER A 100 ? 0.1007 0.1019 0.1815 -0.0039 -0.0363 -0.0096 100 SER A C 656 O O . SER A 100 ? 0.1402 0.0912 0.2518 -0.0025 -0.0560 0.0012 100 SER A O 657 C CB . SER A 100 ? 0.1399 0.1137 0.1673 0.0287 -0.0377 -0.0340 100 SER A CB 658 O OG . SER A 100 ? 0.2188 0.1676 0.2039 0.0405 -0.1048 -0.0425 100 SER A OG 659 N N . PRO A 101 ? 0.1493 0.0977 0.1819 0.0002 -0.0631 0.0000 101 PRO A N 660 C CA . PRO A 101 ? 0.1696 0.1221 0.1573 0.0095 -0.0220 0.0044 101 PRO A CA 661 C C . PRO A 101 ? 0.1330 0.1177 0.1281 -0.0030 -0.0377 0.0167 101 PRO A C 662 O O . PRO A 101 ? 0.1432 0.1380 0.1942 0.0029 0.0113 0.0450 101 PRO A O 663 C CB . PRO A 101 ? 0.1899 0.1439 0.1581 0.0261 -0.0498 -0.0130 101 PRO A CB 664 C CG . PRO A 101 ? 0.1971 0.1411 0.1618 -0.0142 -0.0675 -0.0184 101 PRO A CG 665 C CD . PRO A 101 ? 0.1534 0.1041 0.1425 -0.0077 -0.0318 -0.0106 101 PRO A CD 666 N N . ALA A 102 ? 0.1477 0.0894 0.1169 -0.0039 -0.0304 0.0150 102 ALA A N 667 C CA . ALA A 102 ? 0.1084 0.1038 0.1533 -0.0149 -0.0407 0.0019 102 ALA A CA 668 C C . ALA A 102 ? 0.0986 0.0911 0.1248 -0.0032 -0.0195 0.0137 102 ALA A C 669 O O . ALA A 102 ? 0.1295 0.0871 0.1692 -0.0032 -0.0474 0.0125 102 ALA A O 670 C CB . ALA A 102 ? 0.1332 0.1106 0.1306 -0.0260 -0.0280 -0.0115 102 ALA A CB 671 N N . THR A 103 ? 0.1549 0.0675 0.1103 -0.0142 -0.0272 0.0088 103 THR A N 672 C CA A THR A 103 ? 0.1229 0.0922 0.1550 -0.0181 -0.0376 0.0008 103 THR A CA 673 C CA B THR A 103 ? 0.1547 0.0574 0.1108 0.0021 -0.0321 0.0166 103 THR A CA 674 C C . THR A 103 ? 0.1178 0.0886 0.1244 -0.0094 -0.0452 0.0031 103 THR A C 675 O O . THR A 103 ? 0.1396 0.0792 0.1304 -0.0147 -0.0380 0.0005 103 THR A O 676 C CB A THR A 103 ? 0.1761 0.1469 0.1165 -0.0352 -0.0402 0.0115 103 THR A CB 677 C CB B THR A 103 ? 0.1717 0.1074 0.1258 0.0108 -0.0571 0.0207 103 THR A CB 678 O OG1 A THR A 103 ? 0.1878 0.1384 0.1344 -0.0226 -0.0122 0.0059 103 THR A OG1 679 O OG1 B THR A 103 ? 0.1888 0.1256 0.1072 0.0427 -0.0146 0.0568 103 THR A OG1 680 C CG2 A THR A 103 ? 0.2254 0.1213 0.1443 -0.0222 -0.0573 0.0168 103 THR A CG2 681 C CG2 B THR A 103 ? 0.2425 0.1345 0.0522 0.0290 -0.0569 -0.0396 103 THR A CG2 682 N N . GLU A 104 ? 0.1226 0.0878 0.1343 -0.0098 -0.0388 0.0059 104 GLU A N 683 C CA . GLU A 104 ? 0.1255 0.1017 0.1323 -0.0265 -0.0428 -0.0005 104 GLU A CA 684 C C . GLU A 104 ? 0.0948 0.1221 0.1192 -0.0132 -0.0152 0.0124 104 GLU A C 685 O O . GLU A 104 ? 0.1213 0.1276 0.1998 -0.0211 -0.0543 0.0379 104 GLU A O 686 C CB . GLU A 104 ? 0.1181 0.1537 0.1940 0.0132 -0.0115 0.0051 104 GLU A CB 687 C CG . GLU A 104 ? 0.2130 0.2064 0.2517 0.0708 -0.0202 0.0425 104 GLU A CG 688 C CD . GLU A 104 ? 0.3119 0.3171 0.2329 0.1876 -0.0287 0.0107 104 GLU A CD 689 O OE1 . GLU A 104 ? 0.4373 0.3196 0.4125 0.2359 -0.1844 -0.0732 104 GLU A OE1 690 O OE2 . GLU A 104 ? 0.2843 0.1934 0.2382 0.0828 -0.0182 0.0622 104 GLU A OE2 691 N N . ARG A 105 ? 0.1117 0.1104 0.1195 -0.0052 -0.0247 0.0049 105 ARG A N 692 C CA . ARG A 105 ? 0.1260 0.1083 0.1082 -0.0060 -0.0320 0.0072 105 ARG A CA 693 C C . ARG A 105 ? 0.1150 0.1044 0.1133 -0.0100 -0.0365 0.0139 105 ARG A C 694 O O . ARG A 105 ? 0.1289 0.1024 0.1343 -0.0023 -0.0200 0.0161 105 ARG A O 695 C CB . ARG A 105 ? 0.1526 0.1198 0.1190 -0.0169 -0.0432 0.0022 105 ARG A CB 696 C CG . ARG A 105 ? 0.1639 0.1149 0.1309 -0.0159 -0.0442 -0.0067 105 ARG A CG 697 C CD . ARG A 105 ? 0.2089 0.1464 0.1882 -0.0150 -0.0701 -0.0407 105 ARG A CD 698 N NE . ARG A 105 ? 0.2038 0.1582 0.1380 -0.0239 -0.0418 -0.0289 105 ARG A NE 699 C CZ . ARG A 105 ? 0.1972 0.1385 0.1422 0.0135 -0.0478 -0.0078 105 ARG A CZ 700 N NH1 . ARG A 105 ? 0.1936 0.1924 0.1815 -0.0107 -0.0599 0.0383 105 ARG A NH1 701 N NH2 . ARG A 105 ? 0.2767 0.1776 0.1868 0.0569 -0.0375 -0.0279 105 ARG A NH2 702 N N . PHE A 106 ? 0.1367 0.0946 0.1049 -0.0107 -0.0356 0.0012 106 PHE A N 703 C CA . PHE A 106 ? 0.1101 0.0870 0.1180 -0.0105 -0.0428 0.0036 106 PHE A CA 704 C C . PHE A 106 ? 0.1206 0.0739 0.0948 -0.0135 -0.0359 0.0175 106 PHE A C 705 O O . PHE A 106 ? 0.1271 0.0796 0.1245 -0.0184 -0.0435 0.0033 106 PHE A O 706 C CB . PHE A 106 ? 0.1243 0.0844 0.1174 -0.0105 -0.0360 0.0150 106 PHE A CB 707 C CG . PHE A 106 ? 0.1147 0.1017 0.1030 -0.0223 -0.0217 0.0013 106 PHE A CG 708 C CD1 . PHE A 106 ? 0.1215 0.1136 0.2586 -0.0126 -0.0542 -0.0309 106 PHE A CD1 709 C CD2 . PHE A 106 ? 0.1307 0.1252 0.0749 -0.0007 -0.0222 -0.0048 106 PHE A CD2 710 C CE1 . PHE A 106 ? 0.1579 0.1172 0.3185 -0.0237 -0.0935 -0.0613 106 PHE A CE1 711 C CE2 . PHE A 106 ? 0.1244 0.1426 0.0920 -0.0018 -0.0160 0.0012 106 PHE A CE2 712 C CZ . PHE A 106 ? 0.1463 0.1591 0.1502 -0.0085 -0.0428 -0.0373 106 PHE A CZ 713 N N . LEU A 107 ? 0.1043 0.0992 0.1054 -0.0223 -0.0290 0.0058 107 LEU A N 714 C CA . LEU A 107 ? 0.1175 0.0958 0.1022 -0.0201 -0.0287 0.0060 107 LEU A CA 715 C C . LEU A 107 ? 0.1125 0.0913 0.1416 -0.0204 -0.0654 0.0182 107 LEU A C 716 O O . LEU A 107 ? 0.1574 0.0906 0.1307 -0.0212 -0.0608 0.0192 107 LEU A O 717 C CB . LEU A 107 ? 0.1043 0.1102 0.1421 -0.0166 -0.0475 0.0265 107 LEU A CB 718 C CG . LEU A 107 ? 0.1129 0.1516 0.1668 -0.0484 -0.0526 0.0467 107 LEU A CG 719 C CD1 . LEU A 107 ? 0.1637 0.1950 0.1656 -0.0538 -0.0941 0.0683 107 LEU A CD1 720 C CD2 . LEU A 107 ? 0.0855 0.2158 0.2313 -0.0273 -0.0697 0.0538 107 LEU A CD2 721 N N . ALA A 108 ? 0.0980 0.0938 0.1343 -0.0124 -0.0469 0.0166 108 ALA A N 722 C CA . ALA A 108 ? 0.1067 0.1048 0.1474 -0.0299 -0.0394 0.0239 108 ALA A CA 723 C C . ALA A 108 ? 0.1283 0.0857 0.1225 -0.0362 -0.0203 0.0304 108 ALA A C 724 O O . ALA A 108 ? 0.1257 0.0968 0.1566 -0.0310 -0.0436 0.0200 108 ALA A O 725 C CB . ALA A 108 ? 0.1417 0.1020 0.1435 -0.0094 -0.0140 0.0256 108 ALA A CB 726 N N . SER A 109 ? 0.1156 0.0908 0.1353 -0.0231 -0.0370 0.0372 109 SER A N 727 C CA . SER A 109 ? 0.1281 0.1092 0.1563 -0.0186 -0.0271 0.0313 109 SER A CA 728 C C . SER A 109 ? 0.1397 0.0905 0.1567 -0.0381 -0.0141 0.0212 109 SER A C 729 O O . SER A 109 ? 0.1842 0.1218 0.1899 -0.0069 -0.0360 -0.0082 109 SER A O 730 C CB . SER A 109 ? 0.1261 0.1215 0.1501 -0.0189 -0.0237 0.0247 109 SER A CB 731 O OG . SER A 109 ? 0.1126 0.1215 0.1298 -0.0096 -0.0342 0.0223 109 SER A OG 732 N N . GLY A 110 ? 0.1585 0.0959 0.1324 -0.0335 -0.0473 -0.0023 110 GLY A N 733 C CA . GLY A 110 ? 0.1608 0.1066 0.1260 -0.0295 -0.0267 -0.0200 110 GLY A CA 734 C C . GLY A 110 ? 0.1624 0.0959 0.1190 -0.0208 -0.0276 -0.0262 110 GLY A C 735 O O . GLY A 110 ? 0.1510 0.1237 0.1301 -0.0315 -0.0328 -0.0061 110 GLY A O 736 N N . HIS A 111 ? 0.1663 0.0885 0.1126 -0.0261 -0.0232 -0.0233 111 HIS A N 737 C CA . HIS A 111 ? 0.1471 0.0989 0.0986 -0.0111 -0.0361 -0.0138 111 HIS A CA 738 C C . HIS A 111 ? 0.1244 0.0904 0.0977 -0.0120 -0.0259 -0.0131 111 HIS A C 739 O O . HIS A 111 ? 0.1295 0.1007 0.1002 -0.0099 -0.0442 -0.0047 111 HIS A O 740 C CB . HIS A 111 ? 0.1774 0.0853 0.1344 -0.0149 -0.0116 -0.0220 111 HIS A CB 741 C CG . HIS A 111 ? 0.1995 0.1099 0.1556 0.0299 -0.0060 -0.0049 111 HIS A CG 742 N ND1 . HIS A 111 ? 0.2617 0.1082 0.2221 0.0361 -0.0318 0.0091 111 HIS A ND1 743 C CD2 . HIS A 111 ? 0.2012 0.1351 0.1622 0.0374 -0.0319 -0.0118 111 HIS A CD2 744 C CE1 . HIS A 111 ? 0.2507 0.1904 0.1554 0.0652 0.0017 0.0330 111 HIS A CE1 745 N NE2 . HIS A 111 ? 0.2259 0.1770 0.1771 0.0708 -0.0238 0.0098 111 HIS A NE2 746 N N . MET A 112 ? 0.1209 0.1022 0.0997 -0.0105 -0.0426 -0.0005 112 MET A N 747 C CA . MET A 112 ? 0.1375 0.0856 0.1033 -0.0256 -0.0160 0.0112 112 MET A CA 748 C C . MET A 112 ? 0.1284 0.0937 0.1105 -0.0152 -0.0238 -0.0103 112 MET A C 749 O O . MET A 112 ? 0.1524 0.1170 0.0985 -0.0174 -0.0173 -0.0216 112 MET A O 750 C CB . MET A 112 ? 0.1680 0.0965 0.0967 -0.0193 -0.0244 -0.0124 112 MET A CB 751 C CG . MET A 112 ? 0.1770 0.1177 0.1068 -0.0094 -0.0126 0.0065 112 MET A CG 752 S SD . MET A 112 ? 0.2159 0.1366 0.1708 0.0025 -0.0036 -0.0368 112 MET A SD 753 C CE . MET A 112 ? 0.3186 0.2990 0.3116 -0.1778 0.0243 -0.1051 112 MET A CE 754 N N . THR A 113 ? 0.1204 0.0791 0.1142 -0.0120 -0.0197 -0.0178 113 THR A N 755 C CA . THR A 113 ? 0.1333 0.0825 0.1226 -0.0093 -0.0050 -0.0376 113 THR A CA 756 C C . THR A 113 ? 0.1047 0.1029 0.1263 -0.0049 -0.0061 -0.0160 113 THR A C 757 O O . THR A 113 ? 0.1378 0.0836 0.1103 -0.0096 -0.0153 -0.0251 113 THR A O 758 C CB . THR A 113 ? 0.1288 0.0778 0.1463 -0.0001 -0.0097 -0.0415 113 THR A CB 759 O OG1 . THR A 113 ? 0.1602 0.0856 0.1389 -0.0024 -0.0322 -0.0230 113 THR A OG1 760 C CG2 . THR A 113 ? 0.1616 0.0847 0.1616 0.0011 -0.0187 -0.0265 113 THR A CG2 761 N N . VAL A 114 ? 0.1500 0.0771 0.1346 -0.0035 0.0082 -0.0225 114 VAL A N 762 C CA . VAL A 114 ? 0.1575 0.0905 0.1208 -0.0161 0.0045 -0.0210 114 VAL A CA 763 C C . VAL A 114 ? 0.1502 0.0818 0.1236 -0.0053 -0.0012 -0.0150 114 VAL A C 764 O O . VAL A 114 ? 0.1558 0.0879 0.1216 0.0099 -0.0266 -0.0194 114 VAL A O 765 C CB . VAL A 114 ? 0.1545 0.1114 0.1331 -0.0219 0.0144 -0.0234 114 VAL A CB 766 C CG1 . VAL A 114 ? 0.1782 0.1012 0.1351 -0.0120 0.0334 -0.0296 114 VAL A CG1 767 C CG2 . VAL A 114 ? 0.2102 0.1148 0.1191 -0.0281 0.0231 -0.0345 114 VAL A CG2 768 N N . LEU A 115 ? 0.1280 0.0839 0.1545 -0.0021 -0.0024 -0.0305 115 LEU A N 769 C CA . LEU A 115 ? 0.1391 0.0690 0.1522 -0.0168 -0.0077 -0.0201 115 LEU A CA 770 C C . LEU A 115 ? 0.1091 0.0882 0.1456 -0.0284 -0.0144 -0.0233 115 LEU A C 771 O O . LEU A 115 ? 0.1468 0.0880 0.1546 -0.0224 -0.0245 -0.0345 115 LEU A O 772 C CB . LEU A 115 ? 0.1402 0.1019 0.1754 -0.0026 -0.0078 -0.0376 115 LEU A CB 773 C CG . LEU A 115 ? 0.1421 0.1323 0.2039 -0.0089 0.0037 -0.0624 115 LEU A CG 774 C CD1 . LEU A 115 ? 0.1607 0.2475 0.2064 0.0411 -0.0031 -0.0580 115 LEU A CD1 775 C CD2 . LEU A 115 ? 0.1708 0.1511 0.3071 -0.0577 0.0829 -0.0923 115 LEU A CD2 776 N N . GLU A 116 ? 0.1126 0.1053 0.1455 -0.0231 -0.0219 -0.0171 116 GLU A N 777 C CA . GLU A 116 ? 0.1404 0.0960 0.1263 -0.0053 -0.0108 -0.0042 116 GLU A CA 778 C C . GLU A 116 ? 0.1546 0.0730 0.1105 -0.0127 -0.0174 -0.0074 116 GLU A C 779 O O . GLU A 116 ? 0.1663 0.0783 0.1137 -0.0046 -0.0256 -0.0225 116 GLU A O 780 C CB . GLU A 116 ? 0.1341 0.0823 0.1188 -0.0063 -0.0194 -0.0124 116 GLU A CB 781 C CG . GLU A 116 ? 0.1899 0.0856 0.1309 -0.0169 -0.0552 -0.0110 116 GLU A CG 782 C CD . GLU A 116 ? 0.1435 0.1004 0.1185 -0.0203 -0.0240 -0.0018 116 GLU A CD 783 O OE1 . GLU A 116 ? 0.1531 0.1018 0.1038 -0.0228 -0.0328 0.0055 116 GLU A OE1 784 O OE2 . GLU A 116 ? 0.1515 0.1014 0.1332 -0.0143 -0.0370 -0.0023 116 GLU A OE2 785 N N . ALA A 117 ? 0.1522 0.0769 0.1164 -0.0040 -0.0160 -0.0255 117 ALA A N 786 C CA . ALA A 117 ? 0.1550 0.0755 0.1235 -0.0079 -0.0309 -0.0197 117 ALA A CA 787 C C . ALA A 117 ? 0.1435 0.0767 0.1163 0.0014 -0.0139 -0.0103 117 ALA A C 788 O O . ALA A 117 ? 0.1385 0.0823 0.1240 -0.0053 -0.0231 -0.0225 117 ALA A O 789 C CB . ALA A 117 ? 0.1380 0.1202 0.0880 -0.0042 -0.0002 -0.0233 117 ALA A CB 790 N N . ALA A 118 ? 0.1450 0.0675 0.1250 -0.0013 -0.0138 -0.0298 118 ALA A N 791 C CA . ALA A 118 ? 0.1372 0.0948 0.1104 -0.0106 -0.0129 -0.0252 118 ALA A CA 792 C C . ALA A 118 ? 0.1119 0.0720 0.1095 -0.0132 -0.0105 -0.0091 118 ALA A C 793 O O . ALA A 118 ? 0.1551 0.0724 0.1072 0.0034 -0.0213 -0.0039 118 ALA A O 794 C CB . ALA A 118 ? 0.1686 0.1098 0.1234 -0.0187 0.0110 -0.0247 118 ALA A CB 795 N N . GLN A 119 ? 0.1290 0.0689 0.1073 -0.0057 -0.0050 -0.0119 119 GLN A N 796 C CA . GLN A 119 ? 0.1292 0.0773 0.1158 -0.0057 -0.0209 -0.0139 119 GLN A CA 797 C C . GLN A 119 ? 0.1334 0.0741 0.0839 0.0024 -0.0237 -0.0059 119 GLN A C 798 O O . GLN A 119 ? 0.1480 0.0798 0.0942 -0.0074 -0.0274 -0.0123 119 GLN A O 799 C CB . GLN A 119 ? 0.1360 0.0700 0.1128 0.0118 -0.0123 -0.0135 119 GLN A CB 800 C CG . GLN A 119 ? 0.1543 0.0822 0.1247 0.0101 -0.0392 -0.0215 119 GLN A CG 801 C CD . GLN A 119 ? 0.1538 0.0877 0.1226 0.0065 -0.0229 -0.0072 119 GLN A CD 802 O OE1 . GLN A 119 ? 0.1936 0.0864 0.1316 0.0257 -0.0413 -0.0033 119 GLN A OE1 803 N NE2 . GLN A 119 ? 0.2170 0.1114 0.1181 0.0387 -0.0494 0.0009 119 GLN A NE2 804 N N . ALA A 120 ? 0.1253 0.0783 0.0965 0.0016 -0.0284 0.0049 120 ALA A N 805 C CA . ALA A 120 ? 0.1252 0.0766 0.1127 0.0086 -0.0289 -0.0018 120 ALA A CA 806 C C . ALA A 120 ? 0.1272 0.0783 0.0951 0.0032 -0.0412 -0.0071 120 ALA A C 807 O O . ALA A 120 ? 0.1336 0.0800 0.1080 0.0041 -0.0196 -0.0067 120 ALA A O 808 C CB . ALA A 120 ? 0.1310 0.0878 0.1456 0.0027 -0.0066 0.0113 120 ALA A CB 809 N N . ALA A 121 ? 0.1287 0.0758 0.0993 0.0026 -0.0450 -0.0111 121 ALA A N 810 C CA . ALA A 121 ? 0.1418 0.0831 0.1036 0.0024 -0.0341 0.0016 121 ALA A CA 811 C C . ALA A 121 ? 0.1357 0.0741 0.0885 0.0075 -0.0029 -0.0016 121 ALA A C 812 O O . ALA A 121 ? 0.1472 0.0750 0.1112 0.0168 -0.0303 0.0012 121 ALA A O 813 C CB . ALA A 121 ? 0.1599 0.0990 0.1054 0.0040 -0.0470 -0.0074 121 ALA A CB 814 N N . VAL A 122 ? 0.1378 0.0711 0.0940 0.0011 -0.0244 -0.0100 122 VAL A N 815 C CA . VAL A 122 ? 0.1498 0.0800 0.0775 -0.0052 -0.0224 -0.0029 122 VAL A CA 816 C C . VAL A 122 ? 0.1599 0.0725 0.0819 0.0003 -0.0233 -0.0050 122 VAL A C 817 O O . VAL A 122 ? 0.2261 0.0687 0.0932 0.0114 -0.0289 -0.0005 122 VAL A O 818 C CB . VAL A 122 ? 0.1537 0.1007 0.0861 -0.0186 -0.0152 -0.0041 122 VAL A CB 819 C CG1 . VAL A 122 ? 0.1559 0.1112 0.0839 -0.0175 -0.0201 0.0059 122 VAL A CG1 820 C CG2 . VAL A 122 ? 0.1628 0.1128 0.0856 0.0043 -0.0063 0.0016 122 VAL A CG2 821 N N . GLN A 123 ? 0.1227 0.0651 0.0882 -0.0007 -0.0311 -0.0040 123 GLN A N 822 C CA . GLN A 123 ? 0.1326 0.0765 0.0841 -0.0128 -0.0132 0.0051 123 GLN A CA 823 C C . GLN A 123 ? 0.1270 0.0575 0.1018 -0.0082 -0.0201 -0.0011 123 GLN A C 824 O O . GLN A 123 ? 0.1417 0.0916 0.1050 -0.0094 -0.0144 -0.0138 123 GLN A O 825 C CB . GLN A 123 ? 0.1228 0.1061 0.0860 -0.0059 -0.0151 0.0024 123 GLN A CB 826 C CG . GLN A 123 ? 0.1300 0.0924 0.0725 -0.0096 -0.0066 0.0093 123 GLN A CG 827 C CD . GLN A 123 ? 0.1363 0.0881 0.0809 -0.0004 -0.0190 -0.0071 123 GLN A CD 828 O OE1 . GLN A 123 ? 0.1517 0.0783 0.1227 -0.0043 -0.0313 0.0096 123 GLN A OE1 829 N NE2 . GLN A 123 ? 0.1402 0.1013 0.1256 -0.0149 -0.0289 0.0111 123 GLN A NE2 830 N N . LEU A 124 ? 0.1263 0.0835 0.0883 -0.0019 -0.0071 -0.0187 124 LEU A N 831 C CA . LEU A 124 ? 0.1185 0.0927 0.1092 -0.0030 -0.0188 -0.0102 124 LEU A CA 832 C C . LEU A 124 ? 0.1139 0.0901 0.1235 -0.0105 -0.0186 0.0023 124 LEU A C 833 O O . LEU A 124 ? 0.1200 0.1495 0.1480 0.0083 -0.0138 0.0295 124 LEU A O 834 C CB . LEU A 124 ? 0.1627 0.0956 0.1043 -0.0218 -0.0089 0.0051 124 LEU A CB 835 C CG . LEU A 124 ? 0.1676 0.1349 0.1663 -0.0259 -0.0287 0.0397 124 LEU A CG 836 C CD1 . LEU A 124 ? 0.1895 0.1191 0.2255 0.0168 0.0215 0.0586 124 LEU A CD1 837 C CD2 . LEU A 124 ? 0.3897 0.2246 0.1220 -0.0751 -0.1202 0.0110 124 LEU A CD2 838 N N . SER A 125 ? 0.1464 0.0766 0.1126 -0.0058 -0.0272 -0.0111 125 SER A N 839 C CA . SER A 125 ? 0.1513 0.0743 0.1251 -0.0095 -0.0155 0.0099 125 SER A CA 840 C C . SER A 125 ? 0.1468 0.0809 0.1295 0.0067 -0.0378 0.0039 125 SER A C 841 O O . SER A 125 ? 0.1525 0.0868 0.1762 0.0122 -0.0497 0.0111 125 SER A O 842 C CB . SER A 125 ? 0.1713 0.0741 0.1419 0.0055 -0.0258 0.0160 125 SER A CB 843 O OG . SER A 125 ? 0.2117 0.1006 0.1533 0.0113 -0.0408 0.0181 125 SER A OG 844 N N . ASP A 126 ? 0.1362 0.0794 0.1150 0.0072 -0.0413 -0.0053 126 ASP A N 845 C CA . ASP A 126 ? 0.1377 0.0857 0.1193 0.0006 -0.0366 0.0073 126 ASP A CA 846 C C . ASP A 126 ? 0.1271 0.0724 0.1282 -0.0077 -0.0372 0.0004 126 ASP A C 847 O O . ASP A 126 ? 0.1471 0.1020 0.1185 0.0029 -0.0397 0.0010 126 ASP A O 848 C CB . ASP A 126 ? 0.1430 0.0768 0.1511 0.0037 -0.0536 -0.0138 126 ASP A CB 849 C CG . ASP A 126 ? 0.1386 0.0865 0.1477 -0.0108 -0.0389 -0.0045 126 ASP A CG 850 O OD1 . ASP A 126 ? 0.1554 0.0969 0.1467 -0.0169 -0.0474 -0.0012 126 ASP A OD1 851 O OD2 . ASP A 126 ? 0.2157 0.1095 0.1472 -0.0402 -0.0697 0.0062 126 ASP A OD2 852 N N . ASN A 127 ? 0.1276 0.0982 0.1246 -0.0151 -0.0352 0.0014 127 ASN A N 853 C CA . ASN A 127 ? 0.1424 0.0927 0.1360 -0.0142 -0.0515 -0.0003 127 ASN A CA 854 C C . ASN A 127 ? 0.1751 0.0877 0.1317 0.0085 -0.0714 0.0097 127 ASN A C 855 O O . ASN A 127 ? 0.2126 0.0975 0.1218 0.0137 -0.0713 -0.0028 127 ASN A O 856 C CB . ASN A 127 ? 0.1571 0.0937 0.1899 0.0096 -0.0486 0.0152 127 ASN A CB 857 C CG . ASN A 127 ? 0.2036 0.0960 0.1955 0.0033 -0.0452 -0.0017 127 ASN A CG 858 O OD1 . ASN A 127 ? 0.1979 0.0954 0.2180 -0.0074 -0.0653 0.0143 127 ASN A OD1 859 N ND2 . ASN A 127 ? 0.3251 0.1315 0.4573 0.0156 0.1174 -0.0472 127 ASN A ND2 860 N N . GLY A 128 ? 0.1691 0.0965 0.1324 -0.0173 -0.0489 -0.0117 128 GLY A N 861 C CA . GLY A 128 ? 0.1740 0.0885 0.2028 0.0014 -0.0455 -0.0067 128 GLY A CA 862 C C . GLY A 128 ? 0.1637 0.0859 0.1434 -0.0051 -0.0588 -0.0015 128 GLY A C 863 O O . GLY A 128 ? 0.1960 0.0905 0.1470 -0.0173 -0.0639 -0.0044 128 GLY A O 864 N N . ALA A 129 ? 0.1628 0.0858 0.1176 -0.0131 -0.0469 -0.0005 129 ALA A N 865 C CA . ALA A 129 ? 0.1681 0.0889 0.1326 -0.0072 -0.0498 0.0142 129 ALA A CA 866 C C . ALA A 129 ? 0.1620 0.0745 0.1224 0.0117 -0.0441 0.0018 129 ALA A C 867 O O . ALA A 129 ? 0.1716 0.0875 0.1307 0.0007 -0.0462 -0.0192 129 ALA A O 868 C CB . ALA A 129 ? 0.1421 0.0953 0.1322 -0.0005 -0.0403 -0.0041 129 ALA A CB 869 N N . THR A 130 ? 0.1732 0.0802 0.1117 0.0093 -0.0262 0.0033 130 THR A N 870 C CA . THR A 130 ? 0.1681 0.0913 0.1064 -0.0072 -0.0436 0.0019 130 THR A CA 871 C C . THR A 130 ? 0.1825 0.0820 0.1163 0.0271 -0.0504 -0.0236 130 THR A C 872 O O . THR A 130 ? 0.2191 0.0906 0.1220 0.0042 -0.0369 -0.0323 130 THR A O 873 C CB . THR A 130 ? 0.2300 0.0714 0.1240 -0.0036 -0.0681 -0.0068 130 THR A CB 874 O OG1 . THR A 130 ? 0.2035 0.0885 0.1126 -0.0072 -0.0592 0.0041 130 THR A OG1 875 C CG2 . THR A 130 ? 0.2612 0.0876 0.1100 0.0063 -0.0804 -0.0090 130 THR A CG2 876 N N . ASN A 131 ? 0.1996 0.0949 0.1179 -0.0077 -0.0630 -0.0082 131 ASN A N 877 C CA . ASN A 131 ? 0.2258 0.1021 0.1207 0.0118 -0.0768 -0.0171 131 ASN A CA 878 C C . ASN A 131 ? 0.2579 0.0879 0.1516 0.0059 -0.0868 -0.0218 131 ASN A C 879 O O . ASN A 131 ? 0.2645 0.1131 0.1624 0.0325 -0.0901 -0.0484 131 ASN A O 880 C CB . ASN A 131 ? 0.2183 0.0755 0.2050 -0.0195 -0.0906 -0.0032 131 ASN A CB 881 C CG . ASN A 131 ? 0.2254 0.0935 0.1762 0.0046 -0.0691 -0.0069 131 ASN A CG 882 O OD1 . ASN A 131 ? 0.2176 0.0896 0.2082 0.0181 -0.0663 0.0112 131 ASN A OD1 883 N ND2 . ASN A 131 ? 0.2387 0.1039 0.2715 -0.0056 -0.0453 0.0129 131 ASN A ND2 884 N N . LEU A 132 ? 0.2206 0.0757 0.1821 -0.0064 -0.0687 -0.0035 132 LEU A N 885 C CA . LEU A 132 ? 0.2270 0.0945 0.1870 0.0184 -0.1303 -0.0394 132 LEU A CA 886 C C . LEU A 132 ? 0.2338 0.0984 0.1964 0.0364 -0.1184 -0.0635 132 LEU A C 887 O O . LEU A 132 ? 0.2681 0.1395 0.1932 0.0184 -0.1141 -0.0770 132 LEU A O 888 C CB . LEU A 132 ? 0.2877 0.1116 0.2157 0.0117 -0.1660 -0.0198 132 LEU A CB 889 C CG . LEU A 132 ? 0.3274 0.1092 0.2342 -0.0326 -0.1173 0.0292 132 LEU A CG 890 C CD1 . LEU A 132 ? 0.3571 0.1384 0.2515 -0.0655 -0.1019 -0.0057 132 LEU A CD1 891 C CD2 . LEU A 132 ? 0.4055 0.1682 0.2569 -0.1216 -0.1465 0.0988 132 LEU A CD2 892 N N . LEU A 133 ? 0.2332 0.1020 0.1447 0.0266 -0.0849 -0.0508 133 LEU A N 893 C CA . LEU A 133 ? 0.2354 0.1161 0.1288 0.0497 -0.0680 -0.0598 133 LEU A CA 894 C C . LEU A 133 ? 0.2970 0.1358 0.1307 0.0525 -0.0803 -0.0486 133 LEU A C 895 O O . LEU A 133 ? 0.3146 0.1712 0.1239 0.0659 -0.0679 -0.0396 133 LEU A O 896 C CB . LEU A 133 ? 0.2358 0.1315 0.1224 0.0137 -0.0608 -0.0176 133 LEU A CB 897 C CG . LEU A 133 ? 0.1764 0.1492 0.1237 0.0019 -0.0492 -0.0014 133 LEU A CG 898 C CD1 . LEU A 133 ? 0.2404 0.1609 0.1431 0.0055 -0.0735 -0.0204 133 LEU A CD1 899 C CD2 . LEU A 133 ? 0.1757 0.1370 0.1377 -0.0114 -0.0358 0.0021 133 LEU A CD2 900 N N . LEU A 134 ? 0.2913 0.1142 0.1120 0.0329 -0.0476 -0.0031 134 LEU A N 901 C CA . LEU A 134 ? 0.2688 0.2100 0.1229 0.0815 -0.0668 -0.0166 134 LEU A CA 902 C C . LEU A 134 ? 0.4145 0.2214 0.1126 0.1387 -0.0851 -0.0452 134 LEU A C 903 O O . LEU A 134 ? 0.6970 0.2990 0.1010 0.2540 -0.0663 -0.0189 134 LEU A O 904 C CB . LEU A 134 ? 0.2706 0.1787 0.1527 0.0692 -0.0751 -0.0537 134 LEU A CB 905 C CG . LEU A 134 ? 0.2391 0.1999 0.1128 0.0209 -0.0600 -0.0492 134 LEU A CG 906 C CD1 . LEU A 134 ? 0.2689 0.1329 0.1853 0.0269 -0.0404 -0.0422 134 LEU A CD1 907 C CD2 . LEU A 134 ? 0.3272 0.2047 0.1973 0.0731 0.0133 0.0261 134 LEU A CD2 908 N N . ARG A 135 ? 0.3476 0.2305 0.2144 0.0856 -0.1069 -0.0963 135 ARG A N 909 C CA . ARG A 135 ? 0.4024 0.3059 0.2385 0.1144 -0.1609 -0.1366 135 ARG A CA 910 C C . ARG A 135 ? 0.4904 0.3928 0.2451 0.2108 -0.2126 -0.2068 135 ARG A C 911 O O . ARG A 135 ? 0.6377 0.5368 0.2456 0.3586 -0.2529 -0.2421 135 ARG A O 912 C CB . ARG A 135 ? 0.5475 0.2227 0.2424 0.0319 -0.1697 -0.1244 135 ARG A CB 913 C CG . ARG A 135 ? 0.6743 0.2634 0.3438 0.0037 -0.2783 -0.0241 135 ARG A CG 914 C CD . ARG A 135 ? 0.9333 0.3684 0.4231 -0.1918 -0.4002 0.1033 135 ARG A CD 915 N NE . ARG A 135 ? 1.1082 0.2709 0.4467 -0.2310 -0.5236 0.1579 135 ARG A NE 916 C CZ . ARG A 135 ? 0.8552 0.3941 0.3878 -0.1344 -0.4533 0.0863 135 ARG A CZ 917 N NH1 . ARG A 135 ? 1.0843 0.7016 0.5836 -0.0996 -0.1933 -0.0311 135 ARG A NH1 918 N NH2 . ARG A 135 ? 0.7972 0.1420 0.3497 -0.0106 -0.4705 -0.0008 135 ARG A NH2 919 N N . GLU A 136 ? 0.4295 0.2582 0.1668 0.1449 -0.1279 -0.0860 136 GLU A N 920 C CA . GLU A 136 ? 0.4128 0.2496 0.2412 0.1096 -0.1013 -0.1043 136 GLU A CA 921 C C . GLU A 136 ? 0.5143 0.2982 0.2257 0.1347 -0.0472 -0.0855 136 GLU A C 922 O O . GLU A 136 ? 0.9171 0.2809 0.2029 0.2452 0.0792 -0.0141 136 GLU A O 923 C CB . GLU A 136 ? 0.3152 0.1764 0.2794 0.0545 -0.0930 -0.0758 136 GLU A CB 924 C CG . GLU A 136 ? 0.3441 0.1954 0.2846 -0.0002 -0.1002 -0.0973 136 GLU A CG 925 C CD . GLU A 136 ? 0.2259 0.2329 0.2976 0.0308 -0.0735 -0.1372 136 GLU A CD 926 O OE1 . GLU A 136 ? 0.3424 0.2492 0.2806 0.0374 0.0002 -0.1029 136 GLU A OE1 927 O OE2 . GLU A 136 ? 0.2271 0.3454 0.6566 -0.0058 -0.0330 -0.2876 136 GLU A OE2 928 N N . ILE A 137 ? 0.4362 0.2888 0.1725 0.1732 -0.0097 -0.0395 137 ILE A N 929 C CA . ILE A 137 ? 0.5164 0.3962 0.1188 0.0982 -0.0397 -0.0044 137 ILE A CA 930 C C . ILE A 137 ? 0.6676 0.3658 0.1303 0.1354 -0.0821 -0.0297 137 ILE A C 931 O O . ILE A 137 ? 0.7505 0.3015 0.2209 0.2149 -0.0331 0.0473 137 ILE A O 932 C CB . ILE A 137 ? 0.6086 0.5388 0.1253 -0.0466 -0.0225 -0.0122 137 ILE A CB 933 C CG1 . ILE A 137 ? 0.7421 0.4634 0.2041 -0.0729 -0.0301 -0.1032 137 ILE A CG1 934 C CG2 . ILE A 137 ? 0.8077 0.6797 0.2102 0.0312 -0.1928 -0.0988 137 ILE A CG2 935 C CD1 . ILE A 137 ? 0.3434 0.4637 0.4191 -0.1962 0.1274 0.0054 137 ILE A CD1 936 N N . GLY A 138 ? 0.7289 0.1796 0.2348 0.1353 -0.2255 -0.0847 138 GLY A N 937 C CA . GLY A 138 ? 0.7411 0.2838 0.1765 0.1938 -0.1379 -0.0614 138 GLY A CA 938 C C . GLY A 138 ? 0.6867 0.2593 0.1448 0.1619 -0.1616 -0.0425 138 GLY A C 939 O O . GLY A 138 ? 0.6997 0.2058 0.2145 0.0738 -0.1272 0.0265 138 GLY A O 940 N N . GLY A 139 ? 0.5518 0.2344 0.1756 0.1070 -0.1440 -0.0280 139 GLY A N 941 C CA . GLY A 139 ? 0.5494 0.2090 0.2006 0.1011 -0.1337 0.0098 139 GLY A CA 942 C C . GLY A 139 ? 0.4286 0.2286 0.1380 0.0831 -0.1297 -0.0105 139 GLY A C 943 O O . GLY A 139 ? 0.4148 0.3156 0.1623 0.1114 -0.0671 -0.0432 139 GLY A O 944 N N . PRO A 140 ? 0.3479 0.1924 0.2350 0.0239 -0.1505 -0.0439 140 PRO A N 945 C CA . PRO A 140 ? 0.3084 0.1954 0.2162 0.0104 -0.0978 -0.0769 140 PRO A CA 946 C C . PRO A 140 ? 0.2878 0.1901 0.2274 0.0472 -0.0752 -0.0932 140 PRO A C 947 O O . PRO A 140 ? 0.3784 0.2332 0.2048 -0.0211 -0.0508 -0.0938 140 PRO A O 948 C CB . PRO A 140 ? 0.2992 0.1737 0.3306 -0.0015 -0.0277 -0.0488 140 PRO A CB 949 C CG . PRO A 140 ? 0.2974 0.1888 0.2464 -0.0166 -0.1303 -0.0081 140 PRO A CG 950 C CD . PRO A 140 ? 0.3809 0.1899 0.2245 -0.0178 -0.1205 -0.0226 140 PRO A CD 951 N N . ALA A 141 ? 0.3437 0.2012 0.2364 0.0187 -0.0632 -0.1067 141 ALA A N 952 C CA . ALA A 141 ? 0.3624 0.2735 0.2238 0.0593 -0.0622 -0.0811 141 ALA A CA 953 C C . ALA A 141 ? 0.3617 0.1801 0.1747 0.0505 -0.0546 -0.0754 141 ALA A C 954 O O . ALA A 141 ? 0.3897 0.2312 0.1725 0.0057 -0.0916 -0.0431 141 ALA A O 955 C CB . ALA A 141 ? 0.4296 0.2940 0.1965 -0.0584 -0.0828 -0.0132 141 ALA A CB 956 N N . ALA A 142 ? 0.4223 0.1893 0.2045 0.0222 -0.1218 -0.0573 142 ALA A N 957 C CA . ALA A 142 ? 0.4390 0.1872 0.1797 0.0650 -0.1061 -0.0636 142 ALA A CA 958 C C . ALA A 142 ? 0.3789 0.1391 0.1454 0.0670 -0.0859 -0.0326 142 ALA A C 959 O O . ALA A 142 ? 0.3838 0.2164 0.1798 0.0483 -0.0511 -0.0635 142 ALA A O 960 C CB . ALA A 142 ? 0.5666 0.1508 0.3404 0.0818 -0.1593 -0.1105 142 ALA A CB 961 N N . MET A 143 ? 0.3433 0.1456 0.1710 0.0632 -0.0874 -0.0461 143 MET A N 962 C CA . MET A 143 ? 0.3276 0.1181 0.1643 0.0573 -0.0654 -0.0371 143 MET A CA 963 C C . MET A 143 ? 0.2989 0.1465 0.1770 0.0588 -0.0647 -0.0144 143 MET A C 964 O O . MET A 143 ? 0.2702 0.1936 0.0881 0.0575 -0.0163 0.0028 143 MET A O 965 C CB . MET A 143 ? 0.3388 0.1468 0.1505 0.0306 -0.0671 -0.0345 143 MET A CB 966 C CG . MET A 143 ? 0.3242 0.1372 0.1172 0.0260 -0.0692 -0.0116 143 MET A CG 967 S SD . MET A 143 ? 0.3218 0.1932 0.1519 0.0507 -0.0611 0.0234 143 MET A SD 968 C CE . MET A 143 ? 0.3224 0.2434 0.1121 0.0211 -0.0590 -0.0162 143 MET A CE 969 N N . THR A 144 ? 0.2926 0.1538 0.1242 0.0348 -0.0513 -0.0223 144 THR A N 970 C CA . THR A 144 ? 0.3523 0.1494 0.1253 0.0565 -0.0343 -0.0207 144 THR A CA 971 C C . THR A 144 ? 0.3803 0.1635 0.0998 0.0559 -0.0244 0.0053 144 THR A C 972 O O . THR A 144 ? 0.3699 0.1933 0.1155 0.0462 -0.0204 -0.0037 144 THR A O 973 C CB . THR A 144 ? 0.3653 0.1487 0.1139 0.0307 -0.0506 -0.0077 144 THR A CB 974 O OG1 . THR A 144 ? 0.3337 0.1517 0.1117 0.0333 -0.0682 -0.0178 144 THR A OG1 975 C CG2 . THR A 144 ? 0.3443 0.1807 0.2100 0.0234 -0.0471 0.0441 144 THR A CG2 976 N N . GLN A 145 ? 0.3512 0.1941 0.1399 0.0669 -0.0361 -0.0375 145 GLN A N 977 C CA . GLN A 145 ? 0.3544 0.2233 0.1533 0.0535 -0.0248 -0.0361 145 GLN A CA 978 C C . GLN A 145 ? 0.3522 0.2103 0.1457 0.0468 -0.0193 -0.0142 145 GLN A C 979 O O . GLN A 145 ? 0.3451 0.2451 0.1300 0.0568 -0.0094 -0.0251 145 GLN A O 980 C CB . GLN A 145 ? 0.5071 0.3627 0.1990 0.1229 -0.0984 -0.1849 145 GLN A CB 981 C CG A GLN A 145 ? 0.5246 0.4344 0.1685 0.0408 -0.0800 -0.1637 145 GLN A CG 982 C CG B GLN A 145 ? 0.5090 0.4151 0.1841 0.0769 -0.0571 -0.1194 145 GLN A CG 983 C CD A GLN A 145 ? 0.6423 0.4694 0.3060 -0.0692 -0.0332 -0.1952 145 GLN A CD 984 C CD B GLN A 145 ? 0.4401 0.4562 0.2865 0.0877 -0.0468 -0.1087 145 GLN A CD 985 O OE1 A GLN A 145 ? 0.9599 0.4305 0.3474 0.0590 -0.0300 -0.2715 145 GLN A OE1 986 O OE1 B GLN A 145 ? 0.3825 0.3762 0.6215 0.0408 -0.1057 -0.0409 145 GLN A OE1 987 N NE2 A GLN A 145 ? 0.7178 0.5706 0.4292 -0.1957 -0.1378 -0.2225 145 GLN A NE2 988 N NE2 B GLN A 145 ? 0.2496 0.5095 0.2771 0.0958 -0.0158 -0.0602 145 GLN A NE2 989 N N . TYR A 146 ? 0.3414 0.1808 0.1397 0.0483 -0.0159 -0.0272 146 TYR A N 990 C CA . TYR A 146 ? 0.3443 0.1765 0.1273 0.0390 -0.0077 -0.0350 146 TYR A CA 991 C C . TYR A 146 ? 0.3331 0.1758 0.1038 0.0420 0.0145 -0.0280 146 TYR A C 992 O O . TYR A 146 ? 0.3270 0.1830 0.1127 0.0385 -0.0045 -0.0084 146 TYR A O 993 C CB . TYR A 146 ? 0.3294 0.1761 0.1433 0.0334 -0.0193 -0.0169 146 TYR A CB 994 C CG . TYR A 146 ? 0.3557 0.1390 0.1625 -0.0187 -0.0424 -0.0124 146 TYR A CG 995 C CD1 . TYR A 146 ? 0.4288 0.1924 0.1114 -0.0588 -0.0156 0.0150 146 TYR A CD1 996 C CD2 . TYR A 146 ? 0.3896 0.1728 0.2424 0.0646 -0.1171 -0.0174 146 TYR A CD2 997 C CE1 . TYR A 146 ? 0.4907 0.1847 0.1355 -0.0568 -0.0741 0.0344 146 TYR A CE1 998 C CE2 . TYR A 146 ? 0.4213 0.1606 0.3065 0.0396 -0.1553 -0.0188 146 TYR A CE2 999 C CZ . TYR A 146 ? 0.4812 0.1660 0.2706 -0.0365 -0.1351 0.0034 146 TYR A CZ 1000 O OH . TYR A 146 ? 0.5215 0.2258 0.2552 -0.0445 -0.1600 0.0426 146 TYR A OH 1001 N N . PHE A 147 ? 0.3436 0.1598 0.1062 0.0452 0.0396 0.0087 147 PHE A N 1002 C CA . PHE A 147 ? 0.3463 0.1702 0.1098 0.0464 0.0530 -0.0087 147 PHE A CA 1003 C C . PHE A 147 ? 0.3646 0.1286 0.0987 0.0491 0.0317 -0.0103 147 PHE A C 1004 O O . PHE A 147 ? 0.3997 0.1502 0.1364 0.0105 0.0368 0.0120 147 PHE A O 1005 C CB . PHE A 147 ? 0.3291 0.1439 0.1124 0.0441 0.0134 0.0044 147 PHE A CB 1006 C CG . PHE A 147 ? 0.2828 0.1270 0.1139 0.0573 0.0134 -0.0060 147 PHE A CG 1007 C CD1 . PHE A 147 ? 0.3372 0.1529 0.1288 -0.0335 0.0086 -0.0255 147 PHE A CD1 1008 C CD2 . PHE A 147 ? 0.2614 0.1771 0.1078 0.0637 -0.0010 0.0385 147 PHE A CD2 1009 C CE1 . PHE A 147 ? 0.2906 0.1106 0.1466 0.0031 0.0305 -0.0369 147 PHE A CE1 1010 C CE2 . PHE A 147 ? 0.2807 0.1503 0.1077 0.0466 -0.0093 0.0260 147 PHE A CE2 1011 C CZ . PHE A 147 ? 0.3022 0.1297 0.1108 0.0384 0.0312 0.0071 147 PHE A CZ 1012 N N . ARG A 148 ? 0.3580 0.2375 0.0987 0.0641 0.0197 -0.0089 148 ARG A N 1013 C CA . ARG A 148 ? 0.3915 0.2514 0.1028 0.0756 0.0259 0.0047 148 ARG A CA 1014 C C . ARG A 148 ? 0.3914 0.2927 0.0982 0.0915 0.0359 0.0363 148 ARG A C 1015 O O . ARG A 148 ? 0.3897 0.2822 0.1464 0.0897 0.0216 0.0326 148 ARG A O 1016 C CB . ARG A 148 ? 0.3848 0.2826 0.0936 0.0668 0.0400 -0.0132 148 ARG A CB 1017 C CG . ARG A 148 ? 0.3847 0.2999 0.1276 0.0787 0.0350 0.0600 148 ARG A CG 1018 C CD . ARG A 148 ? 0.4902 0.3037 0.1410 0.1213 0.0397 0.0592 148 ARG A CD 1019 N NE . ARG A 148 ? 0.4578 0.2817 0.1198 0.0936 -0.0431 -0.0128 148 ARG A NE 1020 C CZ . ARG A 148 ? 0.3799 0.2990 0.1444 0.0804 -0.0352 0.0050 148 ARG A CZ 1021 N NH1 . ARG A 148 ? 0.3745 0.3286 0.1022 0.1438 0.0128 0.0147 148 ARG A NH1 1022 N NH2 . ARG A 148 ? 0.3991 0.3095 0.2271 0.1270 -0.0692 -0.0601 148 ARG A NH2 1023 N N . LYS A 149 ? 0.3592 0.2641 0.1465 0.0704 0.0497 -0.0207 149 LYS A N 1024 C CA . LYS A 149 ? 0.3724 0.3267 0.1362 0.1072 0.0318 -0.0034 149 LYS A CA 1025 C C . LYS A 149 ? 0.3638 0.2897 0.2512 0.1113 0.0201 -0.0314 149 LYS A C 1026 O O . LYS A 149 ? 0.3724 0.2862 0.3009 0.0955 0.0348 0.0091 149 LYS A O 1027 C CB . LYS A 149 ? 0.4411 0.2924 0.2675 0.1167 -0.0023 -0.0794 149 LYS A CB 1028 C CG . LYS A 149 ? 0.3987 0.3192 0.4267 0.1025 0.0188 -0.0092 149 LYS A CG 1029 C CD . LYS A 149 ? 0.5407 0.2729 0.6341 0.0873 -0.0562 0.0157 149 LYS A CD 1030 C CE . LYS A 149 ? 0.5814 0.3265 0.7645 0.1311 0.0096 0.0856 149 LYS A CE 1031 N NZ . LYS A 149 ? 0.8686 0.3259 1.0561 0.2115 -0.1599 -0.0668 149 LYS A NZ 1032 N N . ILE A 150 ? 0.3782 0.1905 0.2163 0.0713 -0.0049 -0.0087 150 ILE A N 1033 C CA . ILE A 150 ? 0.3204 0.2012 0.2399 0.0310 0.0193 0.0330 150 ILE A CA 1034 C C . ILE A 150 ? 0.3839 0.2015 0.2593 0.0414 -0.0283 0.0245 150 ILE A C 1035 O O . ILE A 150 ? 0.5471 0.2109 0.2777 -0.0205 -0.0709 0.0463 150 ILE A O 1036 C CB . ILE A 150 ? 0.3455 0.1943 0.2232 0.0098 0.0020 0.0044 150 ILE A CB 1037 C CG1 . ILE A 150 ? 0.3042 0.3100 0.2204 -0.0366 -0.0010 0.0041 150 ILE A CG1 1038 C CG2 . ILE A 150 ? 0.4653 0.2156 0.4357 0.0611 -0.1045 0.1075 150 ILE A CG2 1039 C CD1 . ILE A 150 ? 0.4725 0.2794 0.1957 -0.0079 0.0126 -0.0558 150 ILE A CD1 1040 N N . GLY A 151 ? 0.3627 0.2149 0.2185 0.0419 0.0269 0.0380 151 GLY A N 1041 C CA . GLY A 151 ? 0.3507 0.2126 0.2348 0.0430 0.0306 0.0360 151 GLY A CA 1042 C C . GLY A 151 ? 0.4173 0.2027 0.1836 0.0205 0.0697 -0.0108 151 GLY A C 1043 O O . GLY A 151 ? 0.3648 0.2050 0.3598 0.0189 0.0745 0.0124 151 GLY A O 1044 N N . ASP A 152 ? 0.4013 0.1846 0.1567 0.0391 0.0483 0.0052 152 ASP A N 1045 C CA . ASP A 152 ? 0.4133 0.2013 0.1107 0.0439 0.0370 -0.0264 152 ASP A CA 1046 C C . ASP A 152 ? 0.4469 0.2090 0.1093 0.0963 0.0220 -0.0181 152 ASP A C 1047 O O . ASP A 152 ? 0.3820 0.2302 0.1158 0.1050 -0.0174 0.0040 152 ASP A O 1048 C CB . ASP A 152 ? 0.3809 0.1707 0.1296 0.0667 0.0190 -0.0016 152 ASP A CB 1049 C CG . ASP A 152 ? 0.2815 0.1616 0.1192 0.0065 -0.0141 0.0034 152 ASP A CG 1050 O OD1 . ASP A 152 ? 0.3256 0.1577 0.1418 0.0305 -0.0091 0.0114 152 ASP A OD1 1051 O OD2 . ASP A 152 ? 0.3182 0.2066 0.1088 0.0386 -0.0240 -0.0033 152 ASP A OD2 1052 N N . SER A 153 ? 0.4261 0.2627 0.1538 0.0831 0.0785 0.0532 153 SER A N 1053 C CA . SER A 153 ? 0.5297 0.3052 0.0881 0.1369 0.0683 0.0477 153 SER A CA 1054 C C . SER A 153 ? 0.4869 0.2330 0.0843 0.1385 0.0005 0.0159 153 SER A C 1055 O O . SER A 153 ? 0.5098 0.2758 0.0974 0.0504 -0.0516 -0.0021 153 SER A O 1056 C CB . SER A 153 ? 0.6268 0.3053 0.1678 0.1669 0.1108 0.0872 153 SER A CB 1057 O OG . SER A 153 ? 0.6285 0.2909 0.3198 0.1695 0.1662 0.0611 153 SER A OG 1058 N N . VAL A 154 ? 0.3607 0.1559 0.0830 0.0458 0.0032 0.0155 154 VAL A N 1059 C CA . VAL A 154 ? 0.3303 0.1271 0.1098 0.0211 -0.0050 0.0048 154 VAL A CA 1060 C C . VAL A 154 ? 0.2915 0.0738 0.1546 0.0477 -0.0190 0.0130 154 VAL A C 1061 O O . VAL A 154 ? 0.2901 0.1810 0.1088 0.0309 -0.0317 -0.0120 154 VAL A O 1062 C CB . VAL A 154 ? 0.2958 0.1254 0.1115 0.0135 0.0001 0.0077 154 VAL A CB 1063 C CG1 . VAL A 154 ? 0.2507 0.1407 0.1379 -0.0085 -0.0148 -0.0220 154 VAL A CG1 1064 C CG2 . VAL A 154 ? 0.2842 0.1616 0.2409 0.0001 0.0358 0.0501 154 VAL A CG2 1065 N N . SER A 155 ? 0.3081 0.0934 0.1070 0.0301 -0.0349 -0.0051 155 SER A N 1066 C CA . SER A 155 ? 0.2708 0.1044 0.1051 0.0211 -0.0425 -0.0020 155 SER A CA 1067 C C . SER A 155 ? 0.2247 0.1162 0.1083 0.0458 -0.0403 -0.0161 155 SER A C 1068 O O . SER A 155 ? 0.2700 0.1439 0.1074 0.0162 -0.0176 -0.0252 155 SER A O 1069 C CB . SER A 155 ? 0.2838 0.0957 0.1053 0.0166 -0.0631 -0.0194 155 SER A CB 1070 O OG . SER A 155 ? 0.2574 0.1568 0.1036 -0.0129 -0.0318 -0.0093 155 SER A OG 1071 N N . ARG A 156 ? 0.2425 0.1219 0.0835 0.0317 -0.0383 -0.0187 156 ARG A N 1072 C CA . ARG A 156 ? 0.2614 0.1088 0.0994 0.0260 -0.0678 -0.0052 156 ARG A CA 1073 C C . ARG A 156 ? 0.2555 0.1167 0.0947 0.0309 -0.0616 -0.0005 156 ARG A C 1074 O O . ARG A 156 ? 0.2981 0.1237 0.1108 0.0107 -0.0435 -0.0184 156 ARG A O 1075 C CB . ARG A 156 ? 0.2429 0.1201 0.1015 0.0153 -0.0584 0.0126 156 ARG A CB 1076 C CG . ARG A 156 ? 0.2685 0.1406 0.0948 0.0331 -0.0499 0.0215 156 ARG A CG 1077 C CD . ARG A 156 ? 0.2612 0.1433 0.1069 0.0379 -0.0403 0.0304 156 ARG A CD 1078 N NE . ARG A 156 ? 0.2951 0.1670 0.1489 0.0364 -0.0894 0.0311 156 ARG A NE 1079 C CZ . ARG A 156 ? 0.2795 0.1955 0.1042 0.0445 -0.0607 0.0409 156 ARG A CZ 1080 N NH1 . ARG A 156 ? 0.2548 0.2433 0.1974 0.0277 -0.0682 0.1104 156 ARG A NH1 1081 N NH2 . ARG A 156 ? 0.2510 0.2493 0.1183 0.0193 -0.0442 0.0536 156 ARG A NH2 1082 N N . LEU A 157 ? 0.2724 0.1158 0.1264 0.0253 -0.0555 -0.0080 157 LEU A N 1083 C CA . LEU A 157 ? 0.2952 0.1131 0.1149 0.0182 -0.0773 0.0031 157 LEU A CA 1084 C C . LEU A 157 ? 0.3168 0.1168 0.0890 0.0022 -0.0789 0.0135 157 LEU A C 1085 O O . LEU A 157 ? 0.3422 0.1564 0.1495 0.0350 -0.0846 -0.0448 157 LEU A O 1086 C CB . LEU A 157 ? 0.2662 0.1100 0.1561 0.0216 -0.0810 -0.0014 157 LEU A CB 1087 C CG . LEU A 157 ? 0.3441 0.1193 0.1233 -0.0016 -0.0775 0.0052 157 LEU A CG 1088 C CD1 . LEU A 157 ? 0.3143 0.1765 0.1332 0.0662 -0.0805 -0.0034 157 LEU A CD1 1089 C CD2 . LEU A 157 ? 0.3176 0.1406 0.1259 0.0236 -0.0814 0.0018 157 LEU A CD2 1090 N N . ASP A 158 ? 0.3054 0.1412 0.1385 0.0243 -0.0950 -0.0111 158 ASP A N 1091 C CA . ASP A 158 ? 0.3279 0.1175 0.1282 0.0068 -0.0974 -0.0036 158 ASP A CA 1092 C C . ASP A 158 ? 0.3657 0.1304 0.1493 -0.0180 -0.0961 -0.0062 158 ASP A C 1093 O O . ASP A 158 ? 0.4436 0.1497 0.1738 -0.0496 -0.1504 0.0127 158 ASP A O 1094 C CB . ASP A 158 ? 0.3053 0.1408 0.1376 0.0094 -0.0922 0.0107 158 ASP A CB 1095 C CG . ASP A 158 ? 0.3394 0.1336 0.1269 0.0042 -0.1031 0.0182 158 ASP A CG 1096 O OD1 . ASP A 158 ? 0.4473 0.2153 0.1414 -0.0880 -0.1219 0.0417 158 ASP A OD1 1097 O OD2 . ASP A 158 ? 0.2856 0.1331 0.1563 0.0215 -0.0927 0.0146 158 ASP A OD2 1098 N N . ARG A 159 ? 0.3140 0.1275 0.1515 -0.0078 -0.0932 0.0031 159 ARG A N 1099 C CA . ARG A 159 ? 0.2728 0.1508 0.1830 0.0048 -0.1122 0.0319 159 ARG A CA 1100 C C . ARG A 159 ? 0.2535 0.1147 0.1489 0.0108 -0.0840 -0.0012 159 ARG A C 1101 O O . ARG A 159 ? 0.2684 0.1213 0.2343 0.0002 -0.1415 0.0532 159 ARG A O 1102 C CB . ARG A 159 ? 0.2794 0.1610 0.1738 0.0191 -0.1126 0.0439 159 ARG A CB 1103 C CG . ARG A 159 ? 0.3121 0.1651 0.2471 0.0191 -0.1792 0.0231 159 ARG A CG 1104 C CD . ARG A 159 ? 0.3179 0.1554 0.2698 0.0260 -0.1834 0.0305 159 ARG A CD 1105 N NE . ARG A 159 ? 0.2103 0.1515 0.2329 0.0000 -0.0919 0.0590 159 ARG A NE 1106 C CZ . ARG A 159 ? 0.2422 0.1654 0.2584 0.0067 -0.0908 0.0311 159 ARG A CZ 1107 N NH1 . ARG A 159 ? 0.2387 0.2463 0.3109 0.0423 -0.0821 0.0301 159 ARG A NH1 1108 N NH2 . ARG A 159 ? 0.3191 0.1530 0.2346 -0.0057 -0.1081 0.0555 159 ARG A NH2 1109 N N . LYS A 160 ? 0.2685 0.1388 0.2050 -0.0096 -0.0922 0.0259 160 LYS A N 1110 C CA . LYS A 160 ? 0.2209 0.1060 0.2038 0.0110 -0.0701 0.0176 160 LYS A CA 1111 C C . LYS A 160 ? 0.1940 0.1014 0.1946 0.0051 -0.0989 0.0053 160 LYS A C 1112 O O . LYS A 160 ? 0.2092 0.1111 0.1993 0.0178 -0.0771 0.0162 160 LYS A O 1113 C CB . LYS A 160 ? 0.2813 0.1197 0.1911 -0.0054 -0.1011 -0.0130 160 LYS A CB 1114 C CG . LYS A 160 ? 0.2953 0.1535 0.2627 -0.0360 -0.1552 0.0228 160 LYS A CG 1115 C CD . LYS A 160 ? 0.4517 0.1758 0.3064 -0.1116 -0.2204 0.0214 160 LYS A CD 1116 C CE . LYS A 160 ? 0.3621 0.2295 0.4471 -0.0926 -0.1240 -0.0609 160 LYS A CE 1117 N NZ . LYS A 160 ? 0.4998 0.5671 0.2529 -0.1613 -0.0825 0.0103 160 LYS A NZ 1118 N N . GLU A 161 ? 0.2116 0.1269 0.1958 0.0133 -0.0893 0.0126 161 GLU A N 1119 C CA . GLU A 161 ? 0.2070 0.1106 0.1963 0.0035 -0.0742 0.0278 161 GLU A CA 1120 C C . GLU A 161 ? 0.2090 0.0813 0.3020 0.0103 -0.0530 0.0307 161 GLU A C 1121 O O . GLU A 161 ? 0.2575 0.0938 0.3039 -0.0044 -0.0918 0.0142 161 GLU A O 1122 C CB . GLU A 161 ? 0.2801 0.1666 0.2048 0.0326 -0.1246 0.0001 161 GLU A CB 1123 C CG . GLU A 161 ? 0.2641 0.2831 0.1723 0.0214 -0.1243 0.0372 161 GLU A CG 1124 C CD . GLU A 161 ? 0.2589 0.2763 0.1948 -0.0544 -0.0890 0.0246 161 GLU A CD 1125 O OE1 . GLU A 161 ? 0.2743 0.2650 0.4152 -0.0805 -0.1456 0.1524 161 GLU A OE1 1126 O OE2 . GLU A 161 ? 0.2772 0.2301 0.2912 -0.0354 -0.1204 -0.0202 161 GLU A OE2 1127 N N . PRO A 162 ? 0.2268 0.1299 0.2813 0.0027 -0.0310 0.0271 162 PRO A N 1128 C CA . PRO A 162 ? 0.2439 0.1341 0.2275 0.0260 -0.0048 0.0279 162 PRO A CA 1129 C C . PRO A 162 ? 0.2231 0.1208 0.2329 0.0129 -0.0261 0.0108 162 PRO A C 1130 O O . PRO A 162 ? 0.2173 0.1235 0.2408 -0.0004 -0.0315 0.0060 162 PRO A O 1131 C CB . PRO A 162 ? 0.3023 0.2416 0.2449 -0.0162 0.0268 0.0294 162 PRO A CB 1132 C CG . PRO A 162 ? 0.3433 0.2667 0.2897 -0.0681 0.0768 -0.0243 162 PRO A CG 1133 C CD . PRO A 162 ? 0.2800 0.1823 0.4021 -0.0245 0.0554 0.0124 162 PRO A CD 1134 N N . GLU A 163 ? 0.2327 0.1184 0.2756 -0.0020 -0.0774 0.0120 163 GLU A N 1135 C CA . GLU A 163 ? 0.2273 0.1340 0.2727 0.0140 -0.0422 0.0292 163 GLU A CA 1136 C C . GLU A 163 ? 0.2247 0.1243 0.1787 0.0162 -0.0530 -0.0005 163 GLU A C 1137 O O . GLU A 163 ? 0.2158 0.1343 0.1932 0.0082 -0.0753 0.0309 163 GLU A O 1138 C CB . GLU A 163 ? 0.2238 0.3647 0.4183 -0.0757 -0.1939 0.0720 163 GLU A CB 1139 C CG . GLU A 163 ? 0.4951 0.2767 0.5510 -0.0622 -0.2241 -0.0464 163 GLU A CG 1140 C CD . GLU A 163 ? 0.4076 0.3755 0.5386 -0.0159 -0.2021 -0.0465 163 GLU A CD 1141 O OE1 . GLU A 163 ? 0.4002 0.1887 0.5241 -0.0987 -0.1343 -0.0527 163 GLU A OE1 1142 O OE2 . GLU A 163 ? 0.3663 0.3229 0.5124 -0.0719 -0.0608 0.0784 163 GLU A OE2 1143 N N . MET A 164 ? 0.2085 0.1182 0.2241 -0.0078 -0.1072 -0.0001 164 MET A N 1144 C CA . MET A 164 ? 0.2193 0.1115 0.1967 0.0147 -0.0510 -0.0027 164 MET A CA 1145 C C . MET A 164 ? 0.2341 0.1052 0.1724 -0.0072 -0.0794 0.0120 164 MET A C 1146 O O . MET A 164 ? 0.2604 0.1036 0.1996 0.0051 -0.0475 0.0143 164 MET A O 1147 C CB . MET A 164 ? 0.2086 0.1454 0.2677 0.0346 -0.1004 -0.0023 164 MET A CB 1148 C CG . MET A 164 ? 0.3600 0.1615 0.2655 0.0634 -0.1703 -0.0247 164 MET A CG 1149 S SD . MET A 164 ? 0.2868 0.1640 0.2476 -0.0058 -0.1184 0.0254 164 MET A SD 1150 C CE . MET A 164 ? 0.2973 0.2722 0.1449 0.0725 -0.0890 -0.0092 164 MET A CE 1151 N N . GLY A 165 ? 0.2420 0.1039 0.1576 0.0117 -0.0894 0.0179 165 GLY A N 1152 C CA . GLY A 165 ? 0.2487 0.1138 0.2031 0.0308 -0.0884 -0.0135 165 GLY A CA 1153 C C . GLY A 165 ? 0.2259 0.1221 0.1746 0.0153 -0.0388 0.0342 165 GLY A C 1154 O O . GLY A 165 ? 0.2203 0.1165 0.2105 0.0081 -0.0281 0.0176 165 GLY A O 1155 N N . ASP A 166 ? 0.2058 0.1223 0.2115 0.0088 -0.0449 0.0221 166 ASP A N 1156 C CA . ASP A 166 ? 0.2056 0.1151 0.2543 0.0070 -0.0503 0.0267 166 ASP A CA 1157 C C . ASP A 166 ? 0.2592 0.1183 0.1496 0.0161 -0.0048 0.0381 166 ASP A C 1158 O O . ASP A 166 ? 0.2392 0.1265 0.1895 0.0094 -0.0143 0.0133 166 ASP A O 1159 C CB . ASP A 166 ? 0.2552 0.1529 0.3226 0.0400 -0.1180 -0.0074 166 ASP A CB 1160 C CG . ASP A 166 ? 0.2473 0.1537 0.4718 0.0337 -0.1271 -0.0542 166 ASP A CG 1161 O OD1 . ASP A 166 ? 0.2947 0.1649 0.6060 0.0120 -0.0544 0.0443 166 ASP A OD1 1162 O OD2 . ASP A 166 ? 0.4129 0.3559 0.6342 -0.0628 -0.2458 -0.1243 166 ASP A OD2 1163 N N . ASN A 167 ? 0.2175 0.1061 0.1658 0.0197 -0.0286 0.0278 167 ASN A N 1164 C CA . ASN A 167 ? 0.2312 0.0998 0.1683 0.0316 -0.0294 0.0328 167 ASN A CA 1165 C C . ASN A 167 ? 0.2504 0.1272 0.1747 0.0502 -0.0335 0.0422 167 ASN A C 1166 O O . ASN A 167 ? 0.2734 0.1492 0.2046 0.0769 -0.0114 0.0236 167 ASN A O 1167 C CB . ASN A 167 ? 0.2385 0.1077 0.1758 0.0175 -0.0395 0.0307 167 ASN A CB 1168 C CG . ASN A 167 ? 0.2002 0.1205 0.1778 0.0179 0.0192 0.0037 167 ASN A CG 1169 O OD1 . ASN A 167 ? 0.2655 0.1604 0.1905 -0.0022 -0.0125 -0.0125 167 ASN A OD1 1170 N ND2 . ASN A 167 ? 0.2353 0.0998 0.1745 0.0265 -0.0070 0.0245 167 ASN A ND2 1171 N N . THR A 168 ? 0.2450 0.1521 0.1671 0.0416 -0.0281 0.0572 168 THR A N 1172 C CA . THR A 168 ? 0.2618 0.1545 0.1874 0.0407 -0.0485 0.0608 168 THR A CA 1173 C C . THR A 168 ? 0.2289 0.1514 0.2545 0.0462 -0.0510 0.0648 168 THR A C 1174 O O . THR A 168 ? 0.2502 0.1605 0.3014 0.0545 -0.0161 0.0941 168 THR A O 1175 C CB . THR A 168 ? 0.3171 0.1740 0.2787 0.0217 -0.1256 0.0620 168 THR A CB 1176 O OG1 . THR A 168 ? 0.3162 0.2338 0.2774 -0.0441 -0.0712 0.0676 168 THR A OG1 1177 C CG2 . THR A 168 ? 0.2495 0.3673 0.4934 0.0044 -0.1383 0.2237 168 THR A CG2 1178 N N . PRO A 169 ? 0.3029 0.1544 0.3610 0.1061 0.0205 0.1274 169 PRO A N 1179 C CA . PRO A 169 ? 0.3388 0.1524 0.4811 0.0722 0.0482 0.0913 169 PRO A CA 1180 C C . PRO A 169 ? 0.3699 0.1147 0.5034 0.0314 0.1137 0.1425 169 PRO A C 1181 O O . PRO A 169 ? 0.3045 0.2509 0.4172 0.1371 0.0890 0.2120 169 PRO A O 1182 C CB . PRO A 169 ? 0.3880 0.1637 0.4468 0.1210 0.0043 0.0924 169 PRO A CB 1183 C CG . PRO A 169 ? 0.3821 0.2308 0.3681 0.1498 -0.0026 0.0752 169 PRO A CG 1184 C CD . PRO A 169 ? 0.3801 0.2105 0.3241 0.1197 0.0578 0.1185 169 PRO A CD 1185 N N . GLY A 170 ? 0.3646 0.1355 0.6482 0.0618 0.1652 0.1477 170 GLY A N 1186 C CA . GLY A 170 ? 0.3252 0.1807 0.6781 0.0923 0.2195 0.1997 170 GLY A CA 1187 C C . GLY A 170 ? 0.2909 0.2007 0.6420 0.0766 0.2492 0.2037 170 GLY A C 1188 O O . GLY A 170 ? 0.4319 0.2199 0.6880 0.1035 0.3235 0.2526 170 GLY A O 1189 N N . ASP A 171 ? 0.2752 0.1839 0.4297 0.0954 0.0988 0.1441 171 ASP A N 1190 C CA . ASP A 171 ? 0.2168 0.2102 0.2856 0.0529 0.0332 0.1280 171 ASP A CA 1191 C C . ASP A 171 ? 0.2221 0.2427 0.1946 0.0850 0.0208 0.1137 171 ASP A C 1192 O O . ASP A 171 ? 0.2637 0.2770 0.1853 0.1340 0.0049 0.0713 171 ASP A O 1193 C CB . ASP A 171 ? 0.2958 0.1918 0.2969 0.0435 0.0596 0.1086 171 ASP A CB 1194 C CG . ASP A 171 ? 0.3583 0.2098 0.2496 0.0378 -0.0011 0.1018 171 ASP A CG 1195 O OD1 . ASP A 171 ? 0.2460 0.2737 0.2301 -0.0038 -0.0487 0.0505 171 ASP A OD1 1196 O OD2 . ASP A 171 ? 0.3876 0.2331 0.2325 -0.0390 -0.0196 0.0508 171 ASP A OD2 1197 N N . LEU A 172 ? 0.2119 0.1725 0.1813 0.0498 -0.0081 0.0830 172 LEU A N 1198 C CA . LEU A 172 ? 0.2109 0.1282 0.1018 0.0339 -0.0200 0.0184 172 LEU A CA 1199 C C . LEU A 172 ? 0.1920 0.1343 0.1122 0.0257 -0.0285 0.0265 172 LEU A C 1200 O O . LEU A 172 ? 0.1875 0.1212 0.1213 0.0150 -0.0411 0.0088 172 LEU A O 1201 C CB . LEU A 172 ? 0.2239 0.1450 0.1380 0.0199 -0.0162 0.0421 172 LEU A CB 1202 C CG . LEU A 172 ? 0.2521 0.1387 0.1690 0.0038 -0.0547 0.0526 172 LEU A CG 1203 C CD1 . LEU A 172 ? 0.2431 0.1338 0.1969 0.0086 -0.0032 0.0460 172 LEU A CD1 1204 C CD2 . LEU A 172 ? 0.2585 0.1558 0.2198 0.0514 -0.0751 0.0022 172 LEU A CD2 1205 N N . ARG A 173 ? 0.1892 0.1293 0.1161 0.0186 -0.0494 0.0351 173 ARG A N 1206 C CA . ARG A 173 ? 0.1869 0.1281 0.1440 0.0233 -0.0472 0.0056 173 ARG A CA 1207 C C . ARG A 173 ? 0.2474 0.0855 0.1467 0.0189 -0.0763 0.0052 173 ARG A C 1208 O O . ARG A 173 ? 0.1917 0.1119 0.1581 0.0199 -0.0617 -0.0015 173 ARG A O 1209 C CB . ARG A 173 ? 0.2217 0.1282 0.1721 0.0031 -0.0740 0.0252 173 ARG A CB 1210 C CG . ARG A 173 ? 0.2437 0.1588 0.1956 0.0000 -0.1088 0.0326 173 ARG A CG 1211 C CD . ARG A 173 ? 0.2673 0.2084 0.2026 -0.0330 -0.1119 0.0254 173 ARG A CD 1212 N NE . ARG A 173 ? 0.2664 0.2702 0.2167 -0.0516 -0.0884 0.0248 173 ARG A NE 1213 C CZ . ARG A 173 ? 0.2386 0.2886 0.2667 -0.0368 -0.1280 0.0659 173 ARG A CZ 1214 N NH1 . ARG A 173 ? 0.3024 0.3106 0.2660 -0.0895 -0.1450 0.0630 173 ARG A NH1 1215 N NH2 . ARG A 173 ? 0.2963 0.3653 0.2642 -0.0576 -0.0409 0.0915 173 ARG A NH2 1216 N N . ASP A 174 ? 0.2143 0.0932 0.0947 0.0046 -0.0558 -0.0016 174 ASP A N 1217 C CA . ASP A 174 ? 0.2112 0.1065 0.1066 -0.0034 -0.0630 0.0018 174 ASP A CA 1218 C C . ASP A 174 ? 0.2398 0.0990 0.1022 -0.0069 -0.0938 0.0250 174 ASP A C 1219 O O . ASP A 174 ? 0.2570 0.0962 0.0931 -0.0186 -0.0618 0.0134 174 ASP A O 1220 C CB . ASP A 174 ? 0.2738 0.1134 0.1102 -0.0279 -0.0528 0.0140 174 ASP A CB 1221 C CG . ASP A 174 ? 0.2282 0.1232 0.1570 -0.0169 -0.0473 -0.0149 174 ASP A CG 1222 O OD1 . ASP A 174 ? 0.2566 0.1400 0.1467 0.0033 -0.0599 -0.0112 174 ASP A OD1 1223 O OD2 . ASP A 174 ? 0.2498 0.1347 0.2089 -0.0014 -0.0991 0.0101 174 ASP A OD2 1224 N N . THR A 175 ? 0.2365 0.1062 0.0797 -0.0033 -0.0595 -0.0039 175 THR A N 1225 C CA . THR A 175 ? 0.2121 0.0909 0.1017 0.0024 -0.0313 0.0031 175 THR A CA 1226 C C . THR A 175 ? 0.2158 0.1045 0.0657 0.0046 -0.0328 0.0064 175 THR A C 1227 O O . THR A 175 ? 0.2269 0.1218 0.0843 -0.0051 -0.0276 -0.0091 175 THR A O 1228 C CB . THR A 175 ? 0.2370 0.1104 0.1175 0.0196 -0.0314 0.0205 175 THR A CB 1229 O OG1 . THR A 175 ? 0.2245 0.1539 0.1176 0.0043 -0.0368 0.0429 175 THR A OG1 1230 C CG2 . THR A 175 ? 0.2374 0.1348 0.1167 0.0304 -0.0416 0.0243 175 THR A CG2 1231 N N . THR A 176 ? 0.2086 0.0984 0.0803 0.0044 -0.0400 0.0039 176 THR A N 1232 C CA . THR A 176 ? 0.2087 0.0969 0.0663 0.0140 -0.0292 -0.0051 176 THR A CA 1233 C C . THR A 176 ? 0.1930 0.1033 0.0622 0.0148 -0.0419 -0.0017 176 THR A C 1234 O O . THR A 176 ? 0.2110 0.0811 0.1203 0.0116 -0.0202 0.0040 176 THR A O 1235 C CB . THR A 176 ? 0.2189 0.0987 0.0898 0.0081 -0.0355 0.0206 176 THR A CB 1236 O OG1 . THR A 176 ? 0.2186 0.1109 0.1119 0.0126 -0.0476 0.0012 176 THR A OG1 1237 C CG2 . THR A 176 ? 0.2402 0.1019 0.0922 0.0086 -0.0511 0.0137 176 THR A CG2 1238 N N . THR A 177 ? 0.2127 0.1116 0.0719 -0.0016 -0.0346 0.0023 177 THR A N 1239 C CA . THR A 177 ? 0.2011 0.0974 0.0762 0.0175 -0.0300 0.0028 177 THR A CA 1240 C C . THR A 177 ? 0.1915 0.0841 0.0752 0.0013 -0.0211 0.0103 177 THR A C 1241 O O . THR A 177 ? 0.2015 0.0816 0.0888 0.0212 -0.0172 0.0068 177 THR A O 1242 C CB . THR A 177 ? 0.2138 0.0927 0.0780 0.0185 -0.0303 -0.0028 177 THR A CB 1243 O OG1 . THR A 177 ? 0.2102 0.1133 0.0980 0.0057 -0.0277 0.0070 177 THR A OG1 1244 C CG2 . THR A 177 ? 0.2171 0.0994 0.0649 0.0015 -0.0298 0.0016 177 THR A CG2 1245 N N . PRO A 178 ? 0.1783 0.0851 0.0845 0.0226 -0.0299 0.0033 178 PRO A N 1246 C CA . PRO A 178 ? 0.1747 0.0829 0.0868 0.0227 -0.0292 0.0141 178 PRO A CA 1247 C C . PRO A 178 ? 0.1727 0.0861 0.0727 0.0139 -0.0293 0.0090 178 PRO A C 1248 O O . PRO A 178 ? 0.1813 0.0931 0.0825 0.0278 -0.0184 0.0148 178 PRO A O 1249 C CB . PRO A 178 ? 0.1697 0.1143 0.0663 0.0101 -0.0074 -0.0011 178 PRO A CB 1250 C CG . PRO A 178 ? 0.1801 0.1034 0.0764 0.0211 -0.0229 -0.0053 178 PRO A CG 1251 C CD . PRO A 178 ? 0.1622 0.1094 0.0718 0.0208 -0.0165 0.0054 178 PRO A CD 1252 N N . ILE A 179 ? 0.1993 0.0978 0.0700 0.0302 -0.0077 0.0125 179 ILE A N 1253 C CA . ILE A 179 ? 0.1740 0.0965 0.0992 0.0130 -0.0281 0.0158 179 ILE A CA 1254 C C . ILE A 179 ? 0.1957 0.0979 0.0652 0.0110 0.0016 0.0140 179 ILE A C 1255 O O . ILE A 179 ? 0.1969 0.1306 0.1040 0.0325 0.0082 0.0225 179 ILE A O 1256 C CB . ILE A 179 ? 0.2137 0.1086 0.0850 0.0179 -0.0043 0.0274 179 ILE A CB 1257 C CG1 . ILE A 179 ? 0.2103 0.1369 0.1574 0.0025 0.0059 0.0311 179 ILE A CG1 1258 C CG2 . ILE A 179 ? 0.2267 0.1619 0.0921 0.0026 -0.0183 0.0510 179 ILE A CG2 1259 C CD1 . ILE A 179 ? 0.2142 0.1610 0.1819 -0.0329 -0.0065 0.0321 179 ILE A CD1 1260 N N . ALA A 180 ? 0.2161 0.0967 0.0824 0.0240 -0.0117 0.0057 180 ALA A N 1261 C CA . ALA A 180 ? 0.2111 0.1073 0.0796 0.0242 -0.0221 0.0027 180 ALA A CA 1262 C C . ALA A 180 ? 0.2007 0.0844 0.0804 0.0045 -0.0307 -0.0036 180 ALA A C 1263 O O . ALA A 180 ? 0.2181 0.1020 0.1217 0.0315 -0.0203 0.0097 180 ALA A O 1264 C CB . ALA A 180 ? 0.2491 0.1231 0.1008 0.0251 -0.0579 -0.0004 180 ALA A CB 1265 N N . MET A 181 ? 0.1970 0.1013 0.0901 0.0234 -0.0305 0.0076 181 MET A N 1266 C CA . MET A 181 ? 0.1855 0.0878 0.1023 0.0223 -0.0229 0.0104 181 MET A CA 1267 C C . MET A 181 ? 0.1727 0.1089 0.0794 0.0301 -0.0123 0.0094 181 MET A C 1268 O O . MET A 181 ? 0.1934 0.1179 0.1017 0.0509 -0.0046 0.0021 181 MET A O 1269 C CB . MET A 181 ? 0.1744 0.0971 0.1039 0.0154 -0.0298 -0.0021 181 MET A CB 1270 C CG . MET A 181 ? 0.1802 0.1159 0.0950 -0.0059 -0.0205 -0.0029 181 MET A CG 1271 S SD . MET A 181 ? 0.2181 0.1009 0.1233 0.0208 -0.0114 0.0041 181 MET A SD 1272 C CE . MET A 181 ? 0.3115 0.1114 0.3203 -0.0083 -0.1719 -0.0255 181 MET A CE 1273 N N . ALA A 182 ? 0.1914 0.1103 0.1005 0.0353 -0.0348 0.0029 182 ALA A N 1274 C CA . ALA A 182 ? 0.1603 0.1000 0.0941 0.0193 -0.0082 0.0262 182 ALA A CA 1275 C C . ALA A 182 ? 0.1875 0.0818 0.1056 0.0183 0.0010 0.0215 182 ALA A C 1276 O O . ALA A 182 ? 0.1761 0.1027 0.1080 0.0253 -0.0082 0.0085 182 ALA A O 1277 C CB . ALA A 182 ? 0.1762 0.1016 0.1375 0.0169 0.0100 0.0072 182 ALA A CB 1278 N N . ARG A 183 ? 0.1706 0.1213 0.1049 0.0251 0.0075 0.0126 183 ARG A N 1279 C CA . ARG A 183 ? 0.1904 0.1299 0.1182 0.0372 0.0287 0.0209 183 ARG A CA 1280 C C . ARG A 183 ? 0.2053 0.1335 0.0980 0.0297 0.0327 0.0085 183 ARG A C 1281 O O . ARG A 183 ? 0.2005 0.1365 0.1315 0.0328 0.0189 -0.0077 183 ARG A O 1282 C CB . ARG A 183 ? 0.2284 0.1431 0.1284 0.0232 0.0451 0.0327 183 ARG A CB 1283 C CG . ARG A 183 ? 0.2661 0.1342 0.1271 0.0277 0.0514 0.0243 183 ARG A CG 1284 C CD . ARG A 183 ? 0.3643 0.1570 0.1341 0.0181 0.0203 0.0445 183 ARG A CD 1285 N NE . ARG A 183 ? 0.3852 0.1562 0.1639 0.0082 0.0373 0.0496 183 ARG A NE 1286 C CZ . ARG A 183 ? 0.4051 0.1589 0.1143 0.0277 0.0577 0.0411 183 ARG A CZ 1287 N NH1 . ARG A 183 ? 0.4624 0.2333 0.1668 0.0554 0.0105 0.0634 183 ARG A NH1 1288 N NH2 . ARG A 183 ? 0.4325 0.1537 0.2087 0.0130 0.0724 0.0284 183 ARG A NH2 1289 N N . THR A 184 ? 0.2018 0.1371 0.1167 0.0300 0.0076 0.0149 184 THR A N 1290 C CA . THR A 184 ? 0.1933 0.1339 0.1285 0.0370 0.0120 0.0096 184 THR A CA 1291 C C . THR A 184 ? 0.1941 0.1166 0.1091 0.0275 0.0064 -0.0074 184 THR A C 1292 O O . THR A 184 ? 0.2006 0.1214 0.1196 0.0380 0.0065 -0.0055 184 THR A O 1293 C CB . THR A 184 ? 0.2053 0.1394 0.1336 0.0325 -0.0076 -0.0140 184 THR A CB 1294 O OG1 . THR A 184 ? 0.2466 0.1778 0.1406 0.0242 -0.0182 -0.0029 184 THR A OG1 1295 C CG2 . THR A 184 ? 0.2335 0.1278 0.1608 0.0258 -0.0213 -0.0219 184 THR A CG2 1296 N N . VAL A 185 ? 0.1629 0.1272 0.1201 0.0250 0.0171 -0.0067 185 VAL A N 1297 C CA . VAL A 185 ? 0.1735 0.1362 0.1123 0.0099 0.0129 -0.0024 185 VAL A CA 1298 C C . VAL A 185 ? 0.1742 0.1051 0.0886 0.0197 0.0096 -0.0108 185 VAL A C 1299 O O . VAL A 185 ? 0.1955 0.1188 0.1192 0.0275 -0.0219 0.0001 185 VAL A O 1300 C CB . VAL A 185 ? 0.1738 0.1196 0.1197 0.0457 0.0148 0.0113 185 VAL A CB 1301 C CG1 . VAL A 185 ? 0.2115 0.1182 0.1006 0.0312 0.0089 0.0057 185 VAL A CG1 1302 C CG2 . VAL A 185 ? 0.1862 0.1198 0.1438 0.0267 0.0334 0.0315 185 VAL A CG2 1303 N N . ALA A 186 ? 0.1820 0.1240 0.1130 0.0183 0.0271 0.0036 186 ALA A N 1304 C CA . ALA A 186 ? 0.1739 0.1159 0.1379 0.0213 0.0099 0.0090 186 ALA A CA 1305 C C . ALA A 186 ? 0.1470 0.1286 0.1753 0.0156 0.0079 -0.0159 186 ALA A C 1306 O O . ALA A 186 ? 0.1554 0.1545 0.1724 0.0354 0.0255 0.0121 186 ALA A O 1307 C CB . ALA A 186 ? 0.2110 0.1183 0.1623 0.0028 0.0018 0.0125 186 ALA A CB 1308 N N . LYS A 187 ? 0.1923 0.1373 0.1488 0.0454 0.0089 0.0106 187 LYS A N 1309 C CA . LYS A 187 ? 0.2845 0.1602 0.1432 0.0273 0.0157 -0.0121 187 LYS A CA 1310 C C . LYS A 187 ? 0.2367 0.1509 0.1664 0.0503 0.0368 -0.0184 187 LYS A C 1311 O O . LYS A 187 ? 0.2160 0.1793 0.1679 0.0420 0.0182 -0.0130 187 LYS A O 1312 C CB A LYS A 187 ? 0.3336 0.2228 0.1672 0.0863 -0.0185 -0.0254 187 LYS A CB 1313 C CB B LYS A 187 ? 0.3235 0.2149 0.1730 0.0838 -0.0184 -0.0293 187 LYS A CB 1314 C CG A LYS A 187 ? 0.4137 0.2322 0.1993 0.1397 -0.0202 0.0422 187 LYS A CG 1315 C CG B LYS A 187 ? 0.2985 0.2729 0.1864 0.1490 0.0459 0.0267 187 LYS A CG 1316 C CD A LYS A 187 ? 0.3814 0.3032 0.2418 0.1490 -0.0208 0.0582 187 LYS A CD 1317 C CD B LYS A 187 ? 0.3938 0.3562 0.2393 0.1378 -0.0260 0.0451 187 LYS A CD 1318 C CE A LYS A 187 ? 0.4314 0.3414 0.2245 0.1408 -0.0430 0.0893 187 LYS A CE 1319 C CE B LYS A 187 ? 0.3687 0.4029 0.3420 0.1533 -0.0797 0.0492 187 LYS A CE 1320 N NZ A LYS A 187 ? 0.3925 0.3848 0.2120 0.1845 0.0182 0.0967 187 LYS A NZ 1321 N NZ B LYS A 187 ? 0.3765 0.3036 0.1300 0.1190 0.0179 0.0155 187 LYS A NZ 1322 N N . VAL A 188 ? 0.1940 0.1406 0.1810 0.0330 0.0000 -0.0168 188 VAL A N 1323 C CA . VAL A 188 ? 0.1940 0.1311 0.2194 0.0251 0.0015 -0.0192 188 VAL A CA 1324 C C . VAL A 188 ? 0.1835 0.1144 0.2257 0.0216 0.0062 0.0030 188 VAL A C 1325 O O . VAL A 188 ? 0.1953 0.1305 0.2765 0.0414 0.0141 -0.0024 188 VAL A O 1326 C CB . VAL A 188 ? 0.1944 0.1194 0.1682 0.0161 -0.0039 -0.0437 188 VAL A CB 1327 C CG1 . VAL A 188 ? 0.2613 0.1389 0.2211 0.0215 0.0066 -0.0038 188 VAL A CG1 1328 C CG2 . VAL A 188 ? 0.2340 0.1611 0.2063 0.0056 -0.0409 -0.0379 188 VAL A CG2 1329 N N . LEU A 189 ? 0.1778 0.1140 0.2051 0.0241 0.0058 0.0072 189 LEU A N 1330 C CA . LEU A 189 ? 0.1859 0.1182 0.2020 0.0131 0.0081 0.0418 189 LEU A CA 1331 C C . LEU A 189 ? 0.1783 0.1023 0.2376 0.0228 -0.0005 0.0319 189 LEU A C 1332 O O . LEU A 189 ? 0.1997 0.1214 0.3338 0.0299 -0.0225 0.0700 189 LEU A O 1333 C CB . LEU A 189 ? 0.1889 0.1218 0.1917 0.0206 -0.0144 0.0416 189 LEU A CB 1334 C CG . LEU A 189 ? 0.1853 0.1388 0.1838 0.0179 -0.0090 0.0081 189 LEU A CG 1335 C CD1 . LEU A 189 ? 0.2568 0.2198 0.1256 0.0225 -0.0194 0.0026 189 LEU A CD1 1336 C CD2 . LEU A 189 ? 0.2544 0.1602 0.3581 -0.0020 0.0760 0.0678 189 LEU A CD2 1337 N N . TYR A 190 ? 0.1611 0.1482 0.2118 0.0154 -0.0022 0.0479 190 TYR A N 1338 C CA . TYR A 190 ? 0.1480 0.1559 0.2366 0.0326 0.0191 0.0300 190 TYR A CA 1339 C C . TYR A 190 ? 0.1851 0.1480 0.2586 0.0039 0.0469 0.0110 190 TYR A C 1340 O O . TYR A 190 ? 0.1948 0.2353 0.2748 -0.0069 0.0618 0.0133 190 TYR A O 1341 C CB . TYR A 190 ? 0.1660 0.1692 0.2043 0.0079 -0.0167 0.0148 190 TYR A CB 1342 C CG . TYR A 190 ? 0.1822 0.1698 0.2002 -0.0122 0.0180 0.0300 190 TYR A CG 1343 C CD1 . TYR A 190 ? 0.1734 0.2239 0.1923 -0.0017 -0.0110 -0.0113 190 TYR A CD1 1344 C CD2 . TYR A 190 ? 0.2752 0.1870 0.2052 0.0321 -0.0164 0.0145 190 TYR A CD2 1345 C CE1 . TYR A 190 ? 0.1967 0.2322 0.1943 0.0229 0.0007 0.0036 190 TYR A CE1 1346 C CE2 . TYR A 190 ? 0.2675 0.2569 0.2021 0.0540 0.0089 0.0578 190 TYR A CE2 1347 C CZ . TYR A 190 ? 0.1841 0.2714 0.2033 0.0018 0.0211 0.0647 190 TYR A CZ 1348 O OH . TYR A 190 ? 0.2139 0.3313 0.2045 0.0346 -0.0022 0.0343 190 TYR A OH 1349 N N . GLY A 191 ? 0.2191 0.1892 0.2177 -0.0384 0.0588 0.0264 191 GLY A N 1350 C CA . GLY A 191 ? 0.2153 0.1652 0.2399 -0.0106 0.0921 0.0522 191 GLY A CA 1351 C C . GLY A 191 ? 0.2747 0.1811 0.2529 -0.0106 0.1238 0.0354 191 GLY A C 1352 O O . GLY A 191 ? 0.4656 0.2680 0.2557 0.0285 0.1702 0.0319 191 GLY A O 1353 N N . GLY A 192 ? 0.2692 0.1715 0.2826 0.0129 0.1013 0.0286 192 GLY A N 1354 C CA . GLY A 192 ? 0.2516 0.2111 0.3127 0.0515 0.0980 0.0142 192 GLY A CA 1355 C C . GLY A 192 ? 0.3054 0.1769 0.2082 0.0166 0.1229 0.0265 192 GLY A C 1356 O O . GLY A 192 ? 0.4380 0.2150 0.2221 0.0409 0.1402 0.0017 192 GLY A O 1357 N N . ALA A 193 ? 0.2890 0.2054 0.1510 -0.0228 0.1075 0.0308 193 ALA A N 1358 C CA . ALA A 193 ? 0.3102 0.1721 0.1355 0.0494 0.0396 0.0198 193 ALA A CA 1359 C C . ALA A 193 ? 0.2887 0.1544 0.1388 0.0455 0.0070 -0.0098 193 ALA A C 1360 O O . ALA A 193 ? 0.3118 0.1932 0.1661 0.0452 0.0142 -0.0515 193 ALA A O 1361 C CB . ALA A 193 ? 0.2936 0.1628 0.1669 0.0483 0.0239 0.0359 193 ALA A CB 1362 N N . LEU A 194 ? 0.2588 0.1335 0.1374 0.0234 0.0284 0.0072 194 LEU A N 1363 C CA . LEU A 194 ? 0.2122 0.1282 0.1393 0.0105 0.0169 -0.0027 194 LEU A CA 1364 C C . LEU A 194 ? 0.2078 0.1383 0.1519 0.0220 0.0253 -0.0148 194 LEU A C 1365 O O . LEU A 194 ? 0.2118 0.1526 0.1671 0.0010 0.0403 0.0184 194 LEU A O 1366 C CB . LEU A 194 ? 0.1865 0.1442 0.1482 -0.0054 0.0100 0.0135 194 LEU A CB 1367 C CG . LEU A 194 ? 0.1976 0.1244 0.1704 0.0067 0.0169 0.0020 194 LEU A CG 1368 C CD1 . LEU A 194 ? 0.1674 0.1491 0.1703 0.0044 0.0110 0.0245 194 LEU A CD1 1369 C CD2 . LEU A 194 ? 0.1830 0.2018 0.1925 -0.0076 -0.0012 -0.0156 194 LEU A CD2 1370 N N . THR A 195 ? 0.1899 0.1494 0.1776 0.0275 0.0534 -0.0085 195 THR A N 1371 C CA . THR A 195 ? 0.2102 0.1501 0.1459 0.0381 0.0558 0.0122 195 THR A CA 1372 C C . THR A 195 ? 0.1558 0.1745 0.1621 -0.0184 0.0763 -0.0079 195 THR A C 1373 O O . THR A 195 ? 0.1671 0.1454 0.1429 0.0161 0.0462 -0.0035 195 THR A O 1374 C CB . THR A 195 ? 0.2063 0.1463 0.1672 0.0349 0.0597 0.0043 195 THR A CB 1375 O OG1 . THR A 195 ? 0.2113 0.1552 0.1895 0.0113 0.0526 0.0107 195 THR A OG1 1376 C CG2 . THR A 195 ? 0.2483 0.1992 0.1952 0.0076 0.0547 -0.0348 195 THR A CG2 1377 N N . SER A 196 ? 0.1708 0.1980 0.1981 0.0198 0.0519 -0.0074 196 SER A N 1378 C CA . SER A 196 ? 0.1757 0.2177 0.2067 -0.0210 0.0422 -0.0093 196 SER A CA 1379 C C . SER A 196 ? 0.1682 0.1702 0.1906 0.0330 0.0435 0.0023 196 SER A C 1380 O O . SER A 196 ? 0.1891 0.1765 0.1603 0.0288 0.0143 -0.0045 196 SER A O 1381 C CB A SER A 196 ? 0.1720 0.3435 0.2314 -0.0167 0.0464 -0.0365 196 SER A CB 1382 C CB B SER A 196 ? 0.1743 0.3307 0.2250 -0.0163 0.0478 -0.0231 196 SER A CB 1383 C CB C SER A 196 ? 0.1732 0.3369 0.2085 -0.0080 0.0538 -0.0451 196 SER A CB 1384 O OG A SER A 196 ? 0.1953 0.4078 0.2641 0.0369 0.0071 0.0875 196 SER A OG 1385 O OG B SER A 196 ? 0.2049 0.4404 0.1570 -0.0967 0.0443 -0.0517 196 SER A OG 1386 O OG C SER A 196 ? 0.1822 0.3992 0.1965 -0.0472 0.0434 -0.0097 196 SER A OG 1387 N N . THR A 197 ? 0.1426 0.1771 0.2244 0.0283 0.0438 -0.0120 197 THR A N 1388 C CA . THR A 197 ? 0.1565 0.1705 0.2145 0.0051 0.0227 -0.0088 197 THR A CA 1389 C C . THR A 197 ? 0.1694 0.1604 0.1651 0.0516 0.0462 0.0581 197 THR A C 1390 O O . THR A 197 ? 0.2015 0.1513 0.1685 0.0504 0.0393 0.0416 197 THR A O 1391 C CB A THR A 197 ? 0.2193 0.1719 0.2564 0.0743 0.0379 0.0166 197 THR A CB 1392 C CB B THR A 197 ? 0.2197 0.1719 0.2774 0.0749 0.0429 0.0217 197 THR A CB 1393 O OG1 A THR A 197 ? 0.1997 0.2256 0.4354 0.0384 0.0559 -0.0052 197 THR A OG1 1394 O OG1 B THR A 197 ? 0.1743 0.1959 0.3937 0.0564 0.0056 -0.1099 197 THR A OG1 1395 C CG2 A THR A 197 ? 0.2094 0.1668 0.3288 0.0722 0.0422 0.0522 197 THR A CG2 1396 C CG2 B THR A 197 ? 0.2063 0.2147 0.3359 0.0553 -0.0018 0.0147 197 THR A CG2 1397 N N . SER A 198 ? 0.1675 0.1259 0.1606 0.0282 0.0451 0.0270 198 SER A N 1398 C CA . SER A 198 ? 0.1683 0.1095 0.1335 0.0102 0.0290 -0.0076 198 SER A CA 1399 C C . SER A 198 ? 0.1286 0.1104 0.1232 0.0169 0.0000 0.0068 198 SER A C 1400 O O . SER A 198 ? 0.1483 0.1296 0.1043 0.0197 0.0180 0.0016 198 SER A O 1401 C CB . SER A 198 ? 0.1912 0.1158 0.1195 0.0167 0.0384 -0.0097 198 SER A CB 1402 O OG . SER A 198 ? 0.2096 0.1194 0.1683 -0.0117 0.0159 -0.0234 198 SER A OG 1403 N N . THR A 199 ? 0.1796 0.1099 0.1311 0.0030 0.0316 0.0128 199 THR A N 1404 C CA . THR A 199 ? 0.1609 0.1190 0.1155 0.0051 0.0142 -0.0036 199 THR A CA 1405 C C . THR A 199 ? 0.2344 0.1230 0.1167 0.0496 0.0350 0.0235 199 THR A C 1406 O O . THR A 199 ? 0.1827 0.1218 0.1079 0.0119 0.0138 0.0030 199 THR A O 1407 C CB . THR A 199 ? 0.1666 0.1155 0.1109 -0.0008 -0.0060 0.0151 199 THR A CB 1408 O OG1 . THR A 199 ? 0.1724 0.1405 0.1135 0.0100 0.0084 0.0080 199 THR A OG1 1409 C CG2 . THR A 199 ? 0.1911 0.1180 0.1387 0.0021 0.0191 0.0107 199 THR A CG2 1410 N N . HIS A 200 ? 0.1950 0.1420 0.1238 0.0271 0.0181 0.0099 200 HIS A N 1411 C CA . HIS A 200 ? 0.1616 0.1711 0.1337 0.0108 0.0104 0.0209 200 HIS A CA 1412 C C . HIS A 200 ? 0.1718 0.1053 0.1542 0.0308 0.0250 0.0139 200 HIS A C 1413 O O . HIS A 200 ? 0.1480 0.1632 0.1198 0.0263 -0.0015 0.0039 200 HIS A O 1414 C CB . HIS A 200 ? 0.1735 0.1828 0.1729 0.0277 0.0150 0.0484 200 HIS A CB 1415 C CG . HIS A 200 ? 0.1629 0.3768 0.1834 -0.0463 -0.0210 0.0944 200 HIS A CG 1416 N ND1 . HIS A 200 ? 0.3683 0.5105 0.2177 -0.1377 -0.1090 0.0265 200 HIS A ND1 1417 C CD2 . HIS A 200 ? 0.2333 0.5043 0.2279 0.0037 0.0197 0.1733 200 HIS A CD2 1418 C CE1 . HIS A 200 ? 0.3201 0.7262 0.1907 -0.0306 -0.0268 0.0007 200 HIS A CE1 1419 N NE2 . HIS A 200 ? 0.2152 0.7032 0.1847 0.1426 0.0261 0.1295 200 HIS A NE2 1420 N N . THR A 201 ? 0.1590 0.1213 0.1150 0.0345 0.0048 0.0166 201 THR A N 1421 C CA . THR A 201 ? 0.1575 0.1336 0.1243 0.0243 0.0053 0.0207 201 THR A CA 1422 C C . THR A 201 ? 0.1491 0.1134 0.1009 0.0130 -0.0071 0.0054 201 THR A C 1423 O O . THR A 201 ? 0.1639 0.1293 0.1082 0.0146 0.0022 0.0112 201 THR A O 1424 C CB . THR A 201 ? 0.1670 0.1317 0.1537 0.0274 0.0267 0.0038 201 THR A CB 1425 O OG1 . THR A 201 ? 0.1781 0.1257 0.2923 0.0304 0.0279 0.0374 201 THR A OG1 1426 C CG2 . THR A 201 ? 0.1599 0.1618 0.1966 0.0090 -0.0083 0.0214 201 THR A CG2 1427 N N . ILE A 202 ? 0.1440 0.1319 0.0936 0.0158 0.0013 0.0028 202 ILE A N 1428 C CA . ILE A 202 ? 0.1771 0.1274 0.0722 0.0270 0.0030 0.0014 202 ILE A CA 1429 C C . ILE A 202 ? 0.1468 0.1211 0.0886 0.0132 0.0051 0.0124 202 ILE A C 1430 O O . ILE A 202 ? 0.1283 0.1133 0.0911 0.0118 -0.0114 -0.0010 202 ILE A O 1431 C CB . ILE A 202 ? 0.2068 0.1375 0.0751 0.0444 0.0106 0.0105 202 ILE A CB 1432 C CG1 . ILE A 202 ? 0.1855 0.2044 0.1318 0.0215 -0.0194 0.0101 202 ILE A CG1 1433 C CG2 . ILE A 202 ? 0.1763 0.2085 0.1271 0.0456 0.0071 0.0607 202 ILE A CG2 1434 C CD1 . ILE A 202 ? 0.2148 0.2142 0.1278 -0.0079 -0.0247 0.0102 202 ILE A CD1 1435 N N . GLU A 203 ? 0.1388 0.1098 0.1016 0.0210 0.0148 0.0178 203 GLU A N 1436 C CA . GLU A 203 ? 0.1494 0.1149 0.1242 0.0180 -0.0140 0.0169 203 GLU A CA 1437 C C . GLU A 203 ? 0.1387 0.0805 0.1139 0.0065 -0.0156 -0.0122 203 GLU A C 1438 O O . GLU A 203 ? 0.1395 0.0885 0.1343 0.0156 -0.0076 -0.0021 203 GLU A O 1439 C CB . GLU A 203 ? 0.1666 0.1194 0.1944 -0.0165 0.0113 0.0181 203 GLU A CB 1440 C CG A GLU A 203 ? 0.1887 0.1644 0.2364 -0.0683 0.0693 -0.0294 203 GLU A CG 1441 C CG B GLU A 203 ? 0.1979 0.1358 0.2654 0.0300 0.0344 0.0758 203 GLU A CG 1442 C CD A GLU A 203 ? 0.1888 0.0556 0.2825 -0.0580 0.0257 0.0696 203 GLU A CD 1443 C CD B GLU A 203 ? 0.2434 0.2614 0.2284 -0.0446 0.0139 0.1322 203 GLU A CD 1444 O OE1 A GLU A 203 ? 0.1867 0.0000 0.3453 -0.0860 -0.0038 0.1277 203 GLU A OE1 1445 O OE1 B GLU A 203 ? 0.2389 0.3185 0.3835 -0.0520 -0.0445 0.2412 203 GLU A OE1 1446 O OE2 A GLU A 203 ? 0.1919 0.0000 0.3514 -0.0163 -0.0163 0.3344 203 GLU A OE2 1447 O OE2 B GLU A 203 ? 0.3607 0.2104 0.2607 -0.1160 -0.0549 0.1359 203 GLU A OE2 1448 N N . ARG A 204 ? 0.1463 0.0879 0.0996 0.0119 -0.0053 -0.0030 204 ARG A N 1449 C CA . ARG A 204 ? 0.1309 0.0937 0.0995 -0.0048 -0.0166 -0.0053 204 ARG A CA 1450 C C . ARG A 204 ? 0.1365 0.0755 0.0918 -0.0075 -0.0174 -0.0049 204 ARG A C 1451 O O . ARG A 204 ? 0.1284 0.0879 0.0870 0.0006 -0.0207 0.0022 204 ARG A O 1452 C CB . ARG A 204 ? 0.1441 0.1165 0.0825 0.0163 -0.0187 -0.0052 204 ARG A CB 1453 C CG . ARG A 204 ? 0.1441 0.1305 0.1094 0.0280 -0.0064 -0.0058 204 ARG A CG 1454 C CD . ARG A 204 ? 0.1433 0.1288 0.1114 -0.0029 -0.0174 0.0161 204 ARG A CD 1455 N NE . ARG A 204 ? 0.1270 0.1073 0.1101 0.0089 -0.0062 -0.0006 204 ARG A NE 1456 C CZ . ARG A 204 ? 0.1290 0.1064 0.1123 0.0096 -0.0142 0.0011 204 ARG A CZ 1457 N NH1 . ARG A 204 ? 0.1489 0.1087 0.1158 -0.0004 -0.0337 0.0152 204 ARG A NH1 1458 N NH2 . ARG A 204 ? 0.1403 0.1186 0.1176 0.0156 -0.0389 0.0250 204 ARG A NH2 1459 N N . TRP A 205 ? 0.1246 0.0880 0.1045 -0.0032 -0.0179 -0.0139 205 TRP A N 1460 C CA . TRP A 205 ? 0.1234 0.0818 0.0896 -0.0101 -0.0099 -0.0117 205 TRP A CA 1461 C C . TRP A 205 ? 0.1126 0.0832 0.0982 -0.0066 -0.0169 0.0039 205 TRP A C 1462 O O . TRP A 205 ? 0.1321 0.0815 0.1220 -0.0137 0.0038 -0.0104 205 TRP A O 1463 C CB . TRP A 205 ? 0.1351 0.0960 0.1011 0.0041 -0.0258 -0.0157 205 TRP A CB 1464 C CG . TRP A 205 ? 0.1535 0.0846 0.1304 -0.0086 -0.0198 -0.0232 205 TRP A CG 1465 C CD1 . TRP A 205 ? 0.2051 0.0879 0.1612 -0.0068 -0.0527 -0.0157 205 TRP A CD1 1466 C CD2 . TRP A 205 ? 0.1332 0.0835 0.1199 -0.0236 0.0042 -0.0120 205 TRP A CD2 1467 N NE1 . TRP A 205 ? 0.1809 0.0891 0.1505 -0.0038 -0.0288 -0.0269 205 TRP A NE1 1468 C CE2 . TRP A 205 ? 0.1367 0.0901 0.1431 -0.0131 -0.0015 -0.0211 205 TRP A CE2 1469 C CE3 . TRP A 205 ? 0.1340 0.1198 0.1017 -0.0164 0.0063 -0.0148 205 TRP A CE3 1470 C CZ2 . TRP A 205 ? 0.1681 0.0938 0.1430 -0.0267 0.0060 -0.0339 205 TRP A CZ2 1471 C CZ3 . TRP A 205 ? 0.1732 0.1407 0.1095 -0.0272 0.0041 -0.0233 205 TRP A CZ3 1472 C CH2 . TRP A 205 ? 0.1553 0.1406 0.1436 -0.0214 0.0029 -0.0504 205 TRP A CH2 1473 N N . LEU A 206 ? 0.1274 0.0854 0.0862 -0.0112 -0.0206 -0.0104 206 LEU A N 1474 C CA . LEU A 206 ? 0.1401 0.0877 0.0751 0.0031 -0.0240 0.0055 206 LEU A CA 1475 C C . LEU A 206 ? 0.1421 0.0867 0.0744 0.0036 -0.0091 0.0020 206 LEU A C 1476 O O . LEU A 206 ? 0.1328 0.0889 0.0730 0.0038 -0.0158 0.0023 206 LEU A O 1477 C CB . LEU A 206 ? 0.1220 0.1114 0.0734 0.0021 0.0015 0.0034 206 LEU A CB 1478 C CG . LEU A 206 ? 0.1738 0.1313 0.0741 0.0240 -0.0128 0.0091 206 LEU A CG 1479 C CD1 . LEU A 206 ? 0.2039 0.3132 0.0973 0.0488 0.0290 0.0765 206 LEU A CD1 1480 C CD2 . LEU A 206 ? 0.1742 0.1327 0.0958 0.0314 -0.0315 0.0041 206 LEU A CD2 1481 N N . ILE A 207 ? 0.1313 0.0833 0.0800 -0.0037 -0.0157 0.0016 207 ILE A N 1482 C CA . ILE A 207 ? 0.1336 0.0615 0.0856 0.0102 -0.0240 0.0094 207 ILE A CA 1483 C C . ILE A 207 ? 0.1389 0.0819 0.0718 0.0024 -0.0216 -0.0051 207 ILE A C 1484 O O . ILE A 207 ? 0.1501 0.0934 0.0789 0.0065 -0.0268 -0.0025 207 ILE A O 1485 C CB . ILE A 207 ? 0.1325 0.0863 0.0910 0.0075 -0.0220 -0.0051 207 ILE A CB 1486 C CG1 . ILE A 207 ? 0.1383 0.0760 0.1087 -0.0017 -0.0015 -0.0088 207 ILE A CG1 1487 C CG2 . ILE A 207 ? 0.1650 0.0907 0.0960 -0.0187 -0.0500 0.0025 207 ILE A CG2 1488 C CD1 . ILE A 207 ? 0.1370 0.1038 0.1564 -0.0030 -0.0207 -0.0087 207 ILE A CD1 1489 N N . GLY A 208 ? 0.1365 0.0690 0.0817 0.0026 -0.0192 0.0094 208 GLY A N 1490 C CA . GLY A 208 ? 0.1341 0.0843 0.0940 0.0197 0.0054 -0.0003 208 GLY A CA 1491 C C . GLY A 208 ? 0.1315 0.0857 0.1038 0.0121 0.0083 0.0021 208 GLY A C 1492 O O . GLY A 208 ? 0.1469 0.1019 0.1018 0.0040 0.0016 0.0164 208 GLY A O 1493 N N . ASN A 209 ? 0.1273 0.1010 0.0886 0.0105 -0.0133 -0.0026 209 ASN A N 1494 C CA . ASN A 209 ? 0.1188 0.0945 0.1171 0.0073 0.0084 -0.0048 209 ASN A CA 1495 C C . ASN A 209 ? 0.1286 0.0832 0.0714 0.0054 -0.0190 0.0037 209 ASN A C 1496 O O . ASN A 209 ? 0.1172 0.1163 0.0943 0.0016 -0.0195 -0.0129 209 ASN A O 1497 C CB . ASN A 209 ? 0.1579 0.1875 0.1192 0.0072 -0.0175 0.0740 209 ASN A CB 1498 C CG . ASN A 209 ? 0.1596 0.1092 0.2371 0.0048 -0.0161 0.0801 209 ASN A CG 1499 O OD1 . ASN A 209 ? 0.1855 0.1250 0.1833 0.0094 -0.0548 0.0131 209 ASN A OD1 1500 N ND2 . ASN A 209 ? 0.2255 0.1145 0.1428 0.0159 -0.0142 0.0181 209 ASN A ND2 1501 N N . GLN A 210 ? 0.1277 0.0873 0.0863 -0.0007 -0.0034 0.0075 210 GLN A N 1502 C CA . GLN A 210 ? 0.1489 0.1006 0.0720 0.0024 -0.0127 0.0186 210 GLN A CA 1503 C C . GLN A 210 ? 0.1400 0.1028 0.0791 0.0091 -0.0072 0.0112 210 GLN A C 1504 O O . GLN A 210 ? 0.1893 0.1403 0.1015 0.0273 0.0142 0.0192 210 GLN A O 1505 C CB . GLN A 210 ? 0.1205 0.1051 0.1050 0.0018 0.0039 0.0173 210 GLN A CB 1506 C CG . GLN A 210 ? 0.1609 0.0989 0.1113 0.0061 -0.0166 0.0221 210 GLN A CG 1507 C CD . GLN A 210 ? 0.2153 0.1075 0.1316 0.0041 0.0171 0.0351 210 GLN A CD 1508 O OE1 . GLN A 210 ? 0.2234 0.1388 0.1482 -0.0158 0.0193 0.0318 210 GLN A OE1 1509 N NE2 . GLN A 210 ? 0.4419 0.0957 0.4157 0.0137 0.2091 -0.0111 210 GLN A NE2 1510 N N . THR A 211 ? 0.1449 0.0959 0.0953 0.0144 -0.0138 0.0111 211 THR A N 1511 C CA . THR A 211 ? 0.1444 0.1020 0.1070 0.0133 -0.0193 0.0000 211 THR A CA 1512 C C . THR A 211 ? 0.1577 0.0989 0.0872 0.0110 -0.0288 -0.0056 211 THR A C 1513 O O . THR A 211 ? 0.1968 0.0998 0.1451 0.0384 -0.0223 -0.0001 211 THR A O 1514 C CB . THR A 211 ? 0.1205 0.1151 0.1400 -0.0082 -0.0337 -0.0185 211 THR A CB 1515 O OG1 . THR A 211 ? 0.1975 0.1238 0.1111 0.0248 -0.0304 0.0045 211 THR A OG1 1516 C CG2 . THR A 211 ? 0.1576 0.1116 0.2059 -0.0021 -0.0570 -0.0096 211 THR A CG2 1517 N N . GLY A 212 ? 0.1701 0.0955 0.0919 -0.0008 -0.0234 0.0030 212 GLY A N 1518 C CA . GLY A 212 ? 0.1796 0.0947 0.1005 -0.0048 -0.0141 0.0028 212 GLY A CA 1519 C C . GLY A 212 ? 0.1531 0.0972 0.0878 0.0089 -0.0301 0.0168 212 GLY A C 1520 O O . GLY A 212 ? 0.2216 0.1053 0.0916 -0.0080 -0.0268 0.0075 212 GLY A O 1521 N N . ASP A 213 ? 0.1858 0.0963 0.0936 -0.0035 -0.0173 0.0092 213 ASP A N 1522 C CA . ASP A 213 ? 0.2267 0.1121 0.0789 0.0243 -0.0147 0.0017 213 ASP A CA 1523 C C . ASP A 213 ? 0.2363 0.1011 0.1073 0.0191 -0.0357 -0.0030 213 ASP A C 1524 O O . ASP A 213 ? 0.2483 0.1159 0.1304 0.0288 -0.0571 -0.0169 213 ASP A O 1525 C CB . ASP A 213 ? 0.3035 0.1108 0.0932 0.0305 -0.0263 0.0154 213 ASP A CB 1526 C CG . ASP A 213 ? 0.4178 0.1460 0.0913 0.0949 -0.0092 0.0192 213 ASP A CG 1527 O OD1 . ASP A 213 ? 0.5704 0.1698 0.1586 0.1208 0.0334 0.0723 213 ASP A OD1 1528 O OD2 . ASP A 213 ? 0.2936 0.1316 0.1381 0.0572 -0.0586 0.0000 213 ASP A OD2 1529 N N . ALA A 214 ? 0.2296 0.1064 0.1065 0.0184 -0.0303 -0.0089 214 ALA A N 1530 C CA . ALA A 214 ? 0.2198 0.1235 0.1140 0.0298 0.0182 0.0071 214 ALA A CA 1531 C C . ALA A 214 ? 0.1618 0.1206 0.1024 0.0323 -0.0096 0.0060 214 ALA A C 1532 O O . ALA A 214 ? 0.2889 0.1216 0.1213 0.0636 -0.0156 -0.0110 214 ALA A O 1533 C CB . ALA A 214 ? 0.2251 0.1467 0.1311 0.0056 0.0162 0.0178 214 ALA A CB 1534 N N . THR A 215 ? 0.2388 0.1149 0.1021 0.0338 -0.0023 -0.0018 215 THR A N 1535 C CA . THR A 215 ? 0.2597 0.1294 0.0917 0.0353 -0.0030 -0.0016 215 THR A CA 1536 C C . THR A 215 ? 0.2543 0.0992 0.0972 0.0530 0.0042 0.0024 215 THR A C 1537 O O . THR A 215 ? 0.2388 0.1175 0.1006 0.0436 0.0049 -0.0086 215 THR A O 1538 C CB . THR A 215 ? 0.2605 0.1762 0.1469 0.0876 -0.0858 -0.0145 215 THR A CB 1539 O OG1 . THR A 215 ? 0.2949 0.1343 0.1302 0.0487 -0.0604 -0.0182 215 THR A OG1 1540 C CG2 . THR A 215 ? 0.2696 0.2496 0.2443 0.0553 -0.0721 -0.0654 215 THR A CG2 1541 N N . LEU A 216 ? 0.2861 0.1056 0.0854 0.0273 0.0001 -0.0016 216 LEU A N 1542 C CA . LEU A 216 ? 0.3400 0.1013 0.1185 -0.0033 0.0415 0.0045 216 LEU A CA 1543 C C . LEU A 216 ? 0.2656 0.1054 0.1534 -0.0151 0.0524 -0.0459 216 LEU A C 1544 O O . LEU A 216 ? 0.3106 0.1312 0.1640 -0.0515 0.0727 -0.0581 216 LEU A O 1545 C CB . LEU A 216 ? 0.3925 0.1238 0.1457 0.0295 0.0881 -0.0129 216 LEU A CB 1546 C CG . LEU A 216 ? 0.4993 0.1297 0.1236 0.0447 0.0779 -0.0227 216 LEU A CG 1547 C CD1 . LEU A 216 ? 0.3357 0.1620 0.1169 -0.0111 0.0383 -0.0155 216 LEU A CD1 1548 C CD2 . LEU A 216 ? 0.3533 0.1315 0.0911 -0.0365 -0.0138 -0.0102 216 LEU A CD2 1549 N N . ARG A 217 ? 0.2053 0.1149 0.1624 -0.0008 0.0264 -0.0413 217 ARG A N 1550 C CA . ARG A 217 ? 0.1721 0.1319 0.2629 -0.0205 0.0002 -0.0801 217 ARG A CA 1551 C C . ARG A 217 ? 0.1750 0.0919 0.2148 0.0247 -0.0400 -0.0244 217 ARG A C 1552 O O . ARG A 217 ? 0.1793 0.1634 0.3058 0.0124 -0.0704 -0.0744 217 ARG A O 1553 C CB . ARG A 217 ? 0.1821 0.1496 0.2337 0.0111 0.0012 -0.0553 217 ARG A CB 1554 C CG . ARG A 217 ? 0.2238 0.1312 0.1588 0.0343 -0.0011 -0.0309 217 ARG A CG 1555 C CD . ARG A 217 ? 0.2029 0.1351 0.2321 0.0271 -0.0047 -0.0465 217 ARG A CD 1556 N NE . ARG A 217 ? 0.3138 0.1808 0.2877 0.1141 -0.0890 -0.0740 217 ARG A NE 1557 C CZ . ARG A 217 ? 0.1765 0.1178 0.3090 0.0056 -0.0165 -0.0698 217 ARG A CZ 1558 N NH1 . ARG A 217 ? 0.1856 0.1262 0.2182 0.0114 0.0164 -0.0145 217 ARG A NH1 1559 N NH2 . ARG A 217 ? 0.2241 0.1136 0.3455 0.0221 -0.0652 -0.0709 217 ARG A NH2 1560 N N . ALA A 218 ? 0.1740 0.0879 0.1630 -0.0035 -0.0404 -0.0211 218 ALA A N 1561 C CA . ALA A 218 ? 0.1860 0.1208 0.1334 -0.0047 -0.0396 0.0004 218 ALA A CA 1562 C C . ALA A 218 ? 0.2192 0.1097 0.1132 0.0139 -0.0416 -0.0130 218 ALA A C 1563 O O . ALA A 218 ? 0.3613 0.1370 0.1079 -0.0129 -0.0573 -0.0191 218 ALA A O 1564 C CB . ALA A 218 ? 0.2031 0.1667 0.1056 -0.0066 -0.0357 -0.0058 218 ALA A CB 1565 N N . GLY A 219 ? 0.2061 0.1117 0.1007 0.0132 -0.0620 -0.0081 219 GLY A N 1566 C CA . GLY A 219 ? 0.1968 0.1039 0.0921 0.0283 -0.0292 -0.0280 219 GLY A CA 1567 C C . GLY A 219 ? 0.1931 0.1262 0.0954 0.0264 -0.0292 -0.0242 219 GLY A C 1568 O O . GLY A 219 ? 0.1834 0.1233 0.1570 0.0309 -0.0487 -0.0219 219 GLY A O 1569 N N . PHE A 220 ? 0.1779 0.1181 0.1142 0.0148 -0.0299 -0.0160 220 PHE A N 1570 C CA . PHE A 220 ? 0.1768 0.1041 0.1131 0.0141 -0.0368 -0.0009 220 PHE A CA 1571 C C . PHE A 220 ? 0.1775 0.1128 0.1107 0.0317 -0.0269 0.0162 220 PHE A C 1572 O O . PHE A 220 ? 0.1875 0.1730 0.1310 0.0189 -0.0322 0.0429 220 PHE A O 1573 C CB . PHE A 220 ? 0.1789 0.0943 0.1412 0.0228 -0.0353 -0.0101 220 PHE A CB 1574 C CG . PHE A 220 ? 0.2054 0.1166 0.1174 0.0320 -0.0110 -0.0218 220 PHE A CG 1575 C CD1 . PHE A 220 ? 0.3209 0.1297 0.1308 -0.0032 -0.0095 -0.0297 220 PHE A CD1 1576 C CD2 . PHE A 220 ? 0.3724 0.1163 0.1284 0.0004 -0.0723 -0.0079 220 PHE A CD2 1577 C CE1 . PHE A 220 ? 0.3386 0.1251 0.1305 0.0064 -0.0274 -0.0408 220 PHE A CE1 1578 C CE2 . PHE A 220 ? 0.2676 0.1296 0.1157 0.0181 -0.0496 -0.0225 220 PHE A CE2 1579 C CZ . PHE A 220 ? 0.2081 0.1319 0.1407 0.0036 -0.0051 -0.0350 220 PHE A CZ 1580 N N . PRO A 221 ? 0.1864 0.1312 0.0816 0.0202 -0.0324 0.0054 221 PRO A N 1581 C CA . PRO A 221 ? 0.1833 0.1160 0.0811 0.0373 -0.0304 -0.0035 221 PRO A CA 1582 C C . PRO A 221 ? 0.1966 0.1168 0.0886 0.0251 -0.0313 -0.0065 221 PRO A C 1583 O O . PRO A 221 ? 0.2019 0.1290 0.0898 0.0504 -0.0255 -0.0002 221 PRO A O 1584 C CB . PRO A 221 ? 0.1772 0.1331 0.1288 0.0297 -0.0352 0.0094 221 PRO A CB 1585 C CG . PRO A 221 ? 0.1981 0.1157 0.1179 0.0163 -0.0351 0.0003 221 PRO A CG 1586 C CD . PRO A 221 ? 0.1960 0.1109 0.0888 0.0200 -0.0216 0.0023 221 PRO A CD 1587 N N . LYS A 222 ? 0.2268 0.1243 0.0918 0.0306 -0.0662 -0.0032 222 LYS A N 1588 C CA . LYS A 222 ? 0.1762 0.1328 0.0905 0.0194 -0.0224 -0.0025 222 LYS A CA 1589 C C . LYS A 222 ? 0.1763 0.1290 0.0996 0.0212 -0.0058 0.0220 222 LYS A C 1590 O O . LYS A 222 ? 0.2122 0.1272 0.2511 0.0132 0.0634 -0.0023 222 LYS A O 1591 C CB . LYS A 222 ? 0.2969 0.1666 0.1177 0.0862 0.0368 0.0178 222 LYS A CB 1592 C CG A LYS A 222 ? 0.2976 0.2549 0.2328 0.0760 0.0952 -0.0131 222 LYS A CG 1593 C CG B LYS A 222 ? 0.3120 0.1746 0.1578 0.0953 0.0844 0.0633 222 LYS A CG 1594 C CD A LYS A 222 ? 0.2799 0.2539 0.3112 0.0706 0.0531 0.0393 222 LYS A CD 1595 C CD B LYS A 222 ? 0.2877 0.2116 0.2314 0.0991 0.0172 0.1067 222 LYS A CD 1596 C CE A LYS A 222 ? 0.3849 0.3026 0.2992 -0.0160 0.0380 0.1185 222 LYS A CE 1597 C CE B LYS A 222 ? 0.2934 0.3825 0.3916 0.1332 0.0255 0.1452 222 LYS A CE 1598 N NZ A LYS A 222 ? 0.2051 0.2344 0.3473 -0.0518 -0.1141 0.0429 222 LYS A NZ 1599 N NZ B LYS A 222 ? 0.2411 0.4821 0.2888 0.0616 0.0903 0.1933 222 LYS A NZ 1600 N N . ASP A 223 ? 0.1689 0.1094 0.1221 0.0253 -0.0219 0.0052 223 ASP A N 1601 C CA . ASP A 223 ? 0.1459 0.1469 0.1354 0.0110 -0.0298 0.0063 223 ASP A CA 1602 C C . ASP A 223 ? 0.1412 0.1226 0.1344 0.0105 -0.0105 0.0179 223 ASP A C 1603 O O . ASP A 223 ? 0.1398 0.1739 0.1644 0.0188 -0.0125 -0.0015 223 ASP A O 1604 C CB . ASP A 223 ? 0.1673 0.1708 0.1906 -0.0031 -0.0418 -0.0138 223 ASP A CB 1605 C CG . ASP A 223 ? 0.2571 0.1891 0.3102 -0.0601 -0.0813 0.0363 223 ASP A CG 1606 O OD1 . ASP A 223 ? 0.3051 0.1434 0.3033 -0.0492 -0.1204 0.0425 223 ASP A OD1 1607 O OD2 . ASP A 223 ? 0.2961 0.2258 0.7793 -0.0955 -0.1542 0.0635 223 ASP A OD2 1608 N N . TRP A 224 ? 0.1746 0.0949 0.1190 0.0173 -0.0274 0.0005 224 TRP A N 1609 C CA . TRP A 224 ? 0.1442 0.0976 0.1206 0.0039 -0.0072 -0.0013 224 TRP A CA 1610 C C . TRP A 224 ? 0.1364 0.1029 0.1259 0.0071 -0.0212 0.0000 224 TRP A C 1611 O O . TRP A 224 ? 0.1601 0.1037 0.1405 -0.0074 -0.0207 0.0074 224 TRP A O 1612 C CB . TRP A 224 ? 0.2065 0.1088 0.1133 0.0074 -0.0252 0.0189 224 TRP A CB 1613 C CG . TRP A 224 ? 0.2263 0.1030 0.1564 0.0111 0.0010 0.0115 224 TRP A CG 1614 C CD1 . TRP A 224 ? 0.2080 0.0952 0.1901 0.0026 0.0200 -0.0025 224 TRP A CD1 1615 C CD2 . TRP A 224 ? 0.2155 0.1233 0.1540 0.0502 0.0517 0.0267 224 TRP A CD2 1616 N NE1 . TRP A 224 ? 0.2610 0.0938 0.2561 -0.0016 0.0439 0.0070 224 TRP A NE1 1617 C CE2 . TRP A 224 ? 0.2590 0.1058 0.2098 0.0497 0.0793 0.0090 224 TRP A CE2 1618 C CE3 . TRP A 224 ? 0.2510 0.1622 0.1223 0.0616 0.0425 0.0489 224 TRP A CE3 1619 C CZ2 . TRP A 224 ? 0.3588 0.1368 0.2033 0.0645 0.1033 0.0443 224 TRP A CZ2 1620 C CZ3 . TRP A 224 ? 0.2909 0.1857 0.1789 0.1141 0.0693 0.0646 224 TRP A CZ3 1621 C CH2 . TRP A 224 ? 0.4227 0.1363 0.1749 0.1278 0.0688 0.0273 224 TRP A CH2 1622 N N . VAL A 225 ? 0.1607 0.0977 0.1079 0.0079 -0.0330 0.0043 225 VAL A N 1623 C CA . VAL A 225 ? 0.1602 0.0874 0.1033 -0.0064 -0.0304 0.0180 225 VAL A CA 1624 C C . VAL A 225 ? 0.1934 0.1037 0.1467 -0.0220 -0.0768 0.0558 225 VAL A C 1625 O O . VAL A 225 ? 0.2333 0.2063 0.1814 -0.0788 -0.0776 0.1100 225 VAL A O 1626 C CB . VAL A 225 ? 0.1913 0.0927 0.1526 0.0098 -0.0014 0.0179 225 VAL A CB 1627 C CG1 . VAL A 225 ? 0.2017 0.1101 0.2265 0.0130 -0.0198 -0.0199 225 VAL A CG1 1628 C CG2 . VAL A 225 ? 0.1796 0.1272 0.1919 0.0297 -0.0159 -0.0072 225 VAL A CG2 1629 N N . VAL A 226 ? 0.1725 0.0795 0.1058 0.0108 -0.0410 0.0244 226 VAL A N 1630 C CA . VAL A 226 ? 0.1846 0.0952 0.1139 -0.0066 -0.0589 0.0239 226 VAL A CA 1631 C C . VAL A 226 ? 0.2034 0.0801 0.0932 0.0052 -0.0610 0.0088 226 VAL A C 1632 O O . VAL A 226 ? 0.1878 0.0925 0.0967 0.0015 -0.0382 0.0142 226 VAL A O 1633 C CB . VAL A 226 ? 0.2059 0.1104 0.3703 0.0621 -0.1240 -0.0926 226 VAL A CB 1634 C CG1 . VAL A 226 ? 0.2228 0.0794 0.2471 0.0185 -0.0813 -0.0193 226 VAL A CG1 1635 C CG2 . VAL A 226 ? 0.3169 0.1679 0.3544 0.0081 -0.1406 -0.1097 226 VAL A CG2 1636 N N . GLY A 227 ? 0.1591 0.0972 0.0873 -0.0208 -0.0286 0.0130 227 GLY A N 1637 C CA . GLY A 227 ? 0.1819 0.0846 0.1041 -0.0035 -0.0713 0.0008 227 GLY A CA 1638 C C . GLY A 227 ? 0.1580 0.0756 0.0748 0.0027 -0.0352 0.0154 227 GLY A C 1639 O O . GLY A 227 ? 0.1654 0.1089 0.1200 0.0000 -0.0257 0.0460 227 GLY A O 1640 N N . GLU A 228 ? 0.1662 0.0795 0.0949 -0.0067 -0.0342 0.0261 228 GLU A N 1641 C CA . GLU A 228 ? 0.1527 0.0654 0.1232 0.0065 -0.0340 0.0211 228 GLU A CA 1642 C C . GLU A 228 ? 0.1494 0.0906 0.0705 -0.0022 -0.0132 0.0077 228 GLU A C 1643 O O . GLU A 228 ? 0.1602 0.0900 0.1002 -0.0074 -0.0170 0.0267 228 GLU A O 1644 C CB . GLU A 228 ? 0.1944 0.0861 0.1287 0.0062 -0.0156 0.0032 228 GLU A CB 1645 C CG . GLU A 228 ? 0.2019 0.1059 0.1338 0.0222 -0.0155 0.0055 228 GLU A CG 1646 C CD . GLU A 228 ? 0.1793 0.0829 0.1184 0.0458 -0.0282 0.0189 228 GLU A CD 1647 O OE1 . GLU A 228 ? 0.1907 0.0798 0.0703 0.0240 -0.0324 0.0015 228 GLU A OE1 1648 O OE2 . GLU A 228 ? 0.1823 0.0929 0.0931 0.0221 -0.0523 0.0021 228 GLU A OE2 1649 N N . LYS A 229 ? 0.1646 0.0692 0.0897 0.0007 -0.0314 0.0118 229 LYS A N 1650 C CA . LYS A 229 ? 0.1468 0.0780 0.0743 0.0123 -0.0263 0.0258 229 LYS A CA 1651 C C . LYS A 229 ? 0.1552 0.0682 0.0673 0.0081 -0.0269 -0.0005 229 LYS A C 1652 O O . LYS A 229 ? 0.1320 0.0790 0.0937 0.0139 -0.0303 0.0146 229 LYS A O 1653 C CB . LYS A 229 ? 0.1636 0.0681 0.1012 0.0120 -0.0237 -0.0076 229 LYS A CB 1654 C CG . LYS A 229 ? 0.1599 0.0830 0.1061 0.0078 -0.0265 0.0019 229 LYS A CG 1655 C CD . LYS A 229 ? 0.1712 0.0809 0.1540 0.0055 -0.0536 0.0222 229 LYS A CD 1656 C CE . LYS A 229 ? 0.1733 0.0743 0.1554 0.0020 -0.0430 0.0020 229 LYS A CE 1657 N NZ . LYS A 229 ? 0.1775 0.0771 0.1403 0.0081 -0.0479 0.0092 229 LYS A NZ 1658 N N . THR A 230 ? 0.1559 0.0896 0.0864 0.0168 -0.0173 0.0021 230 THR A N 1659 C CA . THR A 230 ? 0.1537 0.0898 0.0853 0.0115 -0.0073 0.0012 230 THR A CA 1660 C C . THR A 230 ? 0.1570 0.0622 0.1125 0.0049 -0.0198 0.0082 230 THR A C 1661 O O . THR A 230 ? 0.1487 0.0716 0.1499 0.0084 -0.0322 -0.0003 230 THR A O 1662 C CB . THR A 230 ? 0.1885 0.1202 0.0938 0.0246 0.0022 0.0009 230 THR A CB 1663 O OG1 . THR A 230 ? 0.2161 0.1263 0.1334 0.0231 0.0081 0.0541 230 THR A OG1 1664 C CG2 . THR A 230 ? 0.2706 0.2050 0.0901 0.0019 -0.0158 -0.0188 230 THR A CG2 1665 N N . GLY A 231 ? 0.1495 0.0923 0.1165 0.0143 -0.0219 -0.0144 231 GLY A N 1666 C CA . GLY A 231 ? 0.1533 0.1124 0.1574 0.0017 -0.0311 -0.0103 231 GLY A CA 1667 C C . GLY A 231 ? 0.1465 0.1005 0.1376 0.0068 -0.0280 0.0213 231 GLY A C 1668 O O . GLY A 231 ? 0.1549 0.1023 0.1470 0.0092 -0.0224 0.0078 231 GLY A O 1669 N N . THR A 232 ? 0.1534 0.1206 0.1896 0.0044 -0.0338 -0.0066 232 THR A N 1670 C CA . THR A 232 ? 0.1421 0.1702 0.2392 0.0245 -0.0406 0.0319 232 THR A CA 1671 C C . THR A 232 ? 0.1819 0.1225 0.3171 0.0209 -0.0909 0.0148 232 THR A C 1672 O O . THR A 232 ? 0.3040 0.1286 0.5855 0.0209 -0.2134 -0.0256 232 THR A O 1673 C CB . THR A 232 ? 0.1953 0.1678 0.2595 0.0275 0.0191 0.0034 232 THR A CB 1674 O OG1 . THR A 232 ? 0.2396 0.1978 0.2061 0.0261 0.0108 0.0478 232 THR A OG1 1675 C CG2 . THR A 232 ? 0.2851 0.4550 0.2467 0.1769 0.0235 -0.0119 232 THR A CG2 1676 N N . CYS A 233 ? 0.2411 0.1340 0.2948 0.0383 -0.1296 -0.0024 233 CYS A N 1677 C CA . CYS A 233 ? 0.2339 0.1769 0.2459 0.0216 -0.1046 -0.0038 233 CYS A CA 1678 C C . CYS A 233 ? 0.2162 0.1676 0.2179 0.0045 -0.0872 0.0350 233 CYS A C 1679 O O . CYS A 233 ? 0.2021 0.2169 0.1632 0.0200 -0.0610 0.0162 233 CYS A O 1680 C CB . CYS A 233 ? 0.3152 0.3015 0.2599 -0.0360 -0.0452 -0.0694 233 CYS A CB 1681 S SG . CYS A 233 ? 0.3548 0.1996 0.1495 0.0833 -0.0644 -0.0037 233 CYS A SG 1682 N N . ALA A 234 ? 0.2192 0.1762 0.2213 0.0160 -0.0825 0.0091 234 ALA A N 1683 C CA . ALA A 234 ? 0.1966 0.1710 0.2705 -0.0074 -0.0466 0.0442 234 ALA A CA 1684 C C . ALA A 234 ? 0.1861 0.1766 0.1963 0.0182 -0.0120 0.0460 234 ALA A C 1685 O O . ALA A 234 ? 0.1824 0.1620 0.1686 0.0118 -0.0290 0.0222 234 ALA A O 1686 C CB . ALA A 234 ? 0.2122 0.1870 0.2852 0.0177 -0.0694 0.0198 234 ALA A CB 1687 N N . ASN A 235 ? 0.1500 0.1972 0.1854 0.0190 -0.0457 0.0416 235 ASN A N 1688 C CA . ASN A 235 ? 0.2025 0.1888 0.1959 0.0351 -0.0571 0.0132 235 ASN A CA 1689 C C . ASN A 235 ? 0.1700 0.1830 0.1656 0.0334 -0.0229 0.0197 235 ASN A C 1690 O O . ASN A 235 ? 0.2277 0.1845 0.2225 0.0365 -0.0527 0.0585 235 ASN A O 1691 C CB . ASN A 235 ? 0.1561 0.1944 0.2027 0.0048 -0.0401 0.0509 235 ASN A CB 1692 C CG . ASN A 235 ? 0.1643 0.1742 0.2444 0.0283 -0.0666 0.0018 235 ASN A CG 1693 O OD1 . ASN A 235 ? 0.1353 0.3139 0.3036 0.0316 -0.0622 0.0032 235 ASN A OD1 1694 N ND2 . ASN A 235 ? 0.3083 0.2389 0.1872 -0.0163 -0.0789 0.0270 235 ASN A ND2 1695 N N . GLY A 236 ? 0.1564 0.1666 0.1661 0.0205 -0.0143 0.0250 236 GLY A N 1696 C CA . GLY A 236 ? 0.1670 0.1894 0.1328 0.0297 -0.0129 0.0062 236 GLY A CA 1697 C C . GLY A 236 ? 0.1627 0.1074 0.1882 0.0054 0.0056 0.0433 236 GLY A C 1698 O O . GLY A 236 ? 0.1784 0.1150 0.1747 0.0137 -0.0071 0.0230 236 GLY A O 1699 N N . GLY A 237 ? 0.1651 0.1238 0.1799 0.0315 -0.0245 0.0234 237 GLY A N 1700 C CA . GLY A 237 ? 0.1589 0.1467 0.1701 0.0376 -0.0256 0.0479 237 GLY A CA 1701 C C . GLY A 237 ? 0.1547 0.1217 0.1198 0.0209 -0.0105 0.0277 237 GLY A C 1702 O O . GLY A 237 ? 0.1489 0.1392 0.1896 0.0231 -0.0025 0.0558 237 GLY A O 1703 N N . ARG A 238 ? 0.1404 0.1121 0.1287 0.0326 -0.0019 0.0456 238 ARG A N 1704 C CA . ARG A 238 ? 0.1559 0.1136 0.1088 0.0272 -0.0093 0.0320 238 ARG A CA 1705 C C . ARG A 238 ? 0.1518 0.0846 0.0766 0.0140 -0.0299 0.0011 238 ARG A C 1706 O O . ARG A 238 ? 0.1760 0.0733 0.1267 0.0120 -0.0099 -0.0002 238 ARG A O 1707 C CB . ARG A 238 ? 0.1954 0.1474 0.1132 0.0443 0.0109 0.0344 238 ARG A CB 1708 C CG . ARG A 238 ? 0.2550 0.1036 0.0986 0.0127 -0.0374 -0.0015 238 ARG A CG 1709 C CD . ARG A 238 ? 0.2570 0.1277 0.1147 -0.0036 -0.0507 0.0178 238 ARG A CD 1710 N NE . ARG A 238 ? 0.3630 0.1053 0.1343 0.0465 -0.0526 0.0224 238 ARG A NE 1711 C CZ . ARG A 238 ? 0.2365 0.1474 0.1157 0.0254 -0.0287 0.0156 238 ARG A CZ 1712 N NH1 . ARG A 238 ? 0.3019 0.3023 0.1472 0.1348 0.0510 0.0652 238 ARG A NH1 1713 N NH2 . ARG A 238 ? 0.3578 0.1541 0.1416 0.0794 -0.0098 0.0538 238 ARG A NH2 1714 N N . ASN A 239 ? 0.1619 0.0807 0.0867 0.0212 -0.0128 0.0160 239 ASN A N 1715 C CA . ASN A 239 ? 0.1620 0.0687 0.0930 0.0142 -0.0148 0.0102 239 ASN A CA 1716 C C . ASN A 239 ? 0.1608 0.0767 0.0837 0.0192 -0.0231 0.0023 239 ASN A C 1717 O O . ASN A 239 ? 0.1766 0.0732 0.1021 0.0097 -0.0273 0.0090 239 ASN A O 1718 C CB . ASN A 239 ? 0.1365 0.1164 0.0888 0.0196 -0.0178 0.0067 239 ASN A CB 1719 C CG . ASN A 239 ? 0.1835 0.1014 0.1372 0.0103 -0.0558 0.0311 239 ASN A CG 1720 O OD1 . ASN A 239 ? 0.1693 0.1198 0.0959 0.0315 -0.0281 0.0315 239 ASN A OD1 1721 N ND2 . ASN A 239 ? 0.2543 0.1321 0.2072 -0.0012 -0.1317 0.0121 239 ASN A ND2 1722 N N . ASP A 240 ? 0.1656 0.0854 0.0823 0.0173 -0.0284 0.0221 240 ASP A N 1723 C CA . ASP A 240 ? 0.1586 0.0716 0.0788 0.0160 -0.0257 0.0077 240 ASP A CA 1724 C C . ASP A 240 ? 0.1658 0.0824 0.0866 0.0190 -0.0231 0.0192 240 ASP A C 1725 O O . ASP A 240 ? 0.1905 0.0737 0.0967 0.0020 -0.0180 0.0149 240 ASP A O 1726 C CB . ASP A 240 ? 0.1876 0.0836 0.0814 0.0147 -0.0364 0.0100 240 ASP A CB 1727 C CG . ASP A 240 ? 0.1310 0.0902 0.0530 0.0315 -0.0074 -0.0209 240 ASP A CG 1728 O OD1 . ASP A 240 ? 0.1714 0.0723 0.0474 0.0358 -0.0241 -0.0010 240 ASP A OD1 1729 O OD2 . ASP A 240 ? 0.2534 0.0714 0.0555 0.0575 -0.0294 -0.0090 240 ASP A OD2 1730 N N . ILE A 241 ? 0.1612 0.0750 0.0892 0.0051 -0.0130 0.0164 241 ILE A N 1731 C CA . ILE A 241 ? 0.1421 0.0696 0.0848 -0.0082 -0.0278 0.0138 241 ILE A CA 1732 C C . ILE A 241 ? 0.1533 0.0824 0.0824 -0.0012 -0.0357 0.0194 241 ILE A C 1733 O O . ILE A 241 ? 0.1468 0.0843 0.1102 0.0042 -0.0259 0.0316 241 ILE A O 1734 C CB . ILE A 241 ? 0.1680 0.0752 0.0760 0.0074 -0.0282 0.0080 241 ILE A CB 1735 C CG1 . ILE A 241 ? 0.1648 0.0771 0.0936 0.0189 -0.0394 0.0012 241 ILE A CG1 1736 C CG2 . ILE A 241 ? 0.1594 0.0636 0.1022 -0.0048 -0.0352 0.0070 241 ILE A CG2 1737 C CD1 . ILE A 241 ? 0.1832 0.0987 0.0963 -0.0155 -0.0221 0.0008 241 ILE A CD1 1738 N N . GLY A 242 ? 0.1471 0.0817 0.0883 0.0098 -0.0208 0.0204 242 GLY A N 1739 C CA . GLY A 242 ? 0.1502 0.1073 0.1254 -0.0076 -0.0460 0.0484 242 GLY A CA 1740 C C . GLY A 242 ? 0.1400 0.1021 0.0784 0.0014 -0.0150 0.0244 242 GLY A C 1741 O O . GLY A 242 ? 0.1623 0.0877 0.1005 0.0113 0.0001 0.0276 242 GLY A O 1742 N N . PHE A 243 ? 0.1397 0.0973 0.1051 -0.0032 -0.0319 0.0287 243 PHE A N 1743 C CA . PHE A 243 ? 0.1524 0.1025 0.1113 -0.0165 -0.0338 0.0323 243 PHE A CA 1744 C C . PHE A 243 ? 0.1970 0.0958 0.1122 -0.0432 -0.0514 0.0430 243 PHE A C 1745 O O . PHE A 243 ? 0.1911 0.1135 0.1108 -0.0491 -0.0416 0.0356 243 PHE A O 1746 C CB . PHE A 243 ? 0.1432 0.1157 0.1503 -0.0076 -0.0148 0.0413 243 PHE A CB 1747 C CG . PHE A 243 ? 0.1501 0.1304 0.1548 0.0040 -0.0061 0.0481 243 PHE A CG 1748 C CD1 . PHE A 243 ? 0.1732 0.1105 0.2133 0.0098 0.0165 0.0578 243 PHE A CD1 1749 C CD2 . PHE A 243 ? 0.1430 0.2029 0.1691 0.0058 -0.0110 0.0878 243 PHE A CD2 1750 C CE1 . PHE A 243 ? 0.1926 0.1555 0.2504 -0.0009 0.0150 0.0975 243 PHE A CE1 1751 C CE2 . PHE A 243 ? 0.1945 0.2118 0.2862 0.0171 -0.0725 0.1324 243 PHE A CE2 1752 C CZ . PHE A 243 ? 0.1829 0.1974 0.2262 0.0342 0.0226 0.1005 243 PHE A CZ 1753 N N . PHE A 244 ? 0.1999 0.1142 0.1054 -0.0553 -0.0420 0.0424 244 PHE A N 1754 C CA . PHE A 244 ? 0.2050 0.1277 0.1128 -0.0688 -0.0471 0.0389 244 PHE A CA 1755 C C . PHE A 244 ? 0.2023 0.1286 0.1309 -0.0599 -0.0496 0.0428 244 PHE A C 1756 O O . PHE A 244 ? 0.1836 0.1486 0.1505 -0.0317 -0.0219 0.0573 244 PHE A O 1757 C CB . PHE A 244 ? 0.2359 0.1674 0.0974 -0.0606 -0.0186 0.0351 244 PHE A CB 1758 C CG . PHE A 244 ? 0.2059 0.1452 0.0993 -0.0409 -0.0196 0.0077 244 PHE A CG 1759 C CD1 . PHE A 244 ? 0.2073 0.1457 0.1508 -0.0455 -0.0306 0.0161 244 PHE A CD1 1760 C CD2 . PHE A 244 ? 0.2130 0.1423 0.1207 -0.0351 -0.0455 0.0174 244 PHE A CD2 1761 C CE1 . PHE A 244 ? 0.2530 0.1281 0.1335 -0.0127 -0.0436 -0.0146 244 PHE A CE1 1762 C CE2 . PHE A 244 ? 0.2406 0.1372 0.1205 -0.0390 -0.0197 0.0087 244 PHE A CE2 1763 C CZ . PHE A 244 ? 0.2640 0.1017 0.1285 -0.0141 -0.0353 0.0010 244 PHE A CZ 1764 N N . LYS A 245 ? 0.1971 0.1544 0.1381 -0.0578 -0.0474 0.0406 245 LYS A N 1765 C CA . LYS A 245 ? 0.1772 0.1573 0.1504 -0.0055 -0.0324 0.0005 245 LYS A CA 1766 C C . LYS A 245 ? 0.1471 0.1533 0.1436 0.0003 -0.0400 0.0064 245 LYS A C 1767 O O . LYS A 245 ? 0.1433 0.1715 0.1411 -0.0106 -0.0306 0.0090 245 LYS A O 1768 C CB . LYS A 245 ? 0.2643 0.1707 0.1591 0.0294 0.0177 0.0112 245 LYS A CB 1769 N N . ALA A 246 ? 0.1265 0.1630 0.1608 -0.0096 -0.0130 -0.0093 246 ALA A N 1770 C CA . ALA A 246 ? 0.1671 0.1776 0.1812 -0.0506 0.0168 -0.0198 246 ALA A CA 1771 C C . ALA A 246 ? 0.1629 0.3066 0.1833 -0.0823 -0.0087 -0.0375 246 ALA A C 1772 O O . ALA A 246 ? 0.2162 0.3065 0.2478 -0.1173 0.0868 -0.0925 246 ALA A O 1773 C CB . ALA A 246 ? 0.2800 0.1703 0.3088 -0.0035 0.0864 -0.0395 246 ALA A CB 1774 N N . GLN A 247 ? 0.2122 0.4137 0.2191 0.0031 -0.0433 -0.0385 247 GLN A N 1775 C CA . GLN A 247 ? 0.2025 0.3818 0.3434 -0.0169 0.0178 0.0549 247 GLN A CA 1776 C C . GLN A 247 ? 0.1591 0.4484 0.3856 -0.0176 0.0283 0.0024 247 GLN A C 1777 O O . GLN A 247 ? 0.2400 0.5834 0.5120 -0.1123 0.0935 -0.1283 247 GLN A O 1778 C CB . GLN A 247 ? 0.2069 0.5498 0.6927 -0.0034 -0.0659 -0.1884 247 GLN A CB 1779 N N . GLU A 248 ? 0.1897 0.4500 0.3410 0.0125 0.0154 0.0596 248 GLU A N 1780 C CA . GLU A 248 ? 0.1831 0.4183 0.3861 0.0379 0.0366 0.0478 248 GLU A CA 1781 C C . GLU A 248 ? 0.1933 0.4811 0.3327 0.0531 0.0491 0.0009 248 GLU A C 1782 O O . GLU A 248 ? 0.3262 0.7594 0.3690 0.2343 0.0615 -0.0690 248 GLU A O 1783 C CB . GLU A 248 ? 0.1871 0.4993 0.3941 0.0451 0.0519 0.1917 248 GLU A CB 1784 C CG . GLU A 248 ? 0.2071 0.6004 0.4284 -0.0031 -0.0264 0.2773 248 GLU A CG 1785 C CD . GLU A 248 ? 0.2005 0.5867 0.4289 0.0061 -0.0256 0.2828 248 GLU A CD 1786 O OE1 . GLU A 248 ? 0.2710 0.5681 0.4244 -0.1338 -0.0415 0.2499 248 GLU A OE1 1787 O OE2 . GLU A 248 ? 0.2248 0.3335 0.3355 0.0305 -0.0071 0.0165 248 GLU A OE2 1788 N N . ARG A 249 ? 0.1535 0.3146 0.2208 -0.0401 0.0182 0.0167 249 ARG A N 1789 C CA . ARG A 249 ? 0.2304 0.3721 0.2384 -0.0863 -0.0210 0.0675 249 ARG A CA 1790 C C . ARG A 249 ? 0.2213 0.2815 0.1994 -0.0479 -0.0124 0.0457 249 ARG A C 1791 O O . ARG A 249 ? 0.2042 0.2147 0.1773 -0.0222 -0.0198 0.0410 249 ARG A O 1792 C CB . ARG A 249 ? 0.4138 0.3058 0.4365 -0.1355 -0.1959 0.1268 249 ARG A CB 1793 C CG . ARG A 249 ? 0.4201 0.4047 0.5854 -0.2111 -0.1567 0.1385 249 ARG A CG 1794 C CD . ARG A 249 ? 0.5626 0.6216 0.6762 -0.2518 -0.0678 0.2741 249 ARG A CD 1795 N NE . ARG A 249 ? 0.7819 0.7217 0.7135 -0.2279 -0.1296 0.3753 249 ARG A NE 1796 C CZ . ARG A 249 ? 0.8622 0.7907 0.8223 -0.1898 -0.2517 0.3474 249 ARG A CZ 1797 N NH1 . ARG A 249 ? 0.8605 0.9293 0.9950 -0.2602 -0.3223 0.3153 249 ARG A NH1 1798 N NH2 . ARG A 249 ? 1.0843 0.8958 0.7459 -0.3010 -0.2671 0.4770 249 ARG A NH2 1799 N N . ASP A 250 ? 0.1503 0.3109 0.2015 -0.0065 0.0192 0.0360 250 ASP A N 1800 C CA . ASP A 250 ? 0.1814 0.2251 0.1980 0.0252 -0.0126 0.0221 250 ASP A CA 1801 C C . ASP A 250 ? 0.1798 0.1265 0.1832 -0.0190 -0.0014 0.0227 250 ASP A C 1802 O O . ASP A 250 ? 0.1932 0.2106 0.2008 -0.0061 0.0370 0.0515 250 ASP A O 1803 C CB . ASP A 250 ? 0.3377 0.1718 0.2819 0.0637 0.0628 0.0649 250 ASP A CB 1804 C CG . ASP A 250 ? 0.2717 0.1975 0.3454 0.0373 0.0246 0.0555 250 ASP A CG 1805 O OD1 . ASP A 250 ? 0.3220 0.5550 0.3621 0.1590 0.0551 0.1838 250 ASP A OD1 1806 O OD2 . ASP A 250 ? 0.4551 0.2138 0.4574 0.1556 0.0678 0.0303 250 ASP A OD2 1807 N N . TYR A 251 ? 0.1736 0.1164 0.1292 -0.0167 -0.0213 0.0273 251 TYR A N 1808 C CA . TYR A 251 ? 0.1861 0.1067 0.1348 -0.0173 -0.0244 0.0191 251 TYR A CA 1809 C C . TYR A 251 ? 0.1508 0.0916 0.1119 -0.0028 -0.0046 0.0266 251 TYR A C 1810 O O . TYR A 251 ? 0.2351 0.1361 0.1385 -0.0432 -0.0605 0.0639 251 TYR A O 1811 C CB . TYR A 251 ? 0.1789 0.1118 0.1483 -0.0193 0.0166 0.0188 251 TYR A CB 1812 C CG . TYR A 251 ? 0.2127 0.1239 0.1421 -0.0355 0.0088 0.0110 251 TYR A CG 1813 C CD1 . TYR A 251 ? 0.2058 0.1533 0.1608 -0.0283 -0.0031 0.0201 251 TYR A CD1 1814 C CD2 . TYR A 251 ? 0.2222 0.1112 0.1584 -0.0208 0.0047 0.0140 251 TYR A CD2 1815 C CE1 . TYR A 251 ? 0.2527 0.1680 0.1812 -0.0303 -0.0361 0.0026 251 TYR A CE1 1816 C CE2 . TYR A 251 ? 0.3242 0.1142 0.2010 -0.0600 -0.0273 0.0209 251 TYR A CE2 1817 C CZ . TYR A 251 ? 0.2768 0.1560 0.2435 -0.0588 -0.0478 0.0095 251 TYR A CZ 1818 O OH . TYR A 251 ? 0.3264 0.1958 0.3172 -0.0872 -0.0566 -0.0298 251 TYR A OH 1819 N N . ALA A 252 ? 0.1438 0.1109 0.1184 -0.0070 -0.0048 0.0505 252 ALA A N 1820 C CA . ALA A 252 ? 0.1530 0.0984 0.1090 -0.0014 -0.0166 0.0316 252 ALA A CA 1821 C C . ALA A 252 ? 0.1438 0.0907 0.1193 -0.0135 -0.0054 0.0245 252 ALA A C 1822 O O . ALA A 252 ? 0.1844 0.0950 0.1617 -0.0049 0.0269 0.0464 252 ALA A O 1823 C CB . ALA A 252 ? 0.1834 0.1242 0.1186 0.0051 -0.0008 0.0109 252 ALA A CB 1824 N N . VAL A 253 ? 0.1447 0.0851 0.1076 -0.0066 -0.0128 0.0264 253 VAL A N 1825 C CA . VAL A 253 ? 0.1508 0.0893 0.1014 0.0017 -0.0121 0.0097 253 VAL A CA 1826 C C . VAL A 253 ? 0.1611 0.0837 0.0990 -0.0082 -0.0307 0.0314 253 VAL A C 1827 O O . VAL A 253 ? 0.1569 0.0886 0.1153 -0.0084 0.0008 0.0248 253 VAL A O 1828 C CB . VAL A 253 ? 0.1651 0.1228 0.1232 0.0035 -0.0219 -0.0125 253 VAL A CB 1829 C CG1 . VAL A 253 ? 0.1926 0.1776 0.0911 -0.0071 -0.0209 0.0046 253 VAL A CG1 1830 C CG2 . VAL A 253 ? 0.2061 0.2185 0.1215 0.0694 -0.0506 -0.0615 253 VAL A CG2 1831 N N . ALA A 254 ? 0.1575 0.0926 0.0826 -0.0086 -0.0114 0.0308 254 ALA A N 1832 C CA . ALA A 254 ? 0.1606 0.0801 0.0835 0.0065 -0.0169 0.0160 254 ALA A CA 1833 C C . ALA A 254 ? 0.1702 0.0874 0.0726 0.0197 -0.0226 0.0366 254 ALA A C 1834 O O . ALA A 254 ? 0.1778 0.0737 0.1401 0.0159 -0.0178 0.0263 254 ALA A O 1835 C CB . ALA A 254 ? 0.1585 0.1198 0.0830 0.0067 -0.0198 0.0189 254 ALA A CB 1836 N N . VAL A 255 ? 0.1602 0.0792 0.0769 0.0129 -0.0236 0.0062 255 VAL A N 1837 C CA . VAL A 255 ? 0.1621 0.0794 0.0721 0.0100 -0.0253 0.0238 255 VAL A CA 1838 C C . VAL A 255 ? 0.1622 0.0793 0.0845 0.0129 -0.0269 0.0210 255 VAL A C 1839 O O . VAL A 255 ? 0.1670 0.0814 0.0914 0.0047 -0.0276 0.0337 255 VAL A O 1840 C CB . VAL A 255 ? 0.1755 0.0751 0.0825 0.0035 -0.0195 0.0005 255 VAL A CB 1841 C CG1 . VAL A 255 ? 0.1756 0.1140 0.1031 0.0240 -0.0262 -0.0036 255 VAL A CG1 1842 C CG2 . VAL A 255 ? 0.1764 0.1093 0.0847 -0.0012 -0.0368 0.0033 255 VAL A CG2 1843 N N . TYR A 256 ? 0.1588 0.0695 0.0928 0.0140 -0.0196 0.0239 256 TYR A N 1844 C CA . TYR A 256 ? 0.1678 0.0819 0.0899 0.0163 -0.0297 0.0016 256 TYR A CA 1845 C C . TYR A 256 ? 0.1531 0.0798 0.0903 0.0062 -0.0212 0.0065 256 TYR A C 1846 O O . TYR A 256 ? 0.1863 0.0635 0.1628 0.0097 -0.0289 0.0035 256 TYR A O 1847 C CB . TYR A 256 ? 0.1712 0.0900 0.0806 0.0118 -0.0167 0.0112 256 TYR A CB 1848 C CG . TYR A 256 ? 0.1681 0.0828 0.0754 0.0095 -0.0240 0.0078 256 TYR A CG 1849 C CD1 . TYR A 256 ? 0.1637 0.0948 0.0814 0.0063 -0.0243 0.0054 256 TYR A CD1 1850 C CD2 . TYR A 256 ? 0.1723 0.0850 0.0874 0.0062 -0.0116 0.0120 256 TYR A CD2 1851 C CE1 . TYR A 256 ? 0.1754 0.0923 0.0707 -0.0010 -0.0329 -0.0092 256 TYR A CE1 1852 C CE2 . TYR A 256 ? 0.1700 0.0879 0.0879 0.0129 -0.0336 0.0010 256 TYR A CE2 1853 C CZ . TYR A 256 ? 0.1752 0.0914 0.0722 0.0066 -0.0160 0.0052 256 TYR A CZ 1854 O OH . TYR A 256 ? 0.1903 0.0828 0.0995 0.0125 -0.0410 -0.0036 256 TYR A OH 1855 N N . THR A 257 ? 0.1629 0.0863 0.1236 0.0240 -0.0116 0.0171 257 THR A N 1856 C CA . THR A 257 ? 0.1641 0.1092 0.1283 0.0225 0.0104 0.0250 257 THR A CA 1857 C C . THR A 257 ? 0.1711 0.0898 0.1422 0.0200 0.0216 0.0187 257 THR A C 1858 O O . THR A 257 ? 0.1787 0.1020 0.1428 0.0097 0.0030 0.0172 257 THR A O 1859 C CB . THR A 257 ? 0.1917 0.1120 0.1339 0.0336 0.0089 0.0102 257 THR A CB 1860 O OG1 . THR A 257 ? 0.1769 0.1074 0.1086 0.0230 -0.0154 -0.0023 257 THR A OG1 1861 C CG2 . THR A 257 ? 0.1916 0.1187 0.1279 0.0177 0.0072 0.0002 257 THR A CG2 1862 N N . THR A 258 ? 0.1626 0.1120 0.1047 0.0269 -0.0041 0.0056 258 THR A N 1863 C CA . THR A 258 ? 0.1636 0.1263 0.1273 0.0067 -0.0130 -0.0057 258 THR A CA 1864 C C . THR A 258 ? 0.1838 0.1557 0.1383 0.0549 0.0041 0.0097 258 THR A C 1865 O O . THR A 258 ? 0.2325 0.1387 0.1398 0.0752 -0.0160 0.0164 258 THR A O 1866 C CB . THR A 258 ? 0.1801 0.1804 0.1355 0.0359 -0.0165 0.0241 258 THR A CB 1867 O OG1 . THR A 258 ? 0.3335 0.1430 0.1430 0.0375 -0.0082 -0.0166 258 THR A OG1 1868 C CG2 . THR A 258 ? 0.2110 0.4160 0.2720 -0.0261 -0.1001 0.1114 258 THR A CG2 1869 N N . ALA A 259 ? 0.1838 0.1654 0.1599 0.0522 0.0074 0.0029 259 ALA A N 1870 C CA . ALA A 259 ? 0.1910 0.1537 0.1279 0.0501 0.0162 0.0267 259 ALA A CA 1871 C C . ALA A 259 ? 0.1946 0.1784 0.1474 0.0392 0.0094 0.0342 259 ALA A C 1872 O O . ALA A 259 ? 0.1774 0.1930 0.2050 0.0678 0.0505 0.0659 259 ALA A O 1873 C CB . ALA A 259 ? 0.2125 0.2089 0.1705 0.0347 -0.0045 -0.0181 259 ALA A CB 1874 N N . PRO A 260 ? 0.2045 0.2479 0.1459 0.0274 -0.0049 0.0153 260 PRO A N 1875 C CA . PRO A 260 ? 0.1778 0.2669 0.2049 0.0626 -0.0049 0.0432 260 PRO A CA 1876 C C . PRO A 260 ? 0.2335 0.2186 0.2099 0.0801 0.0227 0.0919 260 PRO A C 1877 O O . PRO A 260 ? 0.1994 0.2625 0.3238 0.0698 0.0742 0.0756 260 PRO A O 1878 C CB . PRO A 260 ? 0.2335 0.3570 0.2055 0.0571 -0.0537 0.0370 260 PRO A CB 1879 C CG . PRO A 260 ? 0.3060 0.2819 0.2089 0.0411 -0.0579 0.0485 260 PRO A CG 1880 C CD . PRO A 260 ? 0.2624 0.2220 0.1814 0.0646 -0.0202 0.0429 260 PRO A CD 1881 N N . LYS A 261 ? 0.1965 0.2505 0.2390 0.0986 0.0366 0.0438 261 LYS A N 1882 C CA . LYS A 261 ? 0.2452 0.3153 0.2420 0.1734 0.0375 0.0600 261 LYS A CA 1883 C C . LYS A 261 ? 0.2134 0.2824 0.2276 0.1022 0.0078 0.0374 261 LYS A C 1884 O O . LYS A 261 ? 0.2748 0.3907 0.2363 0.1998 0.0387 0.0502 261 LYS A O 1885 C CB . LYS A 261 ? 0.5242 0.3143 0.2887 0.2589 0.0241 0.0318 261 LYS A CB 1886 C CG . LYS A 261 ? 0.7705 0.3697 0.3499 0.3541 -0.0514 0.0501 261 LYS A CG 1887 C CD . LYS A 261 ? 0.7789 0.6286 0.4224 0.4708 -0.1437 0.0068 261 LYS A CD 1888 C CE . LYS A 261 ? 0.7491 0.7161 0.3651 0.5178 -0.0742 0.0206 261 LYS A CE 1889 N NZ . LYS A 261 ? 0.9197 1.1969 0.2838 0.4020 -0.1696 -0.0182 261 LYS A NZ 1890 N N . LEU A 262 ? 0.1945 0.2109 0.1919 0.0559 0.0217 0.0551 262 LEU A N 1891 C CA . LEU A 262 ? 0.2092 0.2195 0.1989 0.1024 0.0298 0.0470 262 LEU A CA 1892 C C . LEU A 262 ? 0.1838 0.2340 0.1963 0.0905 0.0106 0.0596 262 LEU A C 1893 O O . LEU A 262 ? 0.2883 0.2360 0.2122 0.0834 0.0000 0.0420 262 LEU A O 1894 C CB . LEU A 262 ? 0.2043 0.1964 0.1822 0.0858 0.0226 0.0037 262 LEU A CB 1895 C CG . LEU A 262 ? 0.2427 0.2085 0.2231 0.0727 0.0582 0.0009 262 LEU A CG 1896 C CD1 . LEU A 262 ? 0.2232 0.2078 0.1523 0.0628 -0.0186 0.0081 262 LEU A CD1 1897 C CD2 . LEU A 262 ? 0.2500 0.2783 0.3376 0.0749 0.0046 -0.1187 262 LEU A CD2 1898 N N . SER A 263 ? 0.2286 0.2426 0.1957 0.0775 0.0207 0.0550 263 SER A N 1899 C CA . SER A 263 ? 0.1791 0.2688 0.2297 0.0576 0.0398 0.0909 263 SER A CA 1900 C C . SER A 263 ? 0.1666 0.2345 0.1893 0.0517 0.0264 0.1160 263 SER A C 1901 O O . SER A 263 ? 0.1745 0.2131 0.1712 0.0363 0.0348 0.0392 263 SER A O 1902 C CB . SER A 263 ? 0.2009 0.3311 0.2450 0.0694 0.0749 0.1053 263 SER A CB 1903 O OG . SER A 263 ? 0.2014 0.3715 0.1872 0.1136 0.0629 0.0820 263 SER A OG 1904 N N . ALA A 264 ? 0.1836 0.2306 0.2009 0.0137 0.0099 0.0351 264 ALA A N 1905 C CA . ALA A 264 ? 0.1841 0.1968 0.1965 -0.0067 0.0152 -0.0245 264 ALA A CA 1906 C C . ALA A 264 ? 0.1785 0.2068 0.1365 -0.0080 0.0152 0.0539 264 ALA A C 1907 O O . ALA A 264 ? 0.1663 0.1823 0.1412 0.0433 0.0107 -0.0010 264 ALA A O 1908 C CB . ALA A 264 ? 0.2608 0.2063 0.2000 -0.0262 0.0605 -0.0355 264 ALA A CB 1909 N N . VAL A 265 ? 0.1805 0.2252 0.1470 0.0303 0.0277 0.0379 265 VAL A N 1910 C CA . VAL A 265 ? 0.2320 0.2119 0.1285 0.0464 -0.0031 0.0469 265 VAL A CA 1911 C C . VAL A 265 ? 0.2093 0.1771 0.1007 0.0556 0.0129 -0.0045 265 VAL A C 1912 O O . VAL A 265 ? 0.2041 0.2209 0.1173 0.0569 0.0159 0.0225 265 VAL A O 1913 C CB . VAL A 265 ? 0.3055 0.3826 0.1322 0.0321 -0.0025 0.1032 265 VAL A CB 1914 C CG1 . VAL A 265 ? 0.3634 0.5677 0.0954 -0.0465 0.0277 0.0374 265 VAL A CG1 1915 C CG2 . VAL A 265 ? 0.3934 0.4201 0.2039 -0.0251 0.1154 0.0944 265 VAL A CG2 1916 N N . GLU A 266 ? 0.2053 0.1923 0.1157 0.0523 0.0249 0.0166 266 GLU A N 1917 C CA . GLU A 266 ? 0.2232 0.1868 0.1052 0.0545 0.0235 0.0162 266 GLU A CA 1918 C C . GLU A 266 ? 0.1466 0.1471 0.0938 0.0346 -0.0095 0.0033 266 GLU A C 1919 O O . GLU A 266 ? 0.1704 0.1645 0.1456 0.0208 0.0042 -0.0209 266 GLU A O 1920 C CB . GLU A 266 ? 0.2033 0.1978 0.1392 0.0529 0.0390 0.0142 266 GLU A CB 1921 C CG . GLU A 266 ? 0.3139 0.3497 0.1605 0.1483 0.0611 0.0055 266 GLU A CG 1922 C CD . GLU A 266 ? 0.3411 0.5168 0.1593 0.2230 0.0467 -0.0428 266 GLU A CD 1923 O OE1 . GLU A 266 ? 0.4314 0.6476 0.3307 0.3025 -0.0171 -0.2021 266 GLU A OE1 1924 O OE2 . GLU A 266 ? 0.3522 0.2935 0.2274 0.1246 0.0004 0.0173 266 GLU A OE2 1925 N N . ARG A 267 ? 0.1470 0.1620 0.1033 0.0170 0.0042 0.0129 267 ARG A N 1926 C CA . ARG A 267 ? 0.1786 0.1265 0.1009 0.0348 0.0032 -0.0048 267 ARG A CA 1927 C C . ARG A 267 ? 0.1619 0.1307 0.0914 0.0265 0.0040 0.0064 267 ARG A C 1928 O O . ARG A 267 ? 0.1787 0.1493 0.1114 0.0234 0.0151 0.0079 267 ARG A O 1929 C CB . ARG A 267 ? 0.1566 0.1381 0.1368 0.0157 0.0035 -0.0113 267 ARG A CB 1930 C CG . ARG A 267 ? 0.1805 0.1417 0.1247 0.0313 -0.0046 -0.0026 267 ARG A CG 1931 C CD . ARG A 267 ? 0.1608 0.1393 0.2819 0.0302 -0.0532 -0.0336 267 ARG A CD 1932 N NE . ARG A 267 ? 0.1604 0.1973 0.1979 0.0235 -0.0256 0.0241 267 ARG A NE 1933 C CZ . ARG A 267 ? 0.1597 0.1945 0.1501 0.0258 -0.0338 0.0463 267 ARG A CZ 1934 N NH1 . ARG A 267 ? 0.1719 0.2306 0.2021 0.0431 0.0018 0.0852 267 ARG A NH1 1935 N NH2 . ARG A 267 ? 0.1815 0.1977 0.2298 0.0201 -0.0887 0.0310 267 ARG A NH2 1936 N N . ASP A 268 ? 0.1736 0.1502 0.1083 0.0311 -0.0059 0.0176 268 ASP A N 1937 C CA . ASP A 268 ? 0.1814 0.1305 0.1267 0.0459 -0.0111 0.0086 268 ASP A CA 1938 C C . ASP A 268 ? 0.1622 0.1455 0.0810 0.0355 0.0001 0.0246 268 ASP A C 1939 O O . ASP A 268 ? 0.1679 0.1431 0.0963 0.0392 -0.0038 0.0199 268 ASP A O 1940 C CB . ASP A 268 ? 0.1712 0.1525 0.1566 0.0299 -0.0327 0.0394 268 ASP A CB 1941 C CG . ASP A 268 ? 0.3693 0.1650 0.1523 -0.0129 -0.0649 0.0415 268 ASP A CG 1942 O OD1 . ASP A 268 ? 0.5887 0.1705 0.2388 -0.0611 -0.0376 0.0744 268 ASP A OD1 1943 O OD2 . ASP A 268 ? 0.3866 0.1812 0.1822 0.0785 -0.0909 -0.0147 268 ASP A OD2 1944 N N . GLU A 269 ? 0.1906 0.1263 0.1066 0.0311 0.0061 0.0118 269 GLU A N 1945 C CA . GLU A 269 ? 0.1690 0.1541 0.1278 0.0257 -0.0033 -0.0012 269 GLU A CA 1946 C C . GLU A 269 ? 0.1736 0.1189 0.1012 0.0370 -0.0111 -0.0144 269 GLU A C 1947 O O . GLU A 269 ? 0.1964 0.1525 0.1084 0.0141 -0.0169 -0.0097 269 GLU A O 1948 C CB . GLU A 269 ? 0.2143 0.1627 0.1224 0.0324 0.0004 -0.0157 269 GLU A CB 1949 C CG . GLU A 269 ? 0.4044 0.2835 0.1033 0.0172 0.0236 0.0093 269 GLU A CG 1950 C CD . GLU A 269 ? 0.3826 0.3871 0.1655 -0.1159 0.0804 -0.0879 269 GLU A CD 1951 O OE1 . GLU A 269 ? 0.5019 0.6158 0.2831 0.1382 0.1152 -0.1321 269 GLU A OE1 1952 O OE2 . GLU A 269 ? 0.4475 0.7222 0.1421 -0.1551 0.0579 -0.0159 269 GLU A OE2 1953 N N . LEU A 270 ? 0.1483 0.1692 0.1104 0.0158 0.0060 -0.0059 270 LEU A N 1954 C CA . LEU A 270 ? 0.1789 0.1453 0.1141 0.0431 -0.0111 0.0065 270 LEU A CA 1955 C C . LEU A 270 ? 0.1355 0.1170 0.0868 0.0115 -0.0281 0.0027 270 LEU A C 1956 O O . LEU A 270 ? 0.1508 0.1339 0.1216 0.0191 -0.0225 -0.0154 270 LEU A O 1957 C CB . LEU A 270 ? 0.1273 0.1584 0.1618 0.0264 -0.0016 0.0389 270 LEU A CB 1958 C CG . LEU A 270 ? 0.2096 0.1635 0.1118 0.0682 -0.0121 0.0168 270 LEU A CG 1959 C CD1 . LEU A 270 ? 0.3888 0.1490 0.2115 0.0211 0.0017 0.0453 270 LEU A CD1 1960 C CD2 . LEU A 270 ? 0.2022 0.2950 0.1671 0.0567 -0.0337 0.0414 270 LEU A CD2 1961 N N . VAL A 271 ? 0.1625 0.1349 0.1123 0.0253 -0.0255 -0.0174 271 VAL A N 1962 C CA . VAL A 271 ? 0.1583 0.1197 0.0934 0.0102 -0.0154 -0.0055 271 VAL A CA 1963 C C . VAL A 271 ? 0.1605 0.0859 0.0830 0.0225 -0.0170 -0.0054 271 VAL A C 1964 O O . VAL A 271 ? 0.1628 0.1185 0.0757 0.0210 -0.0188 -0.0011 271 VAL A O 1965 C CB . VAL A 271 ? 0.1625 0.1168 0.1222 0.0094 -0.0382 -0.0057 271 VAL A CB 1966 C CG1 . VAL A 271 ? 0.2104 0.0964 0.1206 0.0381 -0.0309 0.0021 271 VAL A CG1 1967 C CG2 . VAL A 271 ? 0.2043 0.1488 0.1107 0.0206 -0.0608 -0.0236 271 VAL A CG2 1968 N N . ALA A 272 ? 0.1812 0.1126 0.0781 0.0099 -0.0250 -0.0058 272 ALA A N 1969 C CA . ALA A 272 ? 0.1807 0.1209 0.0814 0.0087 -0.0212 -0.0138 272 ALA A CA 1970 C C . ALA A 272 ? 0.1565 0.1149 0.0937 0.0167 -0.0408 -0.0135 272 ALA A C 1971 O O . ALA A 272 ? 0.1670 0.1293 0.1140 0.0148 -0.0476 -0.0048 272 ALA A O 1972 C CB . ALA A 272 ? 0.2007 0.1457 0.0847 0.0370 -0.0324 0.0124 272 ALA A CB 1973 N N . SER A 273 ? 0.1675 0.1251 0.1051 0.0218 -0.0263 -0.0039 273 SER A N 1974 C CA . SER A 273 ? 0.1781 0.1191 0.1147 0.0330 -0.0251 -0.0300 273 SER A CA 1975 C C . SER A 273 ? 0.1812 0.0911 0.0918 0.0339 -0.0402 -0.0078 273 SER A C 1976 O O . SER A 273 ? 0.2111 0.1225 0.1122 -0.0003 -0.0489 -0.0233 273 SER A O 1977 C CB . SER A 273 ? 0.2074 0.1490 0.1132 0.0577 -0.0250 -0.0272 273 SER A CB 1978 O OG . SER A 273 ? 0.2156 0.1860 0.1449 0.0567 0.0107 -0.0236 273 SER A OG 1979 N N . VAL A 274 ? 0.1604 0.1101 0.1043 0.0069 -0.0403 -0.0084 274 VAL A N 1980 C CA . VAL A 274 ? 0.2067 0.1120 0.0786 0.0299 -0.0459 -0.0194 274 VAL A CA 1981 C C . VAL A 274 ? 0.1851 0.1007 0.0497 0.0099 -0.0289 -0.0089 274 VAL A C 1982 O O . VAL A 274 ? 0.2018 0.1152 0.0845 0.0054 -0.0270 0.0113 274 VAL A O 1983 C CB . VAL A 274 ? 0.1964 0.1111 0.0931 -0.0050 -0.0515 0.0071 274 VAL A CB 1984 C CG1 . VAL A 274 ? 0.2267 0.1422 0.0752 -0.0031 -0.0492 -0.0206 274 VAL A CG1 1985 C CG2 . VAL A 274 ? 0.2072 0.1377 0.1291 0.0113 -0.0629 -0.0010 274 VAL A CG2 1986 N N . GLY A 275 ? 0.1699 0.1058 0.0747 0.0047 -0.0234 0.0000 275 GLY A N 1987 C CA . GLY A 275 ? 0.1803 0.1003 0.0941 0.0103 -0.0306 -0.0167 275 GLY A CA 1988 C C . GLY A 275 ? 0.1603 0.0836 0.0592 0.0000 -0.0177 0.0062 275 GLY A C 1989 O O . GLY A 275 ? 0.1697 0.1207 0.0860 0.0062 -0.0199 0.0145 275 GLY A O 1990 N N . GLN A 276 ? 0.1881 0.0897 0.0962 0.0107 -0.0261 -0.0132 276 GLN A N 1991 C CA . GLN A 276 ? 0.1723 0.0975 0.1060 0.0119 -0.0378 -0.0223 276 GLN A CA 1992 C C . GLN A 276 ? 0.1997 0.0748 0.1301 0.0181 -0.0586 -0.0087 276 GLN A C 1993 O O . GLN A 276 ? 0.1931 0.1213 0.1040 0.0083 -0.0446 -0.0054 276 GLN A O 1994 C CB . GLN A 276 ? 0.2063 0.1195 0.1093 0.0594 -0.0442 -0.0211 276 GLN A CB 1995 C CG . GLN A 276 ? 0.2238 0.1433 0.1145 0.0239 -0.0221 -0.0183 276 GLN A CG 1996 C CD . GLN A 276 ? 0.2099 0.2203 0.1721 -0.0460 0.0011 -0.0670 276 GLN A CD 1997 O OE1 . GLN A 276 ? 0.2724 0.3598 0.3019 -0.1437 0.0111 0.0013 276 GLN A OE1 1998 N NE2 . GLN A 276 ? 0.2088 0.2245 0.1299 0.0596 -0.0579 -0.0748 276 GLN A NE2 1999 N N . VAL A 277 ? 0.1994 0.0987 0.1062 0.0129 -0.0410 -0.0103 277 VAL A N 2000 C CA . VAL A 277 ? 0.2008 0.1263 0.1030 0.0170 -0.0585 -0.0018 277 VAL A CA 2001 C C . VAL A 277 ? 0.1828 0.0910 0.1143 0.0052 -0.0556 0.0087 277 VAL A C 2002 O O . VAL A 277 ? 0.2100 0.1146 0.1107 -0.0138 -0.0557 0.0090 277 VAL A O 2003 C CB . VAL A 277 ? 0.1867 0.1009 0.1405 0.0093 -0.0600 0.0002 277 VAL A CB 2004 C CG1 . VAL A 277 ? 0.2418 0.1436 0.1508 0.0214 -0.0704 0.0314 277 VAL A CG1 2005 C CG2 . VAL A 277 ? 0.2026 0.1206 0.1742 0.0241 -0.0517 -0.0204 277 VAL A CG2 2006 N N . ILE A 278 ? 0.1595 0.0989 0.1412 0.0065 -0.0616 0.0010 278 ILE A N 2007 C CA . ILE A 278 ? 0.1784 0.0994 0.1216 0.0038 -0.0574 -0.0051 278 ILE A CA 2008 C C . ILE A 278 ? 0.1534 0.1027 0.0880 -0.0027 -0.0276 -0.0124 278 ILE A C 2009 O O . ILE A 278 ? 0.1690 0.1216 0.1317 -0.0145 -0.0293 0.0080 278 ILE A O 2010 C CB . ILE A 278 ? 0.1663 0.1136 0.0847 -0.0241 -0.0244 -0.0031 278 ILE A CB 2011 C CG1 . ILE A 278 ? 0.1913 0.1204 0.0632 -0.0045 -0.0279 -0.0110 278 ILE A CG1 2012 C CG2 . ILE A 278 ? 0.1945 0.0937 0.1125 0.0012 -0.0253 0.0026 278 ILE A CG2 2013 C CD1 . ILE A 278 ? 0.1755 0.1238 0.0986 -0.0023 -0.0412 -0.0203 278 ILE A CD1 2014 N N . THR A 279 ? 0.1947 0.0945 0.1043 -0.0121 -0.0452 0.0060 279 THR A N 2015 C CA . THR A 279 ? 0.1793 0.1038 0.1073 -0.0022 -0.0439 0.0117 279 THR A CA 2016 C C . THR A 279 ? 0.1832 0.0989 0.0856 0.0097 -0.0526 0.0051 279 THR A C 2017 O O . THR A 279 ? 0.1888 0.1239 0.1595 -0.0111 -0.0529 0.0053 279 THR A O 2018 C CB . THR A 279 ? 0.1951 0.0860 0.0872 0.0130 -0.0412 -0.0195 279 THR A CB 2019 O OG1 . THR A 279 ? 0.2049 0.1000 0.1013 -0.0143 -0.0417 0.0111 279 THR A OG1 2020 C CG2 . THR A 279 ? 0.1778 0.1228 0.0892 -0.0041 -0.0307 -0.0058 279 THR A CG2 2021 N N . GLN A 280 ? 0.2009 0.1034 0.1171 0.0093 -0.0591 0.0116 280 GLN A N 2022 C CA . GLN A 280 ? 0.2470 0.1013 0.1133 0.0022 -0.0579 -0.0207 280 GLN A CA 2023 C C . GLN A 280 ? 0.2296 0.0993 0.1336 -0.0203 -0.0570 -0.0037 280 GLN A C 2024 O O . GLN A 280 ? 0.2573 0.1228 0.1588 -0.0500 -0.0840 -0.0003 280 GLN A O 2025 C CB A GLN A 280 ? 0.2877 0.1108 0.1407 0.0271 -0.0311 -0.0045 280 GLN A CB 2026 C CB B GLN A 280 ? 0.1923 0.0862 0.1869 -0.0143 -0.0392 0.0405 280 GLN A CB 2027 C CG A GLN A 280 ? 0.2615 0.1074 0.1279 0.0379 -0.0432 -0.0103 280 GLN A CG 2028 C CG B GLN A 280 ? 0.2428 0.1283 0.1961 -0.0541 0.0398 0.0803 280 GLN A CG 2029 C CD A GLN A 280 ? 0.2343 0.1130 0.1087 0.0144 -0.0161 -0.0147 280 GLN A CD 2030 C CD B GLN A 280 ? 0.3266 0.1102 0.1744 0.0274 0.0310 0.0438 280 GLN A CD 2031 O OE1 A GLN A 280 ? 0.2147 0.2313 0.1957 0.0518 -0.0648 0.0162 280 GLN A OE1 2032 O OE1 B GLN A 280 ? 0.3830 0.1486 0.0499 -0.1673 -0.0359 -0.0176 280 GLN A OE1 2033 N NE2 A GLN A 280 ? 0.3354 0.1034 0.1423 0.0016 -0.0502 -0.0171 280 GLN A NE2 2034 N NE2 B GLN A 280 ? 0.5275 0.1424 0.3717 -0.2082 0.0696 -0.1655 280 GLN A NE2 2035 N N . LEU A 281 ? 0.1834 0.0937 0.1321 -0.0255 -0.0374 0.0046 281 LEU A N 2036 C CA A LEU A 281 ? 0.2064 0.1191 0.1218 -0.0104 -0.0315 -0.0272 281 LEU A CA 2037 C CA B LEU A 281 ? 0.2120 0.1032 0.1384 -0.0095 -0.0017 -0.0590 281 LEU A CA 2038 C C . LEU A 281 ? 0.2029 0.1173 0.1489 -0.0134 -0.0130 0.0309 281 LEU A C 2039 O O . LEU A 281 ? 0.2007 0.1366 0.1908 -0.0292 -0.0287 0.0209 281 LEU A O 2040 C CB A LEU A 281 ? 0.2661 0.1091 0.1315 -0.0106 -0.0688 -0.0175 281 LEU A CB 2041 C CB B LEU A 281 ? 0.1819 0.1112 0.1342 -0.0242 0.0008 -0.0295 281 LEU A CB 2042 C CG A LEU A 281 ? 0.2803 0.1991 0.1237 -0.0255 -0.0830 0.0019 281 LEU A CG 2043 C CG B LEU A 281 ? 0.2896 0.2073 0.1437 -0.0596 -0.0175 0.0133 281 LEU A CG 2044 C CD1 A LEU A 281 ? 0.3335 0.2380 0.2804 -0.0802 0.0145 0.0570 281 LEU A CD1 2045 C CD1 B LEU A 281 ? 0.4177 0.3174 0.0902 -0.0619 0.0609 -0.1016 281 LEU A CD1 2046 C CD2 A LEU A 281 ? 0.3360 0.2687 0.1036 -0.0476 -0.1124 0.0122 281 LEU A CD2 2047 C CD2 B LEU A 281 ? 0.3149 0.2353 0.1933 -0.1071 0.0586 0.0152 281 LEU A CD2 2048 N N . ILE A 282 ? 0.1761 0.1201 0.1130 -0.0244 -0.0288 0.0059 282 ILE A N 2049 C CA . ILE A 282 ? 0.2227 0.1098 0.1640 -0.0026 -0.0670 0.0087 282 ILE A CA 2050 C C . ILE A 282 ? 0.1787 0.1337 0.1429 -0.0160 -0.0487 0.0369 282 ILE A C 2051 O O . ILE A 282 ? 0.1900 0.1945 0.2188 -0.0261 -0.0336 0.0485 282 ILE A O 2052 C CB . ILE A 282 ? 0.2034 0.1189 0.1484 -0.0204 -0.0314 0.0181 282 ILE A CB 2053 C CG1 . ILE A 282 ? 0.2181 0.1279 0.1556 -0.0089 -0.0311 -0.0184 282 ILE A CG1 2054 C CG2 . ILE A 282 ? 0.2484 0.1192 0.2056 0.0123 -0.0550 0.0254 282 ILE A CG2 2055 C CD1 . ILE A 282 ? 0.2250 0.2119 0.1509 -0.0051 -0.0436 0.0149 282 ILE A CD1 2056 N N . LEU A 283 ? 0.2229 0.1629 0.1702 -0.0017 -0.0518 -0.0166 283 LEU A N 2057 C CA . LEU A 283 ? 0.2171 0.1973 0.1888 0.0049 -0.0671 -0.0313 283 LEU A CA 2058 C C . LEU A 283 ? 0.2636 0.2177 0.2114 -0.0365 -0.0607 -0.0383 283 LEU A C 2059 O O . LEU A 283 ? 0.3040 0.2835 0.2365 -0.0841 -0.1012 0.0427 283 LEU A O 2060 C CB . LEU A 283 ? 0.2725 0.2016 0.1736 0.0350 -0.0683 0.0014 283 LEU A CB 2061 C CG . LEU A 283 ? 0.2798 0.1949 0.1424 0.0556 -0.0962 0.0130 283 LEU A CG 2062 C CD1 . LEU A 283 ? 0.3000 0.2819 0.1234 0.0066 -0.1022 -0.0026 283 LEU A CD1 2063 C CD2 . LEU A 283 ? 0.3392 0.2651 0.2500 0.1176 -0.1128 0.0349 283 LEU A CD2 2064 N N . SER A 284 ? 0.1914 0.2202 0.2063 -0.0711 -0.0283 -0.0172 284 SER A N 2065 C CA . SER A 284 ? 0.2418 0.1860 0.2530 -0.0671 0.0081 -0.0540 284 SER A CA 2066 C C . SER A 284 ? 0.2705 0.2462 0.3162 -0.0747 0.0619 0.0065 284 SER A C 2067 O O . SER A 284 ? 0.3027 0.3993 0.4802 -0.1834 0.0103 0.0599 284 SER A O 2068 C CB . SER A 284 ? 0.3106 0.2168 0.2228 -0.0296 0.0179 -0.0289 284 SER A CB 2069 O OG . SER A 284 ? 0.3379 0.2224 0.2224 -0.1169 0.0120 0.0014 284 SER A OG 2070 N N . THR A 285 ? 0.3237 0.3356 0.3950 0.0151 0.1006 -0.0552 285 THR A N 2071 C CA . THR A 285 ? 0.2779 0.5293 0.3997 -0.0492 0.0736 -0.1503 285 THR A CA 2072 C C . THR A 285 ? 0.1564 0.6606 0.5013 -0.1000 0.0113 -0.2091 285 THR A C 2073 O O . THR A 285 ? 0.2359 0.7100 0.7035 -0.0350 0.1710 -0.1498 285 THR A O 2074 C CB . THR A 285 ? 0.3336 0.8516 0.2788 -0.1055 0.0615 -0.1509 285 THR A CB 2075 N N . SER B 19 ? 1.0491 0.2881 0.3992 0.0791 0.1391 0.1414 19 SER B N 2076 C CA . SER B 19 ? 0.7072 0.2878 0.4879 -0.0410 0.1706 0.1145 19 SER B CA 2077 C C . SER B 19 ? 0.4684 0.2558 0.3587 -0.0343 0.0819 0.0699 19 SER B C 2078 O O . SER B 19 ? 0.2743 0.2867 0.4258 -0.0870 0.0854 0.0091 19 SER B O 2079 C CB . SER B 19 ? 0.8890 0.2738 0.7588 -0.0670 -0.0737 -0.0746 19 SER B CB 2080 N N . GLU B 20 ? 0.3907 0.2243 0.2712 -0.1093 -0.0168 -0.0130 20 GLU B N 2081 C CA . GLU B 20 ? 0.2671 0.2435 0.2404 -0.0770 -0.0408 0.0236 20 GLU B CA 2082 C C . GLU B 20 ? 0.2555 0.1912 0.2164 -0.0584 -0.0304 0.0502 20 GLU B C 2083 O O . GLU B 20 ? 0.2133 0.1872 0.2096 -0.0354 0.0019 0.0300 20 GLU B O 2084 C CB . GLU B 20 ? 0.2718 0.2959 0.2430 -0.0686 -0.0397 -0.0018 20 GLU B CB 2085 C CG . GLU B 20 ? 0.4350 0.5810 0.4625 0.1259 0.0473 -0.0465 20 GLU B CG 2086 N N . LYS B 21 ? 0.2981 0.1784 0.2705 -0.0606 -0.0672 0.0578 21 LYS B N 2087 C CA . LYS B 21 ? 0.2528 0.1749 0.2481 -0.0626 -0.0355 0.0736 21 LYS B CA 2088 C C . LYS B 21 ? 0.2033 0.2704 0.2342 -0.1005 -0.0392 0.0691 21 LYS B C 2089 O O . LYS B 21 ? 0.2136 0.2165 0.2622 -0.0760 0.0023 0.0546 21 LYS B O 2090 C CB . LYS B 21 ? 0.3321 0.2594 0.3071 0.0037 -0.0709 0.0987 21 LYS B CB 2091 C CG . LYS B 21 ? 0.3937 0.3820 0.5408 0.0907 0.0628 0.0646 21 LYS B CG 2092 N N . LEU B 22 ? 0.2058 0.2227 0.3367 -0.0744 0.0039 0.0432 22 LEU B N 2093 C CA . LEU B 22 ? 0.2060 0.2337 0.2808 -0.0808 -0.0130 0.0745 22 LEU B CA 2094 C C . LEU B 22 ? 0.2293 0.2324 0.2052 -0.0729 0.0195 0.0685 22 LEU B C 2095 O O . LEU B 22 ? 0.2379 0.2353 0.2523 -0.1079 0.0066 0.0487 22 LEU B O 2096 C CB . LEU B 22 ? 0.2630 0.2431 0.3237 -0.0965 0.0135 0.0945 22 LEU B CB 2097 C CG . LEU B 22 ? 0.1975 0.2763 0.3777 -0.0254 0.0271 0.1361 22 LEU B CG 2098 C CD1 . LEU B 22 ? 0.3056 0.3761 0.2928 -0.1064 0.0557 0.1276 22 LEU B CD1 2099 C CD2 . LEU B 22 ? 0.3827 0.3462 0.3370 -0.1633 0.0826 0.0622 22 LEU B CD2 2100 N N . THR B 23 ? 0.2357 0.2470 0.2250 -0.0769 0.0008 0.0776 23 THR B N 2101 C CA . THR B 23 ? 0.1550 0.2562 0.2253 -0.0748 -0.0039 0.0497 23 THR B CA 2102 C C . THR B 23 ? 0.1599 0.2356 0.1719 -0.0720 0.0275 0.0277 23 THR B C 2103 O O . THR B 23 ? 0.1794 0.2327 0.1766 -0.0341 -0.0022 0.0368 23 THR B O 2104 C CB . THR B 23 ? 0.1977 0.2090 0.2325 -0.0718 -0.0169 0.0337 23 THR B CB 2105 O OG1 . THR B 23 ? 0.1814 0.3041 0.3161 -0.0953 -0.0288 0.0210 23 THR B OG1 2106 C CG2 . THR B 23 ? 0.1382 0.2917 0.3627 -0.0148 -0.0670 0.0836 23 THR B CG2 2107 N N . PHE B 24 ? 0.1494 0.2082 0.1738 -0.0662 -0.0039 0.0258 24 PHE B N 2108 C CA . PHE B 24 ? 0.1676 0.2769 0.1228 -0.1042 0.0168 0.0415 24 PHE B CA 2109 C C . PHE B 24 ? 0.1385 0.2288 0.1263 -0.0795 0.0056 0.0427 24 PHE B C 2110 O O . PHE B 24 ? 0.1619 0.2184 0.1604 -0.0766 0.0087 0.0449 24 PHE B O 2111 C CB . PHE B 24 ? 0.1924 0.2586 0.1439 -0.1009 0.0249 0.0115 24 PHE B CB 2112 C CG . PHE B 24 ? 0.1566 0.1826 0.1521 -0.0624 -0.0049 0.0198 24 PHE B CG 2113 C CD1 . PHE B 24 ? 0.2094 0.1969 0.1645 -0.0259 -0.0402 0.0065 24 PHE B CD1 2114 C CD2 . PHE B 24 ? 0.1963 0.2674 0.1527 -0.1014 -0.0244 0.0593 24 PHE B CD2 2115 C CE1 . PHE B 24 ? 0.1487 0.2424 0.2633 0.0171 -0.0570 0.0182 24 PHE B CE1 2116 C CE2 . PHE B 24 ? 0.2004 0.2629 0.1707 -0.0920 0.0053 0.0645 24 PHE B CE2 2117 C CZ . PHE B 24 ? 0.1970 0.2394 0.2175 -0.0743 -0.0225 -0.0274 24 PHE B CZ 2118 N N . LYS B 25 ? 0.1747 0.2213 0.1423 -0.0625 0.0092 0.0448 25 LYS B N 2119 C CA . LYS B 25 ? 0.2001 0.2393 0.1255 -0.0459 0.0170 0.0618 25 LYS B CA 2120 C C . LYS B 25 ? 0.1814 0.2133 0.1506 -0.0831 0.0187 0.0435 25 LYS B C 2121 O O . LYS B 25 ? 0.1893 0.2192 0.1724 -0.0552 -0.0070 0.0349 25 LYS B O 2122 C CB . LYS B 25 ? 0.1932 0.2275 0.1649 -0.0715 0.0072 0.0684 25 LYS B CB 2123 C CG . LYS B 25 ? 0.2212 0.2521 0.1798 -0.0554 -0.0250 0.0979 25 LYS B CG 2124 C CD . LYS B 25 ? 0.2098 0.2452 0.2014 -0.0280 -0.0140 0.0827 25 LYS B CD 2125 C CE . LYS B 25 ? 0.3268 0.3342 0.2118 -0.0519 -0.0517 0.1341 25 LYS B CE 2126 N NZ . LYS B 25 ? 0.4071 0.6857 0.2781 -0.2449 0.0183 -0.0804 25 LYS B NZ 2127 N N . THR B 26 ? 0.1746 0.2310 0.1256 -0.0672 -0.0001 0.0577 26 THR B N 2128 C CA . THR B 26 ? 0.1923 0.2665 0.1721 -0.0757 0.0406 0.0506 26 THR B CA 2129 C C . THR B 26 ? 0.1567 0.2646 0.1599 -0.0478 0.0108 0.0423 26 THR B C 2130 O O . THR B 26 ? 0.1686 0.2782 0.1548 -0.0392 0.0020 0.0365 26 THR B O 2131 C CB . THR B 26 ? 0.1993 0.3308 0.3141 -0.1262 0.0955 0.0457 26 THR B CB 2132 O OG1 . THR B 26 ? 0.2631 0.3182 0.2666 -0.1404 0.0682 0.0189 26 THR B OG1 2133 C CG2 . THR B 26 ? 0.2159 0.3254 0.5202 -0.1484 0.1252 -0.0594 26 THR B CG2 2134 N N . ASP B 27 ? 0.2011 0.2563 0.1604 -0.0696 0.0210 0.0340 27 ASP B N 2135 C CA . ASP B 27 ? 0.1580 0.2590 0.1517 -0.0695 0.0070 0.0350 27 ASP B CA 2136 C C . ASP B 27 ? 0.1700 0.2627 0.1364 -0.0729 0.0065 0.0215 27 ASP B C 2137 O O . ASP B 27 ? 0.1850 0.2585 0.1488 -0.0617 -0.0209 0.0298 27 ASP B O 2138 C CB . ASP B 27 ? 0.2097 0.2861 0.1657 -0.0857 -0.0317 0.0315 27 ASP B CB 2139 C CG . ASP B 27 ? 0.2237 0.3424 0.1905 -0.1138 -0.0289 0.0099 27 ASP B CG 2140 O OD1 . ASP B 27 ? 0.2307 0.4143 0.2346 -0.1225 -0.0077 0.0484 27 ASP B OD1 2141 O OD2 . ASP B 27 ? 0.2497 0.3038 0.2075 -0.0415 -0.0687 -0.0009 27 ASP B OD2 2142 N N . LEU B 28 ? 0.1679 0.2698 0.1375 -0.0748 -0.0085 0.0051 28 LEU B N 2143 C CA . LEU B 28 ? 0.1820 0.2240 0.1117 -0.0637 -0.0199 0.0388 28 LEU B CA 2144 C C . LEU B 28 ? 0.1569 0.2865 0.1211 -0.0965 0.0020 0.0187 28 LEU B C 2145 O O . LEU B 28 ? 0.2194 0.3054 0.1164 -0.1149 -0.0060 0.0080 28 LEU B O 2146 C CB . LEU B 28 ? 0.1605 0.2683 0.0981 -0.0733 -0.0072 0.0396 28 LEU B CB 2147 C CG . LEU B 28 ? 0.1757 0.2494 0.1076 -0.0817 -0.0123 0.0311 28 LEU B CG 2148 C CD1 . LEU B 28 ? 0.1968 0.2144 0.1343 -0.0705 -0.0150 -0.0105 28 LEU B CD1 2149 C CD2 . LEU B 28 ? 0.2063 0.2243 0.0887 -0.0678 -0.0122 0.0104 28 LEU B CD2 2150 N N . GLU B 29 ? 0.2165 0.2872 0.0978 -0.0622 -0.0124 0.0407 29 GLU B N 2151 C CA . GLU B 29 ? 0.1919 0.2647 0.1100 -0.0817 -0.0021 0.0097 29 GLU B CA 2152 C C . GLU B 29 ? 0.1851 0.2847 0.1308 -0.0770 0.0138 0.0446 29 GLU B C 2153 O O . GLU B 29 ? 0.1782 0.2884 0.1184 -0.0082 -0.0009 0.0465 29 GLU B O 2154 C CB . GLU B 29 ? 0.2326 0.3073 0.1119 -0.0493 -0.0071 0.0445 29 GLU B CB 2155 C CG . GLU B 29 ? 0.2472 0.3149 0.1991 -0.0323 -0.0122 0.0364 29 GLU B CG 2156 C CD . GLU B 29 ? 0.3094 0.2594 0.2012 -0.0219 0.0116 -0.0238 29 GLU B CD 2157 O OE1 . GLU B 29 ? 0.4011 0.3728 0.2194 -0.0024 0.0876 0.0923 29 GLU B OE1 2158 O OE2 . GLU B 29 ? 0.3346 0.3713 0.2185 0.0418 -0.0054 0.0373 29 GLU B OE2 2159 N N . LYS B 30 ? 0.1791 0.2803 0.1788 -0.0960 0.0042 0.0424 30 LYS B N 2160 C CA . LYS B 30 ? 0.2213 0.2992 0.1280 -0.0591 -0.0042 0.0623 30 LYS B CA 2161 C C . LYS B 30 ? 0.1426 0.2953 0.1115 -0.0570 -0.0159 0.0329 30 LYS B C 2162 O O . LYS B 30 ? 0.1687 0.3367 0.1772 -0.0682 0.0200 -0.0156 30 LYS B O 2163 C CB . LYS B 30 ? 0.2303 0.3150 0.3152 -0.0627 -0.0735 -0.0378 30 LYS B CB 2164 C CG . LYS B 30 ? 0.2592 0.3441 0.5911 -0.0816 -0.0894 0.0269 30 LYS B CG 2165 C CD . LYS B 30 ? 0.2203 0.4279 0.7499 -0.0802 -0.1463 0.2033 30 LYS B CD 2166 C CE . LYS B 30 ? 0.3417 0.5874 0.6940 -0.1739 -0.1267 0.3828 30 LYS B CE 2167 N NZ . LYS B 30 ? 0.4767 0.7581 0.6550 -0.3572 -0.0489 0.0797 30 LYS B NZ 2168 N N . LEU B 31 ? 0.1503 0.2421 0.1373 -0.0449 -0.0099 0.0230 31 LEU B N 2169 C CA . LEU B 31 ? 0.1569 0.2494 0.1337 -0.0406 0.0094 0.0336 31 LEU B CA 2170 C C . LEU B 31 ? 0.1601 0.2593 0.1301 -0.0792 0.0127 0.0547 31 LEU B C 2171 O O . LEU B 31 ? 0.1695 0.2761 0.1477 -0.0490 0.0012 0.0233 31 LEU B O 2172 C CB . LEU B 31 ? 0.1954 0.3377 0.1340 -0.0512 0.0266 0.0295 31 LEU B CB 2173 C CG . LEU B 31 ? 0.3833 0.5673 0.0998 0.1699 0.0024 0.0336 31 LEU B CG 2174 C CD1 . LEU B 31 ? 0.2281 0.3252 0.1722 -0.0537 -0.0125 0.0153 31 LEU B CD1 2175 C CD2 . LEU B 31 ? 0.2784 0.4435 0.1369 -0.0116 0.0500 0.0234 31 LEU B CD2 2176 N N . GLU B 32 ? 0.1894 0.2687 0.0941 -0.0509 0.0005 0.0096 32 GLU B N 2177 C CA . GLU B 32 ? 0.1723 0.2868 0.0839 -0.0706 0.0128 0.0169 32 GLU B CA 2178 C C . GLU B 32 ? 0.1828 0.3108 0.0946 -0.0653 0.0090 0.0025 32 GLU B C 2179 O O . GLU B 32 ? 0.1594 0.3181 0.1277 -0.0233 -0.0226 -0.0218 32 GLU B O 2180 C CB . GLU B 32 ? 0.1760 0.3284 0.1138 -0.0453 -0.0098 0.0165 32 GLU B CB 2181 C CG . GLU B 32 ? 0.2005 0.2373 0.1101 -0.0619 0.0006 0.0057 32 GLU B CG 2182 C CD . GLU B 32 ? 0.1949 0.2841 0.1728 -0.0482 0.0320 0.0793 32 GLU B CD 2183 O OE1 . GLU B 32 ? 0.2691 0.3700 0.5125 -0.0143 0.1547 0.2526 32 GLU B OE1 2184 O OE2 . GLU B 32 ? 0.2015 0.2294 0.1738 -0.0566 0.0351 0.0339 32 GLU B OE2 2185 N N . ARG B 33 ? 0.1822 0.2868 0.1194 -0.0316 0.0287 0.0545 33 ARG B N 2186 C CA . ARG B 33 ? 0.2319 0.3359 0.1507 -0.0378 0.0597 0.0338 33 ARG B CA 2187 C C . ARG B 33 ? 0.1826 0.3269 0.1827 -0.0466 0.0215 -0.0214 33 ARG B C 2188 O O . ARG B 33 ? 0.2548 0.3969 0.2058 -0.0081 0.0190 -0.0713 33 ARG B O 2189 C CB . ARG B 33 ? 0.2890 0.3536 0.1469 -0.0598 0.1194 0.0036 33 ARG B CB 2190 C CG . ARG B 33 ? 0.3850 0.3236 0.1619 -0.1153 0.0052 0.0038 33 ARG B CG 2191 C CD . ARG B 33 ? 0.3918 0.4334 0.1496 -0.0912 0.0246 0.0811 33 ARG B CD 2192 N NE . ARG B 33 ? 0.3002 0.3382 0.2510 -0.0553 0.0120 0.0889 33 ARG B NE 2193 C CZ . ARG B 33 ? 0.3051 0.3261 0.2916 -0.1002 0.0246 0.0770 33 ARG B CZ 2194 N NH1 . ARG B 33 ? 0.2904 0.3550 0.3602 -0.0867 0.0768 0.0277 33 ARG B NH1 2195 N NH2 . ARG B 33 ? 0.4007 0.4234 0.2046 -0.1202 -0.0030 0.1099 33 ARG B NH2 2196 N N . GLU B 34 ? 0.1810 0.2971 0.1878 -0.0552 0.0192 -0.0008 34 GLU B N 2197 C CA . GLU B 34 ? 0.1765 0.3244 0.2651 -0.0284 0.0274 0.0048 34 GLU B CA 2198 C C . GLU B 34 ? 0.1987 0.2856 0.2772 -0.0069 0.0552 -0.0056 34 GLU B C 2199 O O . GLU B 34 ? 0.2784 0.2996 0.4003 0.0413 0.1010 0.0270 34 GLU B O 2200 C CB . GLU B 34 ? 0.2580 0.2557 0.2372 0.0129 0.0033 -0.0046 34 GLU B CB 2201 C CG . GLU B 34 ? 0.2530 0.3402 0.3526 -0.0517 -0.0685 0.0261 34 GLU B CG 2202 C CD . GLU B 34 ? 0.4356 0.2964 0.4748 -0.0465 -0.2316 0.0556 34 GLU B CD 2203 O OE1 . GLU B 34 ? 0.6401 0.6418 0.4595 -0.0997 -0.2760 0.1543 34 GLU B OE1 2204 O OE2 . GLU B 34 ? 0.5940 0.4871 0.6958 -0.2296 -0.3432 0.0685 34 GLU B OE2 2205 N N . LYS B 35 ? 0.1521 0.2832 0.1929 -0.0146 -0.0194 0.0138 35 LYS B N 2206 C CA . LYS B 35 ? 0.1859 0.3118 0.1766 -0.0375 0.0073 -0.0084 35 LYS B CA 2207 C C . LYS B 35 ? 0.2538 0.3335 0.1553 -0.0914 -0.0128 -0.0276 35 LYS B C 2208 O O . LYS B 35 ? 0.2278 0.3455 0.2044 -0.0805 0.0082 -0.0200 35 LYS B O 2209 C CB . LYS B 35 ? 0.2360 0.3368 0.1416 -0.0398 -0.0095 0.0115 35 LYS B CB 2210 C CG . LYS B 35 ? 0.2005 0.3624 0.1802 0.0050 -0.0197 -0.0011 35 LYS B CG 2211 C CD . LYS B 35 ? 0.3509 0.4187 0.1468 -0.0796 -0.0626 -0.0507 35 LYS B CD 2212 C CE . LYS B 35 ? 0.2157 0.2875 0.2158 0.0007 -0.0372 -0.0503 35 LYS B CE 2213 N NZ . LYS B 35 ? 0.1958 0.4970 0.3398 -0.0441 -0.0146 0.1016 35 LYS B NZ 2214 N N . ALA B 36 ? 0.1763 0.3200 0.1452 -0.0258 0.0260 -0.0392 36 ALA B N 2215 C CA . ALA B 36 ? 0.1982 0.3159 0.1438 -0.0219 0.0138 -0.0617 36 ALA B CA 2216 C C . ALA B 36 ? 0.1885 0.2644 0.1960 -0.0416 0.0129 -0.0729 36 ALA B C 2217 O O . ALA B 36 ? 0.2496 0.3019 0.2327 -0.1120 0.0639 -0.0722 36 ALA B O 2218 C CB . ALA B 36 ? 0.2398 0.3514 0.2022 -0.0288 0.0235 -0.1098 36 ALA B CB 2219 N N . ALA B 37 ? 0.2372 0.2456 0.1904 -0.0521 0.0725 -0.0518 37 ALA B N 2220 C CA . ALA B 37 ? 0.1905 0.2130 0.1281 -0.0708 0.0352 -0.0079 37 ALA B CA 2221 C C . ALA B 37 ? 0.1914 0.2101 0.1345 -0.0687 0.0296 -0.0317 37 ALA B C 2222 O O . ALA B 37 ? 0.1780 0.2104 0.1828 -0.0363 0.0499 0.0036 37 ALA B O 2223 C CB . ALA B 37 ? 0.1730 0.2858 0.1546 -0.0543 -0.0096 -0.0175 37 ALA B CB 2224 N N . GLN B 38 ? 0.2242 0.1907 0.1337 -0.0654 0.0797 -0.0097 38 GLN B N 2225 C CA . GLN B 38 ? 0.2046 0.2027 0.1127 -0.0479 0.0210 -0.0091 38 GLN B CA 2226 C C . GLN B 38 ? 0.1958 0.1696 0.1162 -0.0481 0.0201 -0.0137 38 GLN B C 2227 O O . GLN B 38 ? 0.2038 0.1817 0.1237 -0.0618 0.0196 0.0004 38 GLN B O 2228 C CB . GLN B 38 ? 0.2057 0.3179 0.1239 -0.0482 0.0101 -0.0291 38 GLN B CB 2229 C CG . GLN B 38 ? 0.3897 0.5191 0.1060 0.0094 -0.0072 0.0142 38 GLN B CG 2230 C CD . GLN B 38 ? 0.4895 0.7066 0.1747 0.1321 0.0359 0.1201 38 GLN B CD 2231 O OE1 . GLN B 38 ? 0.9193 0.7687 0.6795 -0.0452 -0.1486 0.4204 38 GLN B OE1 2232 N NE2 . GLN B 38 ? 0.4058 0.9663 0.6073 0.3119 0.1155 0.1187 38 GLN B NE2 2233 N N . ILE B 39 ? 0.1531 0.1719 0.0977 -0.0495 0.0151 -0.0019 39 ILE B N 2234 C CA . ILE B 39 ? 0.1559 0.1609 0.1030 -0.0433 0.0163 -0.0053 39 ILE B CA 2235 C C . ILE B 39 ? 0.1594 0.1593 0.1159 -0.0499 0.0095 -0.0231 39 ILE B C 2236 O O . ILE B 39 ? 0.1685 0.1747 0.1533 -0.0297 0.0208 0.0276 39 ILE B O 2237 C CB . ILE B 39 ? 0.1804 0.1585 0.1101 -0.0409 -0.0117 0.0092 39 ILE B CB 2238 C CG1 . ILE B 39 ? 0.1786 0.1731 0.1722 -0.0304 0.0239 0.0229 39 ILE B CG1 2239 C CG2 . ILE B 39 ? 0.2347 0.2052 0.1185 -0.0559 -0.0131 -0.0179 39 ILE B CG2 2240 C CD1 . ILE B 39 ? 0.2001 0.1963 0.1618 -0.0009 -0.0123 -0.0192 39 ILE B CD1 2241 N N . GLY B 40 ? 0.1415 0.1559 0.0912 -0.0293 -0.0038 0.0075 40 GLY B N 2242 C CA . GLY B 40 ? 0.1591 0.1476 0.0893 -0.0413 -0.0011 -0.0031 40 GLY B CA 2243 C C . GLY B 40 ? 0.1566 0.1365 0.0845 -0.0472 0.0114 0.0109 40 GLY B C 2244 O O . GLY B 40 ? 0.2012 0.1337 0.0985 -0.0588 0.0012 0.0132 40 GLY B O 2245 N N . VAL B 41 ? 0.1334 0.1262 0.0759 -0.0346 -0.0038 0.0160 41 VAL B N 2246 C CA . VAL B 41 ? 0.1435 0.1127 0.0756 -0.0231 -0.0159 0.0220 41 VAL B CA 2247 C C . VAL B 41 ? 0.1329 0.1151 0.0730 -0.0305 -0.0113 0.0160 41 VAL B C 2248 O O . VAL B 41 ? 0.1526 0.1215 0.0942 -0.0215 -0.0150 0.0344 41 VAL B O 2249 C CB . VAL B 41 ? 0.1378 0.1665 0.0866 -0.0127 -0.0126 0.0019 41 VAL B CB 2250 C CG1 . VAL B 41 ? 0.1495 0.1988 0.0896 -0.0499 -0.0251 -0.0016 41 VAL B CG1 2251 C CG2 . VAL B 41 ? 0.1487 0.1642 0.1631 -0.0101 -0.0028 -0.0014 41 VAL B CG2 2252 N N . ALA B 42 ? 0.1317 0.1135 0.0850 -0.0187 -0.0084 0.0261 42 ALA B N 2253 C CA . ALA B 42 ? 0.1089 0.1066 0.0901 -0.0299 -0.0116 0.0242 42 ALA B CA 2254 C C . ALA B 42 ? 0.1326 0.0982 0.0910 -0.0256 -0.0145 0.0199 42 ALA B C 2255 O O . ALA B 42 ? 0.1618 0.1214 0.0786 -0.0436 -0.0179 0.0227 42 ALA B O 2256 C CB . ALA B 42 ? 0.1123 0.1401 0.1091 -0.0133 -0.0185 0.0318 42 ALA B CB 2257 N N . ILE B 43 ? 0.1627 0.0932 0.0883 -0.0308 -0.0117 0.0212 43 ILE B N 2258 C CA . ILE B 43 ? 0.1368 0.1047 0.0856 -0.0239 -0.0041 0.0198 43 ILE B CA 2259 C C . ILE B 43 ? 0.1484 0.0966 0.0879 -0.0193 -0.0180 0.0186 43 ILE B C 2260 O O . ILE B 43 ? 0.1594 0.0988 0.1180 -0.0223 -0.0119 0.0231 43 ILE B O 2261 C CB . ILE B 43 ? 0.1359 0.1263 0.1159 -0.0118 -0.0153 0.0036 43 ILE B CB 2262 C CG1 . ILE B 43 ? 0.1751 0.1313 0.1145 0.0116 -0.0164 0.0154 43 ILE B CG1 2263 C CG2 . ILE B 43 ? 0.1715 0.1212 0.1190 -0.0067 -0.0423 -0.0049 43 ILE B CG2 2264 C CD1 . ILE B 43 ? 0.1739 0.3180 0.2670 0.0872 -0.0972 -0.0079 43 ILE B CD1 2265 N N . VAL B 44 ? 0.1432 0.0767 0.1025 -0.0210 -0.0204 0.0134 44 VAL B N 2266 C CA . VAL B 44 ? 0.1375 0.0917 0.1148 -0.0088 -0.0165 0.0187 44 VAL B CA 2267 C C . VAL B 44 ? 0.1317 0.0964 0.1162 -0.0021 0.0039 0.0153 44 VAL B C 2268 O O . VAL B 44 ? 0.1534 0.0994 0.1222 -0.0121 -0.0303 0.0228 44 VAL B O 2269 C CB . VAL B 44 ? 0.1219 0.1195 0.1227 -0.0209 -0.0073 0.0346 44 VAL B CB 2270 C CG1 . VAL B 44 ? 0.1272 0.1458 0.1213 -0.0336 -0.0138 0.0183 44 VAL B CG1 2271 C CG2 . VAL B 44 ? 0.1592 0.1186 0.1471 -0.0340 0.0303 0.0117 44 VAL B CG2 2272 N N . ASP B 45 ? 0.1836 0.0863 0.1207 -0.0113 -0.0259 0.0087 45 ASP B N 2273 C CA . ASP B 45 ? 0.1857 0.0869 0.1282 -0.0182 -0.0100 0.0102 45 ASP B CA 2274 C C . ASP B 45 ? 0.1561 0.0756 0.1389 0.0052 -0.0235 -0.0014 45 ASP B C 2275 O O . ASP B 45 ? 0.1843 0.1051 0.1484 -0.0068 -0.0329 -0.0009 45 ASP B O 2276 C CB . ASP B 45 ? 0.1647 0.0887 0.1711 -0.0099 -0.0254 -0.0132 45 ASP B CB 2277 C CG . ASP B 45 ? 0.1900 0.0928 0.1681 0.0023 -0.0395 -0.0015 45 ASP B CG 2278 O OD1 . ASP B 45 ? 0.1822 0.1166 0.2146 -0.0064 -0.0330 0.0283 45 ASP B OD1 2279 O OD2 . ASP B 45 ? 0.2311 0.0958 0.4112 -0.0030 -0.0837 -0.0035 45 ASP B OD2 2280 N N . PRO B 46 ? 0.1761 0.0983 0.1396 -0.0065 -0.0116 0.0043 46 PRO B N 2281 C CA . PRO B 46 ? 0.1906 0.1176 0.1308 -0.0308 -0.0147 0.0211 46 PRO B CA 2282 C C . PRO B 46 ? 0.1787 0.1462 0.1428 -0.0227 -0.0154 0.0114 46 PRO B C 2283 O O . PRO B 46 ? 0.1733 0.1796 0.1883 -0.0266 0.0060 0.0218 46 PRO B O 2284 C CB . PRO B 46 ? 0.2163 0.1880 0.1269 -0.0453 -0.0121 0.0001 46 PRO B CB 2285 C CG . PRO B 46 ? 0.2223 0.2021 0.1386 -0.0656 -0.0227 0.0027 46 PRO B CG 2286 C CD . PRO B 46 ? 0.1993 0.1520 0.1413 -0.0288 -0.0220 0.0004 46 PRO B CD 2287 N N . GLN B 47 ? 0.1558 0.1061 0.2127 -0.0018 -0.0282 -0.0045 47 GLN B N 2288 C CA . GLN B 47 ? 0.1631 0.1480 0.2255 0.0157 -0.0139 0.0236 47 GLN B CA 2289 C C . GLN B 47 ? 0.2004 0.1616 0.2208 0.0004 -0.0342 0.0243 47 GLN B C 2290 O O . GLN B 47 ? 0.1771 0.2477 0.2127 0.0445 0.0035 0.0304 47 GLN B O 2291 C CB . GLN B 47 ? 0.2669 0.1490 0.3229 0.0660 -0.0721 -0.0185 47 GLN B CB 2292 C CG . GLN B 47 ? 0.3751 0.2154 0.3744 0.0949 -0.0221 -0.0673 47 GLN B CG 2293 C CD . GLN B 47 ? 0.5575 0.2139 0.3215 0.1131 -0.0995 -0.1393 47 GLN B CD 2294 O OE1 . GLN B 47 ? 0.6365 0.3205 0.6120 -0.0327 -0.3526 -0.0962 47 GLN B OE1 2295 N NE2 . GLN B 47 ? 0.7542 0.3948 0.3964 0.3126 0.0881 0.0092 47 GLN B NE2 2296 N N . GLY B 48 ? 0.1585 0.1821 0.1593 -0.0108 -0.0428 0.0309 48 GLY B N 2297 C CA . GLY B 48 ? 0.1873 0.1640 0.1633 -0.0406 -0.0538 0.0313 48 GLY B CA 2298 C C . GLY B 48 ? 0.1629 0.1125 0.1676 0.0037 -0.0244 0.0158 48 GLY B C 2299 O O . GLY B 48 ? 0.1758 0.1751 0.1627 -0.0319 -0.0536 0.0370 48 GLY B O 2300 N N . GLU B 49 ? 0.1703 0.1167 0.1526 -0.0009 -0.0179 0.0164 49 GLU B N 2301 C CA . GLU B 49 ? 0.1873 0.1073 0.2220 -0.0027 0.0039 0.0280 49 GLU B CA 2302 C C . GLU B 49 ? 0.1600 0.0856 0.1619 -0.0159 -0.0227 0.0338 49 GLU B C 2303 O O . GLU B 49 ? 0.1954 0.1026 0.1499 -0.0083 -0.0272 0.0397 49 GLU B O 2304 C CB . GLU B 49 ? 0.2575 0.1043 0.2777 -0.0253 0.0475 -0.0104 49 GLU B CB 2305 C CG . GLU B 49 ? 0.3001 0.1794 0.4148 0.0361 0.0215 -0.0630 49 GLU B CG 2306 C CD . GLU B 49 ? 0.4157 0.2889 0.4674 0.1558 0.0091 -0.0262 49 GLU B CD 2307 O OE1 . GLU B 49 ? 0.3880 0.2082 0.5711 0.1781 -0.0021 0.1236 49 GLU B OE1 2308 O OE2 . GLU B 49 ? 0.4233 0.4951 0.6316 0.2377 0.0377 0.3097 49 GLU B OE2 2309 N N . ILE B 50 ? 0.1645 0.1230 0.1635 -0.0119 -0.0234 0.0651 50 ILE B N 2310 C CA . ILE B 50 ? 0.1615 0.1144 0.1568 -0.0381 -0.0191 0.0429 50 ILE B CA 2311 C C . ILE B 50 ? 0.1553 0.1033 0.1660 -0.0378 -0.0183 0.0302 50 ILE B C 2312 O O . ILE B 50 ? 0.2183 0.1061 0.2519 -0.0540 -0.0590 0.0360 50 ILE B O 2313 C CB . ILE B 50 ? 0.1985 0.1616 0.1516 -0.0474 -0.0219 0.0359 50 ILE B CB 2314 C CG1 . ILE B 50 ? 0.2400 0.1936 0.1816 -0.0635 -0.0556 0.0365 50 ILE B CG1 2315 C CG2 . ILE B 50 ? 0.2449 0.2402 0.1403 0.0164 0.0031 0.0899 50 ILE B CG2 2316 C CD1 . ILE B 50 ? 0.2383 0.4942 0.1167 -0.0045 -0.0124 0.0423 50 ILE B CD1 2317 N N . VAL B 51 ? 0.1678 0.1098 0.1347 -0.0328 -0.0222 0.0240 51 VAL B N 2318 C CA . VAL B 51 ? 0.1566 0.1080 0.1718 -0.0248 -0.0201 0.0028 51 VAL B CA 2319 C C . VAL B 51 ? 0.1755 0.1220 0.1859 -0.0340 -0.0046 -0.0063 51 VAL B C 2320 O O . VAL B 51 ? 0.1718 0.2213 0.2584 -0.0829 0.0116 -0.0651 51 VAL B O 2321 C CB . VAL B 51 ? 0.1892 0.1152 0.1628 -0.0230 -0.0445 -0.0030 51 VAL B CB 2322 C CG1 . VAL B 51 ? 0.1832 0.2367 0.1492 0.0229 -0.0251 -0.0111 51 VAL B CG1 2323 C CG2 . VAL B 51 ? 0.1534 0.1703 0.1552 -0.0109 -0.0454 0.0345 51 VAL B CG2 2324 N N . ALA B 52 ? 0.1494 0.1300 0.1540 -0.0309 -0.0249 0.0033 52 ALA B N 2325 C CA . ALA B 52 ? 0.1618 0.1281 0.1509 -0.0194 -0.0246 0.0087 52 ALA B CA 2326 C C . ALA B 52 ? 0.1861 0.1122 0.1323 -0.0394 -0.0050 0.0229 52 ALA B C 2327 O O . ALA B 52 ? 0.1804 0.1259 0.1545 -0.0395 0.0139 0.0123 52 ALA B O 2328 C CB . ALA B 52 ? 0.1676 0.2543 0.2735 0.0287 -0.0480 -0.0458 52 ALA B CB 2329 N N . GLY B 53 ? 0.1597 0.1475 0.1316 -0.0412 -0.0075 0.0197 53 GLY B N 2330 C CA . GLY B 53 ? 0.1671 0.1475 0.1256 -0.0222 -0.0129 0.0119 53 GLY B CA 2331 C C . GLY B 53 ? 0.1423 0.1583 0.1183 -0.0384 -0.0101 0.0259 53 GLY B C 2332 O O . GLY B 53 ? 0.1450 0.2076 0.1703 -0.0726 -0.0063 0.0116 53 GLY B O 2333 N N . HIS B 54 ? 0.1478 0.1737 0.1158 -0.0542 -0.0039 0.0165 54 HIS B N 2334 C CA . HIS B 54 ? 0.1546 0.1807 0.1044 -0.0339 -0.0209 0.0231 54 HIS B CA 2335 C C . HIS B 54 ? 0.1682 0.1647 0.0944 -0.0368 -0.0194 0.0238 54 HIS B C 2336 O O . HIS B 54 ? 0.2128 0.1682 0.0833 -0.0545 -0.0192 0.0340 54 HIS B O 2337 C CB . HIS B 54 ? 0.1329 0.1861 0.1391 -0.0442 0.0008 0.0477 54 HIS B CB 2338 C CG . HIS B 54 ? 0.1555 0.2032 0.1502 -0.0542 0.0144 0.0167 54 HIS B CG 2339 N ND1 . HIS B 54 ? 0.2391 0.2148 0.2661 -0.0727 0.0988 0.0077 54 HIS B ND1 2340 C CD2 . HIS B 54 ? 0.1505 0.2065 0.1782 -0.0575 0.0007 0.0075 54 HIS B CD2 2341 C CE1 . HIS B 54 ? 0.2254 0.2648 0.2068 -0.0523 0.0741 0.0358 54 HIS B CE1 2342 N NE2 . HIS B 54 ? 0.2454 0.2518 0.2170 -0.0234 0.0585 -0.0066 54 HIS B NE2 2343 N N . ARG B 55 ? 0.1816 0.2051 0.0916 -0.0736 -0.0181 0.0382 55 ARG B N 2344 C CA . ARG B 55 ? 0.2020 0.1818 0.0755 -0.0769 -0.0104 0.0206 55 ARG B CA 2345 C C . ARG B 55 ? 0.1775 0.1739 0.0872 -0.0639 -0.0233 0.0355 55 ARG B C 2346 O O . ARG B 55 ? 0.1979 0.1961 0.1166 -0.0822 -0.0122 0.0332 55 ARG B O 2347 C CB . ARG B 55 ? 0.2225 0.1889 0.1035 -0.0503 -0.0105 0.0179 55 ARG B CB 2348 C CG . ARG B 55 ? 0.2441 0.2250 0.1499 -0.0494 0.0217 -0.0040 55 ARG B CG 2349 C CD . ARG B 55 ? 0.2255 0.2380 0.1125 -0.0697 0.0081 -0.0242 55 ARG B CD 2350 N NE . ARG B 55 ? 0.2693 0.3198 0.1302 0.0306 0.0267 0.0148 55 ARG B NE 2351 C CZ . ARG B 55 ? 0.2766 0.4393 0.1442 0.0926 0.0537 0.1003 55 ARG B CZ 2352 N NH1 . ARG B 55 ? 0.2601 0.5589 0.1325 0.0700 0.0176 0.0241 55 ARG B NH1 2353 N NH2 . ARG B 55 ? 0.2776 0.6399 0.1912 0.1105 0.0807 0.1108 55 ARG B NH2 2354 N N . MET B 56 ? 0.1840 0.1695 0.1293 -0.0615 -0.0059 0.0381 56 MET B N 2355 C CA . MET B 56 ? 0.2039 0.2268 0.1336 -0.0829 0.0122 -0.0028 56 MET B CA 2356 C C . MET B 56 ? 0.1993 0.1232 0.1546 -0.0427 0.0260 -0.0154 56 MET B C 2357 O O . MET B 56 ? 0.2099 0.1769 0.1808 -0.0689 0.0370 -0.0338 56 MET B O 2358 C CB . MET B 56 ? 0.2782 0.1949 0.1566 0.0140 -0.0508 -0.0090 56 MET B CB 2359 C CG . MET B 56 ? 0.2856 0.2273 0.2025 0.0636 -0.0075 0.0231 56 MET B CG 2360 S SD . MET B 56 ? 0.3633 0.3148 0.5961 -0.0816 -0.0291 -0.2434 56 MET B SD 2361 C CE . MET B 56 ? 0.4678 0.2585 0.3531 -0.1526 0.0292 0.0668 56 MET B CE 2362 N N . ALA B 57 ? 0.2199 0.1419 0.1710 -0.0730 -0.0192 -0.0014 57 ALA B N 2363 C CA . ALA B 57 ? 0.2059 0.1397 0.2144 -0.0495 -0.0181 -0.0084 57 ALA B CA 2364 C C . ALA B 57 ? 0.2245 0.1442 0.1285 -0.0417 -0.0237 0.0177 57 ALA B C 2365 O O . ALA B 57 ? 0.2484 0.2112 0.1363 -0.0157 -0.0372 0.0239 57 ALA B O 2366 C CB . ALA B 57 ? 0.2732 0.1338 0.4152 -0.0573 -0.0920 0.0337 57 ALA B CB 2367 N N . GLN B 58 ? 0.1963 0.1528 0.1064 -0.0554 -0.0277 0.0136 58 GLN B N 2368 C CA . GLN B 58 ? 0.1962 0.1625 0.0864 -0.0429 0.0066 0.0163 58 GLN B CA 2369 C C . GLN B 58 ? 0.1916 0.1494 0.0926 -0.0458 -0.0229 0.0204 58 GLN B C 2370 O O . GLN B 58 ? 0.1623 0.1504 0.0921 -0.0537 -0.0238 0.0269 58 GLN B O 2371 C CB A GLN B 58 ? 0.1841 0.1809 0.0970 -0.0297 -0.0225 0.0385 58 GLN B CB 2372 C CB B GLN B 58 ? 0.1814 0.1611 0.1210 -0.0363 -0.0228 0.0278 58 GLN B CB 2373 C CG A GLN B 58 ? 0.1512 0.2027 0.2534 -0.0158 -0.0201 -0.0142 58 GLN B CG 2374 C CG B GLN B 58 ? 0.2176 0.2437 0.1255 -0.1329 0.0047 -0.0018 58 GLN B CG 2375 C CD A GLN B 58 ? 0.1584 0.2804 0.2631 0.0278 -0.0130 0.0355 58 GLN B CD 2376 C CD B GLN B 58 ? 0.2284 0.2359 0.1012 -0.1017 -0.0059 -0.0323 58 GLN B CD 2377 O OE1 A GLN B 58 ? 0.2171 0.3451 0.1347 -0.0150 0.0681 -0.0033 58 GLN B OE1 2378 O OE1 B GLN B 58 ? 0.3204 0.2542 0.1309 -0.0520 -0.0304 -0.0336 58 GLN B OE1 2379 N NE2 A GLN B 58 ? 0.2119 0.3092 0.1792 0.0837 -0.0537 0.0208 58 GLN B NE2 2380 N NE2 B GLN B 58 ? 0.1477 0.2403 0.1148 -0.0599 -0.0381 0.0929 58 GLN B NE2 2381 N N . ARG B 59 ? 0.1974 0.1585 0.0955 -0.0472 -0.0438 0.0419 59 ARG B N 2382 C CA . ARG B 59 ? 0.1797 0.1456 0.1017 -0.0413 -0.0319 0.0220 59 ARG B CA 2383 C C . ARG B 59 ? 0.1945 0.1450 0.0642 -0.0365 -0.0260 0.0140 59 ARG B C 2384 O O . ARG B 59 ? 0.2185 0.1591 0.0842 -0.0318 -0.0135 0.0051 59 ARG B O 2385 C CB . ARG B 59 ? 0.2018 0.1728 0.1472 -0.0510 -0.0653 0.0342 59 ARG B CB 2386 C CG . ARG B 59 ? 0.3270 0.1573 0.3495 0.0419 -0.2244 -0.0072 59 ARG B CG 2387 C CD . ARG B 59 ? 0.2033 0.2775 0.3760 -0.0261 -0.0686 0.0569 59 ARG B CD 2388 N NE . ARG B 59 ? 0.2741 0.2675 0.2663 -0.0054 -0.0025 0.1244 59 ARG B NE 2389 C CZ . ARG B 59 ? 0.2489 0.2380 0.2650 -0.0994 -0.0132 0.0677 59 ARG B CZ 2390 N NH1 . ARG B 59 ? 0.3432 0.3581 0.2694 -0.0620 0.0410 0.0938 59 ARG B NH1 2391 N NH2 . ARG B 59 ? 0.3638 0.3143 0.2638 0.0011 0.0063 0.0175 59 ARG B NH2 2392 N N . PHE B 60 ? 0.1475 0.1466 0.0782 -0.0338 -0.0312 0.0134 60 PHE B N 2393 C CA . PHE B 60 ? 0.1395 0.1626 0.0877 -0.0253 -0.0247 0.0311 60 PHE B CA 2394 C C . PHE B 60 ? 0.1509 0.1526 0.0827 -0.0476 -0.0353 0.0034 60 PHE B C 2395 O O . PHE B 60 ? 0.1344 0.1661 0.1038 -0.0447 -0.0285 0.0125 60 PHE B O 2396 C CB . PHE B 60 ? 0.1402 0.1593 0.0941 -0.0336 -0.0399 0.0057 60 PHE B CB 2397 C CG . PHE B 60 ? 0.1590 0.1718 0.0468 -0.0470 -0.0082 -0.0126 60 PHE B CG 2398 C CD1 . PHE B 60 ? 0.1599 0.1691 0.0805 -0.0423 -0.0267 0.0108 60 PHE B CD1 2399 C CD2 . PHE B 60 ? 0.1825 0.1766 0.0682 -0.0362 0.0311 0.0252 60 PHE B CD2 2400 C CE1 . PHE B 60 ? 0.1975 0.2081 0.0845 -0.0859 -0.0299 0.0274 60 PHE B CE1 2401 C CE2 . PHE B 60 ? 0.1661 0.2469 0.0909 -0.0689 0.0015 -0.0052 60 PHE B CE2 2402 C CZ . PHE B 60 ? 0.1601 0.2530 0.1053 -0.1015 -0.0206 0.0244 60 PHE B CZ 2403 N N . ALA B 61 ? 0.2110 0.1471 0.0916 -0.0333 -0.0245 0.0293 61 ALA B N 2404 C CA . ALA B 61 ? 0.1592 0.1446 0.0919 -0.0304 -0.0314 0.0126 61 ALA B CA 2405 C C . ALA B 61 ? 0.1604 0.1601 0.0909 -0.0512 -0.0296 0.0023 61 ALA B C 2406 O O . ALA B 61 ? 0.1665 0.1647 0.0997 -0.0350 -0.0488 0.0161 61 ALA B O 2407 C CB . ALA B 61 ? 0.2267 0.1447 0.1309 -0.0532 -0.0438 -0.0205 61 ALA B CB 2408 N N . MET B 62 ? 0.1593 0.1820 0.0902 -0.0438 -0.0299 0.0219 62 MET B N 2409 C CA . MET B 62 ? 0.1430 0.1747 0.0882 -0.0495 -0.0429 0.0017 62 MET B CA 2410 C C . MET B 62 ? 0.1845 0.1607 0.0906 -0.0341 -0.0556 -0.0061 62 MET B C 2411 O O . MET B 62 ? 0.1717 0.1913 0.0770 -0.0593 -0.0389 0.0095 62 MET B O 2412 C CB . MET B 62 ? 0.1509 0.2066 0.1222 -0.0312 -0.0258 0.0263 62 MET B CB 2413 C CG . MET B 62 ? 0.1383 0.2128 0.1899 -0.0229 -0.0498 0.0702 62 MET B CG 2414 S SD . MET B 62 ? 0.1934 0.1751 0.1267 -0.0226 -0.0300 0.0433 62 MET B SD 2415 C CE . MET B 62 ? 0.1448 0.2393 0.2749 -0.0483 -0.0554 0.0613 62 MET B CE 2416 N N A CYS B 63 ? 0.2271 0.1695 0.0852 -0.0469 -0.0404 -0.0102 63 CYS B N 2417 N N C CYS B 63 ? 0.2184 0.1730 0.0881 -0.0731 -0.0426 0.0060 63 CYS B N 2418 C CA A CYS B 63 ? 0.2243 0.1717 0.1024 -0.0893 -0.0755 0.0087 63 CYS B CA 2419 C CA C CYS B 63 ? 0.2385 0.1612 0.0938 -0.0344 -0.0387 0.0051 63 CYS B CA 2420 C C A CYS B 63 ? 0.1968 0.1643 0.1131 -0.0662 -0.0704 0.0251 63 CYS B C 2421 C C C CYS B 63 ? 0.1745 0.1816 0.0976 -0.0461 -0.0350 0.0260 63 CYS B C 2422 O O A CYS B 63 ? 0.2110 0.1682 0.1479 -0.0471 -0.0728 0.0267 63 CYS B O 2423 O O C CYS B 63 ? 0.1710 0.1456 0.0682 -0.0616 -0.0462 0.0266 63 CYS B O 2424 C CB A CYS B 63 ? 0.2510 0.1430 0.1574 -0.0319 -0.0417 -0.0405 63 CYS B CB 2425 C CB B CYS B 63 ? 0.1340 0.1939 0.1562 -0.0632 0.0528 -0.0362 63 CYS B CB 2426 C CB C CYS B 63 ? 0.2286 0.1729 0.1643 -0.0602 -0.0082 -0.0398 63 CYS B CB 2427 S SG A CYS B 63 ? 0.2785 0.2108 0.2271 -0.0924 0.0039 -0.0327 63 CYS B SG 2428 S SG B CYS B 63 ? 0.4641 0.2179 0.5053 -0.1363 0.0574 0.0279 63 CYS B SG 2429 S SG C CYS B 63 ? 0.2177 0.3130 0.1663 -0.0606 0.0003 -0.0728 63 CYS B SG 2430 N N . SER B 64 ? 0.1787 0.1439 0.0920 -0.0437 -0.0457 -0.0051 64 SER B N 2431 C CA . SER B 64 ? 0.1601 0.1282 0.1024 -0.0428 -0.0307 0.0197 64 SER B CA 2432 C C . SER B 64 ? 0.1163 0.1172 0.1144 -0.0158 0.0083 0.0207 64 SER B C 2433 O O . SER B 64 ? 0.1101 0.1294 0.1005 -0.0135 0.0047 0.0399 64 SER B O 2434 C CB . SER B 64 ? 0.1641 0.1207 0.1413 -0.0196 -0.0418 0.0126 64 SER B CB 2435 O OG . SER B 64 ? 0.2228 0.1300 0.1576 -0.0471 -0.0187 0.0102 64 SER B OG 2436 N N . THR B 65 ? 0.1020 0.1184 0.0798 -0.0228 -0.0017 0.0146 65 THR B N 2437 C CA . THR B 65 ? 0.1054 0.1252 0.0750 -0.0250 0.0018 0.0108 65 THR B CA 2438 C C . THR B 65 ? 0.1030 0.1208 0.0927 -0.0187 -0.0034 0.0133 65 THR B C 2439 O O . THR B 65 ? 0.1119 0.1371 0.0954 -0.0150 -0.0023 -0.0009 65 THR B O 2440 C CB . THR B 65 ? 0.1003 0.1333 0.0764 -0.0418 -0.0235 0.0157 65 THR B CB 2441 O OG1 . THR B 65 ? 0.1233 0.1612 0.1032 -0.0361 -0.0280 0.0551 65 THR B OG1 2442 C CG2 . THR B 65 ? 0.1078 0.1248 0.0798 -0.0268 -0.0104 0.0169 65 THR B CG2 2443 N N . PHE B 66 ? 0.1172 0.1259 0.0746 -0.0171 -0.0073 0.0156 66 PHE B N 2444 C CA . PHE B 66 ? 0.1084 0.1165 0.1002 -0.0120 -0.0241 0.0293 66 PHE B CA 2445 C C . PHE B 66 ? 0.0895 0.1298 0.0929 -0.0049 -0.0279 0.0190 66 PHE B C 2446 O O . PHE B 66 ? 0.0937 0.1426 0.0909 -0.0123 -0.0325 0.0182 66 PHE B O 2447 C CB . PHE B 66 ? 0.1394 0.1708 0.0956 -0.0321 -0.0371 0.0290 66 PHE B CB 2448 C CG . PHE B 66 ? 0.1365 0.1962 0.0816 -0.0440 -0.0536 0.0390 66 PHE B CG 2449 C CD1 . PHE B 66 ? 0.2011 0.1673 0.1503 -0.0431 -0.0901 0.0560 66 PHE B CD1 2450 C CD2 . PHE B 66 ? 0.1272 0.3115 0.0864 -0.0731 -0.0551 0.0363 66 PHE B CD2 2451 C CE1 . PHE B 66 ? 0.2419 0.2057 0.2370 -0.0908 -0.1853 0.1094 66 PHE B CE1 2452 C CE2 . PHE B 66 ? 0.1832 0.3708 0.1431 -0.1264 -0.0749 0.1198 66 PHE B CE2 2453 C CZ . PHE B 66 ? 0.2408 0.3090 0.1926 -0.1338 -0.1693 0.1694 66 PHE B CZ 2454 N N . LYS B 67 ? 0.1110 0.1293 0.0744 -0.0099 -0.0297 0.0237 67 LYS B N 2455 C CA . LYS B 67 ? 0.0883 0.1133 0.1022 -0.0221 -0.0257 0.0173 67 LYS B CA 2456 C C . LYS B 67 ? 0.0754 0.1069 0.0789 -0.0084 -0.0237 0.0270 67 LYS B C 2457 O O . LYS B 67 ? 0.0914 0.1189 0.1012 -0.0049 0.0064 0.0315 67 LYS B O 2458 C CB . LYS B 67 ? 0.1211 0.1086 0.0690 -0.0212 -0.0143 0.0163 67 LYS B CB 2459 C CG . LYS B 67 ? 0.1142 0.1052 0.0982 -0.0391 -0.0275 0.0138 67 LYS B CG 2460 C CD . LYS B 67 ? 0.1207 0.1026 0.1254 -0.0381 -0.0239 0.0026 67 LYS B CD 2461 C CE . LYS B 67 ? 0.1475 0.1297 0.1138 -0.0412 -0.0187 -0.0091 67 LYS B CE 2462 N NZ . LYS B 67 ? 0.1871 0.1207 0.1015 -0.0359 -0.0276 -0.0119 67 LYS B NZ 2463 N N . PHE B 68 ? 0.0771 0.1173 0.0859 -0.0153 -0.0183 0.0099 68 PHE B N 2464 C CA . PHE B 68 ? 0.0787 0.1049 0.1091 -0.0091 -0.0245 0.0115 68 PHE B CA 2465 C C . PHE B 68 ? 0.0816 0.1036 0.1099 -0.0128 -0.0109 0.0200 68 PHE B C 2466 O O . PHE B 68 ? 0.0797 0.1144 0.1030 -0.0113 -0.0156 0.0216 68 PHE B O 2467 C CB . PHE B 68 ? 0.0904 0.1223 0.1383 -0.0213 -0.0273 0.0053 68 PHE B CB 2468 C CG . PHE B 68 ? 0.1027 0.1215 0.1394 -0.0193 -0.0408 0.0107 68 PHE B CG 2469 C CD1 . PHE B 68 ? 0.4488 0.1992 0.1512 -0.1883 0.0321 -0.0024 68 PHE B CD1 2470 C CD2 . PHE B 68 ? 0.1259 0.2086 0.1701 -0.0477 -0.0220 -0.0601 68 PHE B CD2 2471 C CE1 . PHE B 68 ? 0.5584 0.2089 0.1045 -0.2212 -0.0574 0.0247 68 PHE B CE1 2472 C CE2 . PHE B 68 ? 0.1547 0.2175 0.2448 0.0262 -0.0591 -0.0940 68 PHE B CE2 2473 C CZ . PHE B 68 ? 0.4235 0.1166 0.1508 -0.0039 -0.1301 0.0313 68 PHE B CZ 2474 N N . PRO B 69 ? 0.0856 0.0997 0.1195 -0.0018 -0.0124 0.0241 69 PRO B N 2475 C CA . PRO B 69 ? 0.0791 0.1238 0.1247 -0.0016 -0.0150 0.0295 69 PRO B CA 2476 C C . PRO B 69 ? 0.0748 0.1292 0.1081 -0.0050 -0.0163 0.0319 69 PRO B C 2477 O O . PRO B 69 ? 0.0863 0.1188 0.1253 -0.0053 -0.0189 0.0255 69 PRO B O 2478 C CB . PRO B 69 ? 0.1168 0.2277 0.1786 -0.0146 -0.0274 0.1256 69 PRO B CB 2479 C CG . PRO B 69 ? 0.1325 0.1798 0.1534 0.0267 0.0196 0.0753 69 PRO B CG 2480 C CD . PRO B 69 ? 0.1065 0.1145 0.1358 0.0007 0.0101 0.0372 69 PRO B CD 2481 N N . LEU B 70 ? 0.0850 0.1270 0.1082 -0.0098 -0.0271 0.0327 70 LEU B N 2482 C CA . LEU B 70 ? 0.0753 0.1390 0.0992 -0.0153 -0.0294 0.0179 70 LEU B CA 2483 C C . LEU B 70 ? 0.0870 0.1082 0.1052 -0.0069 -0.0198 0.0170 70 LEU B C 2484 O O . LEU B 70 ? 0.0847 0.1296 0.1200 -0.0012 -0.0200 0.0270 70 LEU B O 2485 C CB . LEU B 70 ? 0.0983 0.1412 0.0916 -0.0293 -0.0290 0.0095 70 LEU B CB 2486 C CG . LEU B 70 ? 0.0979 0.1543 0.1227 -0.0341 -0.0269 0.0119 70 LEU B CG 2487 C CD1 . LEU B 70 ? 0.1030 0.1817 0.1463 -0.0455 -0.0349 0.0372 70 LEU B CD1 2488 C CD2 . LEU B 70 ? 0.1571 0.1419 0.1230 -0.0481 -0.0317 0.0112 70 LEU B CD2 2489 N N . ALA B 71 ? 0.0863 0.1153 0.0934 0.0041 -0.0113 0.0376 71 ALA B N 2490 C CA . ALA B 71 ? 0.0904 0.1088 0.1018 0.0024 -0.0062 0.0237 71 ALA B CA 2491 C C . ALA B 71 ? 0.0875 0.1101 0.1026 -0.0059 -0.0172 0.0203 71 ALA B C 2492 O O . ALA B 71 ? 0.0773 0.1221 0.1261 0.0031 -0.0005 0.0218 71 ALA B O 2493 C CB . ALA B 71 ? 0.0998 0.1333 0.0964 0.0171 -0.0177 0.0210 71 ALA B CB 2494 N N . ALA B 72 ? 0.0822 0.1105 0.0950 -0.0151 -0.0245 0.0147 72 ALA B N 2495 C CA . ALA B 72 ? 0.0793 0.1118 0.1388 -0.0092 -0.0193 0.0254 72 ALA B CA 2496 C C . ALA B 72 ? 0.0869 0.0979 0.1237 -0.0053 -0.0084 0.0282 72 ALA B C 2497 O O . ALA B 72 ? 0.1070 0.1106 0.1490 0.0030 0.0054 0.0156 72 ALA B O 2498 C CB . ALA B 72 ? 0.0929 0.1156 0.1236 -0.0166 -0.0221 0.0270 72 ALA B CB 2499 N N . LEU B 73 ? 0.0750 0.1246 0.1148 0.0011 -0.0071 0.0281 73 LEU B N 2500 C CA . LEU B 73 ? 0.0750 0.1238 0.1530 0.0031 -0.0149 0.0312 73 LEU B CA 2501 C C . LEU B 73 ? 0.0774 0.1178 0.1452 -0.0054 -0.0081 0.0175 73 LEU B C 2502 O O . LEU B 73 ? 0.0750 0.1311 0.1872 0.0077 -0.0083 0.0188 73 LEU B O 2503 C CB A LEU B 73 ? 0.0816 0.1652 0.1397 -0.0381 -0.0198 0.0446 73 LEU B CB 2504 C CB B LEU B 73 ? 0.0877 0.1363 0.1422 0.0063 -0.0275 0.0429 73 LEU B CB 2505 C CG A LEU B 73 ? 0.0772 0.1716 0.1951 -0.0140 -0.0394 0.0280 73 LEU B CG 2506 C CG B LEU B 73 ? 0.0992 0.1970 0.1834 0.0157 -0.0664 0.0378 73 LEU B CG 2507 C CD1 A LEU B 73 ? 0.1755 0.0785 0.1778 -0.0839 -0.0784 0.0646 73 LEU B CD1 2508 C CD1 B LEU B 73 ? 0.0913 0.2193 0.1522 0.0282 -0.0229 0.0790 73 LEU B CD1 2509 C CD2 A LEU B 73 ? 0.0763 0.3377 0.2260 -0.0803 -0.0453 0.1229 73 LEU B CD2 2510 C CD2 B LEU B 73 ? 0.0889 0.1605 0.1557 -0.0445 -0.0299 0.0736 73 LEU B CD2 2511 N N . VAL B 74 ? 0.0776 0.1115 0.1586 0.0017 -0.0089 0.0139 74 VAL B N 2512 C CA . VAL B 74 ? 0.0774 0.1023 0.1763 -0.0150 -0.0033 0.0110 74 VAL B CA 2513 C C . VAL B 74 ? 0.0864 0.0972 0.1573 -0.0079 -0.0004 0.0263 74 VAL B C 2514 O O . VAL B 74 ? 0.0799 0.1221 0.1583 -0.0157 0.0000 0.0151 74 VAL B O 2515 C CB . VAL B 74 ? 0.1137 0.1057 0.1832 -0.0059 0.0184 0.0145 74 VAL B CB 2516 C CG1 . VAL B 74 ? 0.1482 0.1014 0.1968 -0.0020 0.0348 0.0241 74 VAL B CG1 2517 C CG2 . VAL B 74 ? 0.1556 0.1212 0.1934 -0.0008 0.0120 -0.0012 74 VAL B CG2 2518 N N . PHE B 75 ? 0.0822 0.1268 0.1220 -0.0004 0.0126 0.0110 75 PHE B N 2519 C CA . PHE B 75 ? 0.0862 0.1452 0.1171 0.0018 0.0052 0.0092 75 PHE B CA 2520 C C . PHE B 75 ? 0.0913 0.1219 0.1405 -0.0113 -0.0064 -0.0032 75 PHE B C 2521 O O . PHE B 75 ? 0.1080 0.1418 0.1633 0.0020 0.0113 -0.0151 75 PHE B O 2522 C CB . PHE B 75 ? 0.0928 0.1260 0.1409 -0.0095 -0.0030 0.0141 75 PHE B CB 2523 C CG . PHE B 75 ? 0.1103 0.1190 0.1235 -0.0112 -0.0344 0.0013 75 PHE B CG 2524 C CD1 . PHE B 75 ? 0.1499 0.2023 0.1282 0.0465 -0.0274 0.0024 75 PHE B CD1 2525 C CD2 . PHE B 75 ? 0.1544 0.1285 0.1583 -0.0093 -0.0017 0.0258 75 PHE B CD2 2526 C CE1 . PHE B 75 ? 0.1601 0.1962 0.2023 0.0448 -0.0677 0.0041 75 PHE B CE1 2527 C CE2 . PHE B 75 ? 0.2136 0.1543 0.1671 -0.0223 -0.0489 0.0449 75 PHE B CE2 2528 C CZ . PHE B 75 ? 0.2203 0.1239 0.2092 0.0172 -0.0896 0.0217 75 PHE B CZ 2529 N N . GLU B 76 ? 0.0963 0.1060 0.1654 -0.0034 -0.0021 0.0067 76 GLU B N 2530 C CA . GLU B 76 ? 0.1022 0.1172 0.2100 -0.0053 0.0021 0.0271 76 GLU B CA 2531 C C . GLU B 76 ? 0.1011 0.1125 0.1626 0.0029 0.0129 0.0139 76 GLU B C 2532 O O . GLU B 76 ? 0.1050 0.1228 0.2185 0.0229 -0.0069 -0.0030 76 GLU B O 2533 C CB . GLU B 76 ? 0.0891 0.1342 0.2247 -0.0057 0.0023 0.0507 76 GLU B CB 2534 C CG A GLU B 76 ? 0.1600 0.2348 0.3608 0.0602 -0.0033 0.1325 76 GLU B CG 2535 C CG B GLU B 76 ? 0.0796 0.1970 0.3095 0.0290 0.0190 0.1051 76 GLU B CG 2536 C CD A GLU B 76 ? 0.2904 0.2552 0.4920 -0.0014 -0.1853 0.2029 76 GLU B CD 2537 C CD B GLU B 76 ? 0.1121 0.1900 0.3756 0.0198 -0.0352 0.0693 76 GLU B CD 2538 O OE1 A GLU B 76 ? 0.5507 0.3412 0.5737 -0.1675 -0.3327 0.2966 76 GLU B OE1 2539 O OE1 B GLU B 76 ? 0.1112 0.1416 0.6489 0.0516 -0.0458 0.1579 76 GLU B OE1 2540 O OE2 A GLU B 76 ? 0.9108 0.3586 0.5702 -0.2513 -0.4034 0.2991 76 GLU B OE2 2541 O OE2 B GLU B 76 ? 0.2883 0.1334 0.5248 -0.0546 -0.1093 0.1111 76 GLU B OE2 2542 N N . ARG B 77 ? 0.0723 0.1146 0.1687 0.0033 -0.0013 0.0093 77 ARG B N 2543 C CA . ARG B 77 ? 0.0855 0.1444 0.1733 -0.0017 0.0072 0.0191 77 ARG B CA 2544 C C . ARG B 77 ? 0.0806 0.1217 0.1751 -0.0130 0.0050 0.0067 77 ARG B C 2545 O O . ARG B 77 ? 0.0779 0.1760 0.1685 0.0040 0.0036 0.0127 77 ARG B O 2546 C CB . ARG B 77 ? 0.1035 0.1758 0.1728 -0.0424 -0.0060 0.0068 77 ARG B CB 2547 C CG . ARG B 77 ? 0.1312 0.3461 0.1629 -0.0717 0.0415 -0.0152 77 ARG B CG 2548 C CD . ARG B 77 ? 0.2603 0.5306 0.2429 -0.2066 -0.1024 0.1419 77 ARG B CD 2549 N NE . ARG B 77 ? 0.1524 0.6267 0.2589 -0.0848 -0.0347 0.1072 77 ARG B NE 2550 C CZ . ARG B 77 ? 0.1974 0.6287 0.3035 0.0978 -0.0176 0.0149 77 ARG B CZ 2551 N NH1 . ARG B 77 ? 0.2284 0.5189 0.5026 0.1571 -0.1641 -0.0369 77 ARG B NH1 2552 N NH2 . ARG B 77 ? 0.3716 0.8426 0.2586 0.2862 -0.0324 0.0823 77 ARG B NH2 2553 N N . ILE B 78 ? 0.0865 0.1209 0.1624 0.0026 0.0149 0.0145 78 ILE B N 2554 C CA . ILE B 78 ? 0.0959 0.1291 0.1648 -0.0037 0.0264 0.0112 78 ILE B CA 2555 C C . ILE B 78 ? 0.1130 0.1294 0.1792 0.0000 0.0232 0.0061 78 ILE B C 2556 O O . ILE B 78 ? 0.1003 0.1739 0.2036 -0.0125 0.0302 -0.0314 78 ILE B O 2557 C CB . ILE B 78 ? 0.1219 0.1365 0.1556 0.0116 0.0210 0.0250 78 ILE B CB 2558 C CG1 . ILE B 78 ? 0.1066 0.1279 0.1710 -0.0070 0.0118 0.0324 78 ILE B CG1 2559 C CG2 . ILE B 78 ? 0.1199 0.1818 0.1615 0.0115 0.0173 0.0091 78 ILE B CG2 2560 C CD1 . ILE B 78 ? 0.1493 0.1178 0.2056 0.0151 -0.0033 0.0219 78 ILE B CD1 2561 N N . ASP B 79 ? 0.1024 0.1315 0.1837 -0.0088 0.0104 -0.0099 79 ASP B N 2562 C CA . ASP B 79 ? 0.0899 0.1488 0.2311 -0.0098 0.0163 -0.0366 79 ASP B CA 2563 C C . ASP B 79 ? 0.0994 0.1533 0.2289 0.0044 0.0251 -0.0307 79 ASP B C 2564 O O . ASP B 79 ? 0.1309 0.1878 0.2508 0.0188 0.0271 -0.0598 79 ASP B O 2565 C CB . ASP B 79 ? 0.1042 0.1238 0.2099 -0.0020 0.0131 -0.0288 79 ASP B CB 2566 C CG . ASP B 79 ? 0.0967 0.1450 0.2165 -0.0102 0.0065 -0.0037 79 ASP B CG 2567 O OD1 . ASP B 79 ? 0.1362 0.1945 0.2155 -0.0084 0.0037 0.0205 79 ASP B OD1 2568 O OD2 . ASP B 79 ? 0.1220 0.1580 0.2231 -0.0273 0.0000 0.0090 79 ASP B OD2 2569 N N . SER B 80 ? 0.0981 0.1467 0.2417 0.0061 0.0081 -0.0360 80 SER B N 2570 C CA . SER B 80 ? 0.1097 0.1915 0.2725 0.0370 0.0205 -0.0016 80 SER B CA 2571 C C . SER B 80 ? 0.0972 0.1791 0.2342 0.0066 -0.0113 -0.0529 80 SER B C 2572 O O . SER B 80 ? 0.1010 0.2190 0.3213 0.0176 -0.0110 -0.0549 80 SER B O 2573 C CB . SER B 80 ? 0.1604 0.1806 0.2945 -0.0169 -0.0357 0.0316 80 SER B CB 2574 O OG . SER B 80 ? 0.1674 0.2273 0.3332 0.0354 0.0050 -0.0603 80 SER B OG 2575 N N . GLY B 81 ? 0.0906 0.1808 0.2678 -0.0049 0.0009 -0.0408 81 GLY B N 2576 C CA . GLY B 81 ? 0.1116 0.1959 0.2865 -0.0253 0.0249 -0.0571 81 GLY B CA 2577 C C . GLY B 81 ? 0.0627 0.1857 0.2683 0.0047 -0.0073 -0.0329 81 GLY B C 2578 O O . GLY B 81 ? 0.0915 0.2052 0.2962 -0.0205 0.0142 -0.0425 81 GLY B O 2579 N N . THR B 82 ? 0.0897 0.1495 0.2758 0.0145 0.0036 -0.0275 82 THR B N 2580 C CA . THR B 82 ? 0.1219 0.1790 0.2737 0.0021 0.0392 -0.0603 82 THR B CA 2581 C C . THR B 82 ? 0.1405 0.1801 0.4521 0.0077 -0.0598 -0.1039 82 THR B C 2582 O O . THR B 82 ? 0.2448 0.2498 1.1422 0.0973 -0.3427 -0.3177 82 THR B O 2583 C CB A THR B 82 ? 0.1482 0.2979 0.2585 -0.0092 0.0595 -0.0496 82 THR B CB 2584 C CB B THR B 82 ? 0.0790 0.2879 0.2745 -0.0546 0.0667 -0.0577 82 THR B CB 2585 O OG1 A THR B 82 ? 0.1094 0.2571 0.2408 0.0246 0.0026 0.0002 82 THR B OG1 2586 O OG1 B THR B 82 ? 0.3412 0.1996 0.2847 -0.1207 0.0509 -0.0285 82 THR B OG1 2587 C CG2 A THR B 82 ? 0.2137 0.3534 0.2804 0.0736 0.1765 0.0673 82 THR B CG2 2588 C CG2 B THR B 82 ? 0.2640 0.2846 0.2467 -0.1078 0.1635 -0.1268 82 THR B CG2 2589 N N . GLU B 83 ? 0.1191 0.1528 0.2894 -0.0199 0.0088 -0.0385 83 GLU B N 2590 C CA . GLU B 83 ? 0.1415 0.1482 0.3008 -0.0153 0.0433 -0.0137 83 GLU B CA 2591 C C . GLU B 83 ? 0.1210 0.1271 0.3099 -0.0175 0.0428 -0.0175 83 GLU B C 2592 O O . GLU B 83 ? 0.1818 0.1346 0.2896 -0.0341 0.0528 -0.0106 83 GLU B O 2593 C CB . GLU B 83 ? 0.1127 0.1932 0.3253 -0.0086 0.0472 0.0039 83 GLU B CB 2594 C CG . GLU B 83 ? 0.1936 0.1917 0.4130 0.0091 0.1055 -0.0166 83 GLU B CG 2595 C CD . GLU B 83 ? 0.2279 0.1886 0.5091 0.0267 0.0235 -0.0274 83 GLU B CD 2596 O OE1 . GLU B 83 ? 0.4292 0.3888 0.5259 -0.1753 0.1304 -0.1567 83 GLU B OE1 2597 O OE2 . GLU B 83 ? 0.3747 0.1727 0.4926 -0.0785 -0.0016 -0.0157 83 GLU B OE2 2598 N N . ARG B 84 ? 0.1916 0.1268 0.3019 0.0080 0.0017 -0.0257 84 ARG B N 2599 C CA . ARG B 84 ? 0.1602 0.1683 0.2986 0.0149 0.0306 -0.0137 84 ARG B CA 2600 C C . ARG B 84 ? 0.1540 0.1338 0.2793 0.0013 0.0587 0.0224 84 ARG B C 2601 O O . ARG B 84 ? 0.1807 0.1462 0.2789 0.0236 0.0502 0.0115 84 ARG B O 2602 C CB . ARG B 84 ? 0.1672 0.3237 0.4127 0.0635 0.1114 0.0787 84 ARG B CB 2603 C CG . ARG B 84 ? 0.3335 0.3243 0.5299 0.0336 0.2317 0.0295 84 ARG B CG 2604 C CD . ARG B 84 ? 0.3562 0.4152 0.5760 0.0134 0.3060 0.0212 84 ARG B CD 2605 N NE . ARG B 84 ? 0.3595 0.3826 0.6160 -0.0390 0.3413 0.0570 84 ARG B NE 2606 C CZ . ARG B 84 ? 0.4387 0.3735 0.7112 -0.0997 0.2877 0.0924 84 ARG B CZ 2607 N NH1 . ARG B 84 ? 0.5315 0.4395 0.7538 -0.1193 0.2059 0.0894 84 ARG B NH1 2608 N NH2 . ARG B 84 ? 0.4350 0.4374 0.8068 0.0189 0.3289 -0.0790 84 ARG B NH2 2609 N N . GLY B 85 ? 0.1349 0.1445 0.3333 -0.0114 0.0596 0.0003 85 GLY B N 2610 C CA . GLY B 85 ? 0.1465 0.1465 0.2531 -0.0119 0.0586 0.0208 85 GLY B CA 2611 C C . GLY B 85 ? 0.1523 0.1490 0.2255 0.0039 0.0754 0.0178 85 GLY B C 2612 O O . GLY B 85 ? 0.1442 0.1536 0.1845 -0.0061 0.0557 0.0076 85 GLY B O 2613 N N . ASP B 86 ? 0.1955 0.1396 0.1873 -0.0231 0.0792 -0.0060 86 ASP B N 2614 C CA . ASP B 86 ? 0.2213 0.1411 0.1916 -0.0164 0.0769 0.0036 86 ASP B CA 2615 C C . ASP B 86 ? 0.1664 0.1149 0.2357 0.0042 0.0700 0.0059 86 ASP B C 2616 O O . ASP B 86 ? 0.1920 0.1486 0.2864 -0.0280 0.0561 0.0465 86 ASP B O 2617 C CB . ASP B 86 ? 0.2595 0.2484 0.2003 -0.0608 0.0914 0.0328 86 ASP B CB 2618 C CG . ASP B 86 ? 0.3083 0.2528 0.2092 -0.0455 0.1289 -0.0392 86 ASP B CG 2619 O OD1 . ASP B 86 ? 0.2404 0.4819 0.2793 0.0438 0.1665 0.0528 86 ASP B OD1 2620 O OD2 . ASP B 86 ? 0.4384 0.3236 0.3068 -0.0055 0.2387 0.0469 86 ASP B OD2 2621 N N . ARG B 87 ? 0.1364 0.1197 0.2883 -0.0053 0.0404 0.0205 87 ARG B N 2622 C CA . ARG B 87 ? 0.1202 0.1262 0.2906 -0.0064 0.0489 0.0100 87 ARG B CA 2623 C C . ARG B 87 ? 0.1081 0.1136 0.2658 -0.0118 0.0463 0.0320 87 ARG B C 2624 O O . ARG B 87 ? 0.1067 0.1170 0.2434 -0.0057 0.0407 0.0314 87 ARG B O 2625 C CB . ARG B 87 ? 0.1073 0.1299 0.3396 0.0022 0.0128 0.0171 87 ARG B CB 2626 C CG . ARG B 87 ? 0.2004 0.1549 0.4079 -0.0372 -0.0645 0.0429 87 ARG B CG 2627 C CD . ARG B 87 ? 0.1831 0.2443 0.3946 0.0108 -0.0394 0.0686 87 ARG B CD 2628 N NE . ARG B 87 ? 0.4138 0.4875 0.4748 0.1292 -0.2232 -0.0255 87 ARG B NE 2629 C CZ . ARG B 87 ? 0.3818 0.5547 0.4917 -0.0216 -0.0464 -0.1906 87 ARG B CZ 2630 N NH1 . ARG B 87 ? 0.5133 0.8037 0.4229 -0.1591 0.0568 -0.2968 87 ARG B NH1 2631 N NH2 . ARG B 87 ? 0.2275 0.7063 0.4611 -0.1593 0.0480 -0.1729 87 ARG B NH2 2632 N N . LYS B 88 ? 0.1109 0.1385 0.2389 -0.0253 0.0343 -0.0051 88 LYS B N 2633 C CA . LYS B 88 ? 0.1145 0.1276 0.2214 -0.0290 0.0191 -0.0072 88 LYS B CA 2634 C C . LYS B 88 ? 0.1149 0.1416 0.2302 0.0283 -0.0050 -0.0001 88 LYS B C 2635 O O . LYS B 88 ? 0.1152 0.1794 0.2794 0.0059 -0.0239 0.0120 88 LYS B O 2636 C CB . LYS B 88 ? 0.1339 0.1399 0.2716 -0.0259 0.0157 0.0207 88 LYS B CB 2637 C CG . LYS B 88 ? 0.1367 0.1554 0.2710 -0.0152 0.0282 0.0393 88 LYS B CG 2638 C CD . LYS B 88 ? 0.2254 0.1723 0.3362 0.0050 0.1291 0.0587 88 LYS B CD 2639 C CE . LYS B 88 ? 0.3109 0.3228 0.3382 -0.0340 0.1265 0.1243 88 LYS B CE 2640 N NZ . LYS B 88 ? 0.4971 0.3586 0.4989 0.0034 0.2341 0.2192 88 LYS B NZ 2641 N N . LEU B 89 ? 0.1094 0.1234 0.1707 -0.0019 -0.0246 0.0320 89 LEU B N 2642 C CA . LEU B 89 ? 0.1220 0.1330 0.1743 -0.0066 -0.0632 0.0201 89 LEU B CA 2643 C C . LEU B 89 ? 0.1083 0.1340 0.1610 -0.0097 -0.0362 0.0309 89 LEU B C 2644 O O . LEU B 89 ? 0.1145 0.1387 0.1515 -0.0077 -0.0436 0.0239 89 LEU B O 2645 C CB . LEU B 89 ? 0.1649 0.1365 0.1579 -0.0099 -0.0228 0.0257 89 LEU B CB 2646 C CG . LEU B 89 ? 0.1634 0.1433 0.2025 -0.0275 -0.0305 0.0198 89 LEU B CG 2647 C CD1 . LEU B 89 ? 0.2258 0.1757 0.1523 -0.0682 -0.0339 0.0228 89 LEU B CD1 2648 C CD2 . LEU B 89 ? 0.2141 0.1213 0.3224 -0.0025 -0.0769 0.0692 89 LEU B CD2 2649 N N . SER B 90 ? 0.1013 0.1188 0.2004 -0.0121 -0.0320 0.0228 90 SER B N 2650 C CA . SER B 90 ? 0.1380 0.1205 0.1483 -0.0085 -0.0367 0.0265 90 SER B CA 2651 C C . SER B 90 ? 0.1045 0.1424 0.1338 -0.0145 -0.0543 0.0272 90 SER B C 2652 O O . SER B 90 ? 0.1972 0.1695 0.1523 0.0215 -0.0422 0.0464 90 SER B O 2653 C CB . SER B 90 ? 0.1589 0.1177 0.3043 -0.0336 0.0486 -0.0080 90 SER B CB 2654 O OG . SER B 90 ? 0.2618 0.3057 0.3591 0.0044 0.1351 -0.0320 90 SER B OG 2655 N N . TYR B 91 ? 0.1315 0.1357 0.1333 -0.0111 -0.0281 0.0253 91 TYR B N 2656 C CA . TYR B 91 ? 0.1393 0.1428 0.1163 -0.0306 -0.0346 0.0195 91 TYR B CA 2657 C C . TYR B 91 ? 0.1751 0.1362 0.1434 -0.0355 -0.0292 0.0063 91 TYR B C 2658 O O . TYR B 91 ? 0.1895 0.1203 0.1462 -0.0355 -0.0270 0.0009 91 TYR B O 2659 C CB . TYR B 91 ? 0.1412 0.1554 0.1195 -0.0322 -0.0332 0.0403 91 TYR B CB 2660 C CG . TYR B 91 ? 0.1325 0.1273 0.0952 -0.0186 -0.0257 0.0267 91 TYR B CG 2661 C CD1 . TYR B 91 ? 0.1314 0.1376 0.1203 -0.0037 -0.0143 -0.0012 91 TYR B CD1 2662 C CD2 . TYR B 91 ? 0.1682 0.1061 0.0949 -0.0124 -0.0343 0.0091 91 TYR B CD2 2663 C CE1 . TYR B 91 ? 0.1564 0.1200 0.0863 -0.0059 -0.0165 0.0012 91 TYR B CE1 2664 C CE2 . TYR B 91 ? 0.1493 0.0973 0.0888 -0.0119 -0.0241 0.0163 91 TYR B CE2 2665 C CZ . TYR B 91 ? 0.1390 0.1118 0.0893 -0.0115 -0.0234 0.0199 91 TYR B CZ 2666 O OH . TYR B 91 ? 0.1548 0.1243 0.0896 -0.0216 -0.0362 0.0151 91 TYR B OH 2667 N N . GLY B 92 ? 0.1929 0.1445 0.1402 -0.0217 -0.0273 0.0087 92 GLY B N 2668 C CA . GLY B 92 ? 0.1781 0.1529 0.1798 -0.0416 -0.0323 -0.0246 92 GLY B CA 2669 C C . GLY B 92 ? 0.2036 0.1157 0.1218 -0.0418 -0.0411 -0.0308 92 GLY B C 2670 O O . GLY B 92 ? 0.1865 0.1172 0.1257 -0.0338 -0.0487 -0.0033 92 GLY B O 2671 N N . PRO B 93 ? 0.2057 0.1178 0.1517 -0.0313 -0.0473 -0.0300 93 PRO B N 2672 C CA . PRO B 93 ? 0.2065 0.1243 0.1338 -0.0098 -0.0555 -0.0244 93 PRO B CA 2673 C C . PRO B 93 ? 0.2126 0.1263 0.1418 -0.0014 -0.0392 -0.0299 93 PRO B C 2674 O O . PRO B 93 ? 0.2271 0.1250 0.1877 0.0116 0.0067 -0.0301 93 PRO B O 2675 C CB . PRO B 93 ? 0.2695 0.1228 0.1966 0.0177 -0.0565 -0.0137 93 PRO B CB 2676 C CG . PRO B 93 ? 0.3199 0.1240 0.3395 -0.0501 0.0173 -0.0694 93 PRO B CG 2677 C CD . PRO B 93 ? 0.2658 0.1168 0.2302 -0.0592 -0.0253 -0.0394 93 PRO B CD 2678 N N . ASP B 94 ? 0.2328 0.1573 0.1327 -0.0368 -0.0720 -0.0213 94 ASP B N 2679 C CA . ASP B 94 ? 0.2635 0.1796 0.1229 -0.0056 -0.0456 -0.0243 94 ASP B CA 2680 C C . ASP B 94 ? 0.2726 0.1425 0.1271 0.0232 -0.0370 0.0027 94 ASP B C 2681 O O . ASP B 94 ? 0.3499 0.1803 0.1586 0.0272 0.0149 0.0159 94 ASP B O 2682 C CB . ASP B 94 ? 0.3110 0.2290 0.1551 0.0253 -0.0896 -0.0229 94 ASP B CB 2683 C CG . ASP B 94 ? 0.2999 0.2604 0.3030 0.0410 -0.1060 -0.0701 94 ASP B CG 2684 O OD1 . ASP B 94 ? 0.3675 0.3731 0.2868 0.1326 -0.0805 -0.1030 94 ASP B OD1 2685 O OD2 . ASP B 94 ? 0.3319 0.5378 0.5168 0.1062 -0.2120 -0.1926 94 ASP B OD2 2686 N N . MET B 95 ? 0.2202 0.1341 0.1414 -0.0015 -0.0347 -0.0080 95 MET B N 2687 C CA . MET B 95 ? 0.2138 0.1231 0.1745 -0.0080 0.0074 -0.0003 95 MET B CA 2688 C C . MET B 95 ? 0.2239 0.1198 0.1317 -0.0147 -0.0223 0.0016 95 MET B C 2689 O O . MET B 95 ? 0.2179 0.1328 0.1753 -0.0204 -0.0123 -0.0058 95 MET B O 2690 C CB . MET B 95 ? 0.2775 0.1248 0.2293 -0.0128 0.0291 -0.0486 95 MET B CB 2691 C CG . MET B 95 ? 0.3777 0.2600 0.3019 0.1476 0.0795 0.0324 95 MET B CG 2692 S SD . MET B 95 ? 0.3311 0.3325 0.6726 0.1719 0.1835 0.2068 95 MET B SD 2693 C CE . MET B 95 ? 1.8959 0.2020 0.2869 -0.1563 0.4305 0.0018 95 MET B CE 2694 N N . ILE B 96 ? 0.2156 0.1343 0.1411 0.0026 0.0100 -0.0042 96 ILE B N 2695 C CA . ILE B 96 ? 0.2146 0.1698 0.1384 -0.0001 0.0199 0.0074 96 ILE B CA 2696 C C . ILE B 96 ? 0.2031 0.1557 0.1048 -0.0329 -0.0121 -0.0159 96 ILE B C 2697 O O . ILE B 96 ? 0.2465 0.1747 0.1455 -0.0250 -0.0232 -0.0424 96 ILE B O 2698 C CB . ILE B 96 ? 0.2481 0.1823 0.1068 0.0116 -0.0398 0.0094 96 ILE B CB 2699 C CG1 . ILE B 96 ? 0.2565 0.2082 0.0967 0.0059 -0.0429 0.0137 96 ILE B CG1 2700 C CG2 . ILE B 96 ? 0.2390 0.1845 0.1685 -0.0108 -0.0359 0.0146 96 ILE B CG2 2701 C CD1 . ILE B 96 ? 0.2803 0.2894 0.1614 -0.0848 0.0461 -0.0582 96 ILE B CD1 2702 N N . VAL B 97 ? 0.2051 0.1530 0.1203 -0.0332 -0.0133 -0.0113 97 VAL B N 2703 C CA . VAL B 97 ? 0.2201 0.1435 0.1368 -0.0566 -0.0118 -0.0127 97 VAL B CA 2704 C C . VAL B 97 ? 0.2162 0.1578 0.1111 -0.0441 -0.0028 -0.0233 97 VAL B C 2705 O O . VAL B 97 ? 0.2419 0.1850 0.1204 -0.0330 -0.0186 -0.0134 97 VAL B O 2706 C CB . VAL B 97 ? 0.2135 0.1455 0.1355 -0.0558 -0.0159 -0.0143 97 VAL B CB 2707 C CG1 . VAL B 97 ? 0.2233 0.1532 0.1839 -0.0729 -0.0445 -0.0245 97 VAL B CG1 2708 C CG2 . VAL B 97 ? 0.2398 0.1561 0.1805 -0.0218 -0.0866 -0.0364 97 VAL B CG2 2709 N N . GLU B 98 ? 0.2430 0.1858 0.1412 -0.0666 0.0305 -0.0332 98 GLU B N 2710 C CA . GLU B 98 ? 0.2383 0.2312 0.2106 -0.0730 0.0307 -0.0749 98 GLU B CA 2711 C C . GLU B 98 ? 0.2218 0.1838 0.1710 -0.0563 0.0276 -0.0326 98 GLU B C 2712 O O . GLU B 98 ? 0.2439 0.1838 0.1746 -0.0514 -0.0440 -0.0248 98 GLU B O 2713 C CB . GLU B 98 ? 0.2682 0.4613 0.2258 -0.1148 0.0799 -0.1309 98 GLU B CB 2714 C CG . GLU B 98 ? 0.2779 0.5595 0.2512 -0.0835 0.0639 -0.0125 98 GLU B CG 2715 C CD . GLU B 98 ? 0.2385 0.5040 0.2813 -0.1126 0.0900 0.0000 98 GLU B CD 2716 O OE1 . GLU B 98 ? 0.3045 0.4239 0.3510 -0.1913 0.1960 0.0983 98 GLU B OE1 2717 O OE2 . GLU B 98 ? 0.1693 0.4265 0.3165 -0.1879 -0.0097 -0.1321 98 GLU B OE2 2718 N N . TRP B 99 ? 0.2173 0.1958 0.1647 -0.0030 0.0431 -0.0397 99 TRP B N 2719 C CA . TRP B 99 ? 0.1907 0.2210 0.1600 -0.0133 0.0511 -0.0458 99 TRP B CA 2720 C C . TRP B 99 ? 0.1748 0.1908 0.1065 -0.0102 0.0222 -0.0099 99 TRP B C 2721 O O . TRP B 99 ? 0.2020 0.1879 0.1264 0.0186 0.0291 0.0164 99 TRP B O 2722 C CB . TRP B 99 ? 0.2136 0.2707 0.1326 -0.0486 0.0601 -0.0426 99 TRP B CB 2723 C CG . TRP B 99 ? 0.1773 0.2377 0.1994 0.0213 0.0159 -0.0809 99 TRP B CG 2724 C CD1 . TRP B 99 ? 0.1810 0.2237 0.2219 0.0002 0.0381 -0.0803 99 TRP B CD1 2725 C CD2 . TRP B 99 ? 0.2142 0.2510 0.3391 0.0357 -0.0730 -0.1049 99 TRP B CD2 2726 N NE1 . TRP B 99 ? 0.3098 0.2713 0.2140 -0.0028 -0.0004 -0.0984 99 TRP B NE1 2727 C CE2 . TRP B 99 ? 0.2869 0.3835 0.2816 0.0854 -0.0771 -0.1299 99 TRP B CE2 2728 C CE3 . TRP B 99 ? 0.4335 0.3043 0.4924 0.1488 -0.1625 -0.1374 99 TRP B CE3 2729 C CZ2 . TRP B 99 ? 0.4119 0.4841 0.4199 0.1115 -0.2061 -0.1349 99 TRP B CZ2 2730 C CZ3 . TRP B 99 ? 0.5986 0.4004 0.6070 0.2378 -0.2630 -0.1240 99 TRP B CZ3 2731 C CH2 . TRP B 99 ? 0.6023 0.4687 0.5638 0.1760 -0.2920 -0.0815 99 TRP B CH2 2732 N N . SER B 100 ? 0.1407 0.1800 0.1233 -0.0061 0.0067 -0.0108 100 SER B N 2733 C CA . SER B 100 ? 0.1293 0.1497 0.1027 0.0025 -0.0026 -0.0098 100 SER B CA 2734 C C . SER B 100 ? 0.1320 0.1331 0.1187 -0.0184 -0.0159 -0.0019 100 SER B C 2735 O O . SER B 100 ? 0.1484 0.1476 0.1160 -0.0390 -0.0122 -0.0120 100 SER B O 2736 C CB . SER B 100 ? 0.1342 0.1904 0.1000 -0.0110 -0.0002 -0.0238 100 SER B CB 2737 O OG . SER B 100 ? 0.1918 0.2631 0.1206 0.0122 -0.0469 -0.0150 100 SER B OG 2738 N N . PRO B 101 ? 0.1297 0.1412 0.1314 -0.0186 -0.0235 0.0084 101 PRO B N 2739 C CA . PRO B 101 ? 0.1425 0.1328 0.1268 0.0044 -0.0070 0.0063 101 PRO B CA 2740 C C . PRO B 101 ? 0.1407 0.1167 0.1261 0.0196 -0.0113 0.0194 101 PRO B C 2741 O O . PRO B 101 ? 0.1681 0.1074 0.1302 0.0061 -0.0001 0.0080 101 PRO B O 2742 C CB . PRO B 101 ? 0.1223 0.2382 0.1784 0.0095 -0.0290 0.0482 101 PRO B CB 2743 C CG . PRO B 101 ? 0.1598 0.2188 0.1154 -0.0621 -0.0309 0.0166 101 PRO B CG 2744 C CD . PRO B 101 ? 0.1588 0.1371 0.1113 -0.0326 -0.0230 -0.0052 101 PRO B CD 2745 N N . ALA B 102 ? 0.1307 0.1103 0.1047 0.0078 -0.0178 0.0323 102 ALA B N 2746 C CA . ALA B 102 ? 0.1385 0.0925 0.1068 -0.0187 -0.0108 0.0078 102 ALA B CA 2747 C C . ALA B 102 ? 0.1373 0.0751 0.1072 -0.0092 -0.0168 0.0107 102 ALA B C 2748 O O . ALA B 102 ? 0.1418 0.0945 0.0925 -0.0144 -0.0140 0.0094 102 ALA B O 2749 C CB . ALA B 102 ? 0.1647 0.0948 0.0948 -0.0273 -0.0230 0.0107 102 ALA B CB 2750 N N . THR B 103 ? 0.1195 0.0888 0.0951 -0.0216 -0.0011 0.0022 103 THR B N 2751 C CA . THR B 103 ? 0.1099 0.1044 0.1401 -0.0259 -0.0098 0.0270 103 THR B CA 2752 C C . THR B 103 ? 0.1196 0.1023 0.0951 -0.0231 -0.0276 0.0012 103 THR B C 2753 O O . THR B 103 ? 0.1303 0.0953 0.1225 -0.0251 -0.0407 0.0177 103 THR B O 2754 C CB . THR B 103 ? 0.1435 0.1269 0.1625 -0.0159 -0.0506 0.0366 103 THR B CB 2755 O OG1 . THR B 103 ? 0.1584 0.1328 0.1860 0.0037 -0.0329 0.0521 103 THR B OG1 2756 C CG2 . THR B 103 ? 0.1475 0.2534 0.2112 -0.0675 -0.0654 0.1329 103 THR B CG2 2757 N N . GLU B 104 ? 0.1366 0.1093 0.0901 -0.0212 -0.0284 -0.0060 104 GLU B N 2758 C CA . GLU B 104 ? 0.1386 0.1017 0.1151 -0.0269 -0.0270 -0.0103 104 GLU B CA 2759 C C . GLU B 104 ? 0.1227 0.0882 0.1100 -0.0090 -0.0255 -0.0150 104 GLU B C 2760 O O . GLU B 104 ? 0.1939 0.0990 0.1285 -0.0388 -0.0192 -0.0041 104 GLU B O 2761 C CB . GLU B 104 ? 0.2011 0.1421 0.1620 -0.0106 0.0401 -0.0081 104 GLU B CB 2762 C CG . GLU B 104 ? 0.6477 0.1849 0.5268 0.1812 0.0765 -0.0932 104 GLU B CG 2763 C CD . GLU B 104 ? 0.8028 0.3664 0.6493 0.2918 0.1886 -0.1876 104 GLU B CD 2764 O OE1 . GLU B 104 ? 0.8553 0.6010 0.6081 0.1692 0.3069 -0.1040 104 GLU B OE1 2765 O OE2 . GLU B 104 ? 1.1954 0.6599 0.6362 0.2399 0.1505 -0.3341 104 GLU B OE2 2766 N N . ARG B 105 ? 0.1277 0.0810 0.0998 -0.0024 -0.0154 -0.0031 105 ARG B N 2767 C CA . ARG B 105 ? 0.1281 0.0905 0.0978 0.0067 -0.0326 0.0025 105 ARG B CA 2768 C C . ARG B 105 ? 0.1249 0.0956 0.0906 -0.0017 -0.0242 0.0144 105 ARG B C 2769 O O . ARG B 105 ? 0.1537 0.0925 0.1208 0.0040 -0.0147 0.0219 105 ARG B O 2770 C CB . ARG B 105 ? 0.1316 0.0704 0.1117 -0.0103 -0.0313 0.0126 105 ARG B CB 2771 C CG . ARG B 105 ? 0.1279 0.0999 0.1076 0.0034 -0.0440 0.0126 105 ARG B CG 2772 C CD . ARG B 105 ? 0.1265 0.1532 0.1029 0.0018 -0.0505 -0.0150 105 ARG B CD 2773 N NE . ARG B 105 ? 0.1344 0.1247 0.1166 -0.0105 -0.0432 0.0100 105 ARG B NE 2774 C CZ . ARG B 105 ? 0.1457 0.1279 0.0932 -0.0254 -0.0508 0.0200 105 ARG B CZ 2775 N NH1 . ARG B 105 ? 0.1779 0.1309 0.1265 -0.0352 -0.0184 0.0072 105 ARG B NH1 2776 N NH2 . ARG B 105 ? 0.1598 0.1535 0.1393 -0.0181 -0.0232 0.0258 105 ARG B NH2 2777 N N . PHE B 106 ? 0.1278 0.0896 0.0777 0.0008 -0.0255 0.0076 106 PHE B N 2778 C CA . PHE B 106 ? 0.1230 0.0873 0.0929 -0.0116 -0.0206 0.0116 106 PHE B CA 2779 C C . PHE B 106 ? 0.1278 0.0772 0.1041 -0.0255 -0.0222 0.0197 106 PHE B C 2780 O O . PHE B 106 ? 0.1245 0.0995 0.1136 -0.0300 -0.0342 0.0066 106 PHE B O 2781 C CB . PHE B 106 ? 0.1070 0.0844 0.1040 0.0007 -0.0427 0.0131 106 PHE B CB 2782 C CG . PHE B 106 ? 0.1060 0.0794 0.1020 0.0023 -0.0362 0.0095 106 PHE B CG 2783 C CD1 . PHE B 106 ? 0.1105 0.1292 0.1231 -0.0220 -0.0232 -0.0039 106 PHE B CD1 2784 C CD2 . PHE B 106 ? 0.1438 0.0873 0.1023 0.0071 -0.0133 0.0064 106 PHE B CD2 2785 C CE1 . PHE B 106 ? 0.1699 0.1446 0.1368 -0.0545 -0.0221 -0.0259 106 PHE B CE1 2786 C CE2 . PHE B 106 ? 0.1426 0.1255 0.1051 0.0249 -0.0277 0.0073 106 PHE B CE2 2787 C CZ . PHE B 106 ? 0.1314 0.1363 0.1243 0.0212 -0.0413 -0.0241 106 PHE B CZ 2788 N N . LEU B 107 ? 0.1250 0.0953 0.1211 -0.0257 -0.0259 0.0073 107 LEU B N 2789 C CA . LEU B 107 ? 0.1453 0.1012 0.1138 -0.0322 -0.0230 0.0029 107 LEU B CA 2790 C C . LEU B 107 ? 0.1328 0.0857 0.1308 -0.0256 -0.0293 0.0065 107 LEU B C 2791 O O . LEU B 107 ? 0.1402 0.1038 0.1354 -0.0211 -0.0411 0.0278 107 LEU B O 2792 C CB . LEU B 107 ? 0.1446 0.1247 0.1271 -0.0157 -0.0196 -0.0065 107 LEU B CB 2793 C CG . LEU B 107 ? 0.1868 0.1240 0.1478 -0.0282 -0.0338 -0.0214 107 LEU B CG 2794 C CD1 . LEU B 107 ? 0.1843 0.1444 0.1596 -0.0363 -0.0563 -0.0137 107 LEU B CD1 2795 C CD2 . LEU B 107 ? 0.2296 0.2045 0.1781 -0.0059 -0.0316 -0.0687 107 LEU B CD2 2796 N N . ALA B 108 ? 0.1248 0.0919 0.1252 -0.0147 -0.0366 0.0030 108 ALA B N 2797 C CA . ALA B 108 ? 0.1361 0.0701 0.1595 -0.0216 -0.0391 0.0010 108 ALA B CA 2798 C C . ALA B 108 ? 0.1377 0.0638 0.1529 -0.0203 -0.0256 0.0295 108 ALA B C 2799 O O . ALA B 108 ? 0.1478 0.0913 0.1573 -0.0184 -0.0229 0.0131 108 ALA B O 2800 C CB . ALA B 108 ? 0.1592 0.0936 0.1645 0.0030 -0.0058 0.0221 108 ALA B CB 2801 N N . SER B 109 ? 0.1342 0.0900 0.1192 -0.0104 -0.0124 0.0191 109 SER B N 2802 C CA . SER B 109 ? 0.1275 0.0928 0.1444 -0.0115 -0.0004 0.0200 109 SER B CA 2803 C C . SER B 109 ? 0.1373 0.0897 0.1728 -0.0061 -0.0119 0.0215 109 SER B C 2804 O O . SER B 109 ? 0.1559 0.1508 0.2071 0.0222 0.0099 0.0341 109 SER B O 2805 C CB . SER B 109 ? 0.1697 0.0950 0.1204 -0.0097 -0.0092 0.0131 109 SER B CB 2806 O OG . SER B 109 ? 0.1914 0.0991 0.1161 -0.0279 -0.0019 0.0045 109 SER B OG 2807 N N . GLY B 110 ? 0.1363 0.0897 0.1748 -0.0016 -0.0214 0.0320 110 GLY B N 2808 C CA . GLY B 110 ? 0.1570 0.0978 0.2337 -0.0137 -0.0783 0.0237 110 GLY B CA 2809 C C . GLY B 110 ? 0.1118 0.1019 0.1626 -0.0197 -0.0318 0.0394 110 GLY B C 2810 O O . GLY B 110 ? 0.1363 0.1111 0.1524 -0.0127 -0.0394 0.0271 110 GLY B O 2811 N N . HIS B 111 ? 0.1065 0.0924 0.1592 -0.0130 -0.0333 0.0331 111 HIS B N 2812 C CA . HIS B 111 ? 0.0983 0.0955 0.1445 -0.0061 -0.0226 0.0102 111 HIS B CA 2813 C C . HIS B 111 ? 0.1020 0.0826 0.1299 -0.0010 -0.0189 0.0059 111 HIS B C 2814 O O . HIS B 111 ? 0.1285 0.0847 0.1220 0.0108 -0.0340 -0.0025 111 HIS B O 2815 C CB . HIS B 111 ? 0.1063 0.1202 0.1604 -0.0052 -0.0058 0.0299 111 HIS B CB 2816 C CG . HIS B 111 ? 0.1244 0.1745 0.1583 0.0306 0.0144 0.0419 111 HIS B CG 2817 N ND1 . HIS B 111 ? 0.2053 0.2273 0.1979 0.0501 0.0514 0.0935 111 HIS B ND1 2818 C CD2 . HIS B 111 ? 0.1646 0.2484 0.1425 0.0398 0.0118 -0.0018 111 HIS B CD2 2819 C CE1 . HIS B 111 ? 0.2159 0.3363 0.1842 0.1078 0.0592 0.1019 111 HIS B CE1 2820 N NE2 . HIS B 111 ? 0.2113 0.3449 0.1523 0.1129 0.0184 0.0288 111 HIS B NE2 2821 N N . MET B 112 ? 0.1136 0.0912 0.1203 -0.0073 -0.0304 0.0111 112 MET B N 2822 C CA . MET B 112 ? 0.1257 0.0873 0.1136 -0.0117 -0.0099 0.0008 112 MET B CA 2823 C C . MET B 112 ? 0.1153 0.0854 0.1273 -0.0029 -0.0053 0.0243 112 MET B C 2824 O O . MET B 112 ? 0.1407 0.1003 0.1203 -0.0043 -0.0171 0.0184 112 MET B O 2825 C CB . MET B 112 ? 0.1201 0.1042 0.1519 0.0021 -0.0005 0.0176 112 MET B CB 2826 C CG A MET B 112 ? 0.1073 0.1081 0.2178 -0.0035 -0.0095 -0.0068 112 MET B CG 2827 C CG B MET B 112 ? 0.1361 0.1357 0.0987 0.0396 -0.0249 0.0488 112 MET B CG 2828 S SD A MET B 112 ? 0.1393 0.1915 0.2437 0.0109 0.0338 0.0131 112 MET B SD 2829 S SD B MET B 112 ? 0.1288 0.1053 0.1299 0.0331 -0.0216 0.0327 112 MET B SD 2830 C CE A MET B 112 ? 0.1351 0.1392 0.5708 -0.0392 -0.1433 0.1015 112 MET B CE 2831 C CE B MET B 112 ? 0.0972 0.1206 0.0981 0.0369 0.0101 0.0134 112 MET B CE 2832 N N . THR B 113 ? 0.1232 0.0839 0.1369 -0.0068 -0.0120 0.0086 113 THR B N 2833 C CA . THR B 113 ? 0.1191 0.0982 0.1327 -0.0037 0.0062 0.0146 113 THR B CA 2834 C C . THR B 113 ? 0.1056 0.1034 0.1241 -0.0025 0.0112 0.0211 113 THR B C 2835 O O . THR B 113 ? 0.0890 0.1076 0.1290 -0.0081 0.0010 0.0067 113 THR B O 2836 C CB . THR B 113 ? 0.1087 0.1236 0.1374 -0.0200 0.0439 -0.0051 113 THR B CB 2837 O OG1 . THR B 113 ? 0.1255 0.1465 0.1273 -0.0249 0.0123 0.0084 113 THR B OG1 2838 C CG2 . THR B 113 ? 0.1511 0.1579 0.1397 -0.0284 0.0161 0.0358 113 THR B CG2 2839 N N . VAL B 114 ? 0.0923 0.1107 0.1445 -0.0078 0.0146 0.0294 114 VAL B N 2840 C CA . VAL B 114 ? 0.1052 0.0945 0.1607 -0.0194 -0.0012 0.0235 114 VAL B CA 2841 C C . VAL B 114 ? 0.0885 0.1171 0.1326 -0.0018 -0.0026 0.0202 114 VAL B C 2842 O O . VAL B 114 ? 0.1054 0.1145 0.1360 -0.0226 0.0135 0.0096 114 VAL B O 2843 C CB . VAL B 114 ? 0.1148 0.1207 0.1576 0.0070 -0.0006 0.0482 114 VAL B CB 2844 C CG1 . VAL B 114 ? 0.1519 0.0971 0.1703 -0.0148 -0.0065 0.0096 114 VAL B CG1 2845 C CG2 . VAL B 114 ? 0.1365 0.1156 0.2601 -0.0200 -0.0376 0.0582 114 VAL B CG2 2846 N N . LEU B 115 ? 0.1077 0.1293 0.1312 -0.0042 0.0123 0.0085 115 LEU B N 2847 C CA . LEU B 115 ? 0.1250 0.1120 0.1299 -0.0150 -0.0010 -0.0058 115 LEU B CA 2848 C C . LEU B 115 ? 0.1009 0.1239 0.0960 -0.0205 0.0049 -0.0009 115 LEU B C 2849 O O . LEU B 115 ? 0.1123 0.1252 0.1289 -0.0265 0.0103 -0.0078 115 LEU B O 2850 C CB . LEU B 115 ? 0.1302 0.1368 0.1344 0.0014 0.0113 -0.0071 115 LEU B CB 2851 C CG . LEU B 115 ? 0.1386 0.1614 0.2286 0.0043 0.0555 -0.0438 115 LEU B CG 2852 C CD1 . LEU B 115 ? 0.1924 0.2491 0.2422 0.0069 0.0055 -0.1264 115 LEU B CD1 2853 C CD2 . LEU B 115 ? 0.1564 0.1317 0.3833 -0.0266 0.0166 -0.0454 115 LEU B CD2 2854 N N . GLU B 116 ? 0.1075 0.1243 0.0993 -0.0144 -0.0019 0.0084 116 GLU B N 2855 C CA . GLU B 116 ? 0.1248 0.1250 0.1023 -0.0083 0.0000 0.0139 116 GLU B CA 2856 C C . GLU B 116 ? 0.1015 0.1031 0.0996 -0.0113 -0.0060 0.0021 116 GLU B C 2857 O O . GLU B 116 ? 0.0936 0.1285 0.1093 -0.0071 -0.0070 0.0193 116 GLU B O 2858 C CB . GLU B 116 ? 0.1210 0.1273 0.1300 -0.0096 -0.0208 0.0358 116 GLU B CB 2859 C CG . GLU B 116 ? 0.1483 0.1490 0.1437 -0.0255 -0.0125 0.0451 116 GLU B CG 2860 C CD . GLU B 116 ? 0.1473 0.1235 0.1123 -0.0054 -0.0086 0.0233 116 GLU B CD 2861 O OE1 . GLU B 116 ? 0.1704 0.1111 0.1211 -0.0125 -0.0172 0.0231 116 GLU B OE1 2862 O OE2 . GLU B 116 ? 0.1875 0.1211 0.1194 -0.0149 -0.0170 0.0264 116 GLU B OE2 2863 N N . ALA B 117 ? 0.0903 0.1195 0.1087 -0.0154 -0.0035 0.0160 117 ALA B N 2864 C CA . ALA B 117 ? 0.0966 0.1156 0.0989 -0.0196 -0.0075 0.0175 117 ALA B CA 2865 C C . ALA B 117 ? 0.0860 0.1094 0.1015 -0.0086 -0.0081 0.0233 117 ALA B C 2866 O O . ALA B 117 ? 0.0816 0.0999 0.1121 -0.0133 -0.0020 0.0147 117 ALA B O 2867 C CB . ALA B 117 ? 0.1117 0.1027 0.1252 -0.0212 -0.0295 0.0073 117 ALA B CB 2868 N N . ALA B 118 ? 0.0832 0.1183 0.1098 -0.0193 0.0051 0.0090 118 ALA B N 2869 C CA . ALA B 118 ? 0.0842 0.1085 0.1298 -0.0095 -0.0110 0.0156 118 ALA B CA 2870 C C . ALA B 118 ? 0.0806 0.1067 0.0957 -0.0051 -0.0028 0.0042 118 ALA B C 2871 O O . ALA B 118 ? 0.0882 0.1297 0.0880 -0.0101 -0.0121 0.0163 118 ALA B O 2872 C CB . ALA B 118 ? 0.0991 0.1050 0.1502 0.0007 -0.0202 0.0239 118 ALA B CB 2873 N N . GLN B 119 ? 0.0880 0.0949 0.0968 -0.0117 -0.0012 0.0012 119 GLN B N 2874 C CA . GLN B 119 ? 0.0908 0.1062 0.1015 -0.0111 -0.0060 0.0121 119 GLN B CA 2875 C C . GLN B 119 ? 0.0872 0.1026 0.0912 -0.0101 -0.0088 0.0215 119 GLN B C 2876 O O . GLN B 119 ? 0.0786 0.1180 0.0858 -0.0083 -0.0111 0.0093 119 GLN B O 2877 C CB . GLN B 119 ? 0.0924 0.1607 0.1040 -0.0162 -0.0008 0.0135 119 GLN B CB 2878 C CG . GLN B 119 ? 0.1042 0.1730 0.1034 -0.0053 -0.0215 0.0152 119 GLN B CG 2879 C CD . GLN B 119 ? 0.1301 0.1814 0.1162 -0.0323 -0.0176 0.0382 119 GLN B CD 2880 O OE1 . GLN B 119 ? 0.1425 0.1884 0.1036 -0.0094 -0.0028 0.0274 119 GLN B OE1 2881 N NE2 . GLN B 119 ? 0.1339 0.2100 0.0983 -0.0107 -0.0180 0.0177 119 GLN B NE2 2882 N N . ALA B 120 ? 0.0947 0.1097 0.0819 -0.0124 -0.0086 0.0056 120 ALA B N 2883 C CA . ALA B 120 ? 0.0963 0.1059 0.0842 0.0023 -0.0119 0.0162 120 ALA B CA 2884 C C . ALA B 120 ? 0.0867 0.0974 0.0655 -0.0199 -0.0266 -0.0004 120 ALA B C 2885 O O . ALA B 120 ? 0.0875 0.0978 0.0787 -0.0150 -0.0180 0.0000 120 ALA B O 2886 C CB . ALA B 120 ? 0.1091 0.0891 0.1399 -0.0011 0.0036 0.0189 120 ALA B CB 2887 N N . ALA B 121 ? 0.0915 0.0979 0.0778 -0.0061 -0.0171 0.0100 121 ALA B N 2888 C CA . ALA B 121 ? 0.0999 0.0999 0.0989 -0.0084 -0.0268 0.0219 121 ALA B CA 2889 C C . ALA B 121 ? 0.0834 0.0917 0.0817 0.0043 -0.0250 0.0193 121 ALA B C 2890 O O . ALA B 121 ? 0.1132 0.1251 0.0999 -0.0063 -0.0011 0.0199 121 ALA B O 2891 C CB . ALA B 121 ? 0.1147 0.1213 0.0930 -0.0039 -0.0540 0.0154 121 ALA B CB 2892 N N . VAL B 122 ? 0.0838 0.0987 0.0825 -0.0029 -0.0285 0.0230 122 VAL B N 2893 C CA . VAL B 122 ? 0.1031 0.0822 0.1126 -0.0050 -0.0326 0.0133 122 VAL B CA 2894 C C . VAL B 122 ? 0.0838 0.1008 0.0798 -0.0085 -0.0158 0.0174 122 VAL B C 2895 O O . VAL B 122 ? 0.0973 0.1330 0.1157 -0.0050 -0.0039 0.0327 122 VAL B O 2896 C CB . VAL B 122 ? 0.1016 0.0987 0.1000 -0.0119 -0.0178 0.0101 122 VAL B CB 2897 C CG1 . VAL B 122 ? 0.1234 0.1094 0.1278 -0.0166 -0.0280 -0.0035 122 VAL B CG1 2898 C CG2 . VAL B 122 ? 0.1161 0.1014 0.1451 0.0049 -0.0151 0.0154 122 VAL B CG2 2899 N N . GLN B 123 ? 0.1023 0.0845 0.0735 -0.0150 -0.0291 0.0099 123 GLN B N 2900 C CA . GLN B 123 ? 0.1086 0.0871 0.0744 -0.0061 -0.0247 0.0083 123 GLN B CA 2901 C C . GLN B 123 ? 0.1158 0.0768 0.0752 -0.0117 -0.0342 0.0057 123 GLN B C 2902 O O . GLN B 123 ? 0.1150 0.0925 0.1038 -0.0030 -0.0290 0.0014 123 GLN B O 2903 C CB . GLN B 123 ? 0.1334 0.1061 0.0718 -0.0289 -0.0329 -0.0034 123 GLN B CB 2904 C CG . GLN B 123 ? 0.1375 0.1118 0.0831 0.0087 -0.0136 0.0001 123 GLN B CG 2905 C CD . GLN B 123 ? 0.1128 0.1176 0.0884 -0.0049 -0.0164 -0.0092 123 GLN B CD 2906 O OE1 . GLN B 123 ? 0.1498 0.1364 0.1013 -0.0252 -0.0185 0.0108 123 GLN B OE1 2907 N NE2 . GLN B 123 ? 0.1145 0.1690 0.0891 -0.0332 -0.0343 -0.0025 123 GLN B NE2 2908 N N . LEU B 124 ? 0.1025 0.0870 0.0911 -0.0023 -0.0211 -0.0049 124 LEU B N 2909 C CA . LEU B 124 ? 0.1033 0.0899 0.0993 -0.0010 -0.0229 -0.0097 124 LEU B CA 2910 C C . LEU B 124 ? 0.1207 0.0856 0.0957 -0.0165 -0.0270 -0.0079 124 LEU B C 2911 O O . LEU B 124 ? 0.1878 0.1004 0.0929 0.0045 -0.0233 -0.0105 124 LEU B O 2912 C CB . LEU B 124 ? 0.1353 0.0864 0.1133 -0.0070 -0.0464 0.0118 124 LEU B CB 2913 C CG . LEU B 124 ? 0.2336 0.1201 0.1097 -0.0433 -0.0527 0.0127 124 LEU B CG 2914 C CD1 . LEU B 124 ? 0.2222 0.1262 0.1157 -0.0357 -0.0481 0.0235 124 LEU B CD1 2915 C CD2 . LEU B 124 ? 0.3132 0.2733 0.3912 -0.1735 -0.2761 0.2110 124 LEU B CD2 2916 N N . SER B 125 ? 0.1194 0.0975 0.0804 -0.0116 -0.0123 -0.0067 125 SER B N 2917 C CA . SER B 125 ? 0.1137 0.1003 0.0866 -0.0131 -0.0171 -0.0001 125 SER B CA 2918 C C . SER B 125 ? 0.0977 0.1162 0.0884 -0.0114 -0.0232 -0.0082 125 SER B C 2919 O O . SER B 125 ? 0.1539 0.1411 0.0854 -0.0490 -0.0025 -0.0200 125 SER B O 2920 C CB . SER B 125 ? 0.1013 0.0973 0.1078 -0.0099 -0.0057 0.0008 125 SER B CB 2921 O OG . SER B 125 ? 0.1715 0.1340 0.1051 -0.0452 -0.0226 0.0141 125 SER B OG 2922 N N . ASP B 126 ? 0.1179 0.0891 0.0788 -0.0132 -0.0181 -0.0041 126 ASP B N 2923 C CA . ASP B 126 ? 0.1082 0.1169 0.0737 -0.0168 -0.0167 -0.0066 126 ASP B CA 2924 C C . ASP B 126 ? 0.1196 0.1049 0.0796 -0.0179 -0.0262 -0.0062 126 ASP B C 2925 O O . ASP B 126 ? 0.1215 0.1085 0.0919 -0.0164 -0.0287 -0.0033 126 ASP B O 2926 C CB . ASP B 126 ? 0.1114 0.1098 0.0859 -0.0171 -0.0314 0.0063 126 ASP B CB 2927 C CG . ASP B 126 ? 0.1372 0.0993 0.0823 -0.0215 -0.0214 -0.0071 126 ASP B CG 2928 O OD1 . ASP B 126 ? 0.1354 0.1111 0.0905 -0.0254 -0.0311 -0.0010 126 ASP B OD1 2929 O OD2 . ASP B 126 ? 0.1431 0.1463 0.1190 -0.0390 -0.0490 0.0340 126 ASP B OD2 2930 N N . ASN B 127 ? 0.1261 0.1170 0.0741 -0.0256 -0.0184 -0.0049 127 ASN B N 2931 C CA . ASN B 127 ? 0.1436 0.1267 0.0819 -0.0244 -0.0320 -0.0013 127 ASN B CA 2932 C C . ASN B 127 ? 0.1490 0.1312 0.0697 -0.0336 -0.0419 0.0106 127 ASN B C 2933 O O . ASN B 127 ? 0.1408 0.1580 0.0955 -0.0416 -0.0549 0.0251 127 ASN B O 2934 C CB . ASN B 127 ? 0.1989 0.1358 0.0746 -0.0439 -0.0104 0.0075 127 ASN B CB 2935 C CG . ASN B 127 ? 0.2105 0.1445 0.1203 -0.0685 0.0222 -0.0394 127 ASN B CG 2936 O OD1 . ASN B 127 ? 0.2373 0.1415 0.1163 -0.0661 -0.0227 0.0043 127 ASN B OD1 2937 N ND2 . ASN B 127 ? 0.3019 0.1922 0.4151 -0.0428 0.1718 -0.0480 127 ASN B ND2 2938 N N . GLY B 128 ? 0.1383 0.1376 0.1015 -0.0295 -0.0430 0.0069 128 GLY B N 2939 C CA . GLY B 128 ? 0.1542 0.1306 0.1259 -0.0513 -0.0365 0.0007 128 GLY B CA 2940 C C . GLY B 128 ? 0.1337 0.1251 0.1104 -0.0432 -0.0373 0.0213 128 GLY B C 2941 O O . GLY B 128 ? 0.1366 0.1374 0.1078 -0.0465 -0.0410 0.0207 128 GLY B O 2942 N N . ALA B 129 ? 0.1050 0.1245 0.1023 -0.0280 -0.0236 0.0198 129 ALA B N 2943 C CA . ALA B 129 ? 0.1037 0.1246 0.1101 -0.0151 -0.0172 0.0240 129 ALA B CA 2944 C C . ALA B 129 ? 0.1112 0.1333 0.0863 -0.0154 -0.0274 0.0175 129 ALA B C 2945 O O . ALA B 129 ? 0.1063 0.1208 0.1117 -0.0252 -0.0380 0.0185 129 ALA B O 2946 C CB . ALA B 129 ? 0.1571 0.1149 0.0957 -0.0045 -0.0321 0.0193 129 ALA B CB 2947 N N . THR B 130 ? 0.1084 0.1304 0.0934 -0.0309 -0.0355 0.0251 130 THR B N 2948 C CA . THR B 130 ? 0.1082 0.1272 0.1103 -0.0201 -0.0285 0.0249 130 THR B CA 2949 C C . THR B 130 ? 0.1136 0.1252 0.1246 -0.0301 -0.0471 0.0480 130 THR B C 2950 O O . THR B 130 ? 0.1178 0.1293 0.1298 -0.0258 -0.0344 0.0415 130 THR B O 2951 C CB . THR B 130 ? 0.1194 0.1237 0.1080 -0.0408 -0.0327 0.0206 130 THR B CB 2952 O OG1 . THR B 130 ? 0.1238 0.1371 0.1072 -0.0465 -0.0327 0.0154 130 THR B OG1 2953 C CG2 . THR B 130 ? 0.1146 0.1447 0.1358 -0.0368 -0.0312 0.0454 130 THR B CG2 2954 N N . ASN B 131 ? 0.1258 0.1257 0.1165 -0.0345 -0.0356 0.0387 131 ASN B N 2955 C CA . ASN B 131 ? 0.1515 0.1579 0.1086 -0.0503 -0.0498 0.0477 131 ASN B CA 2956 C C . ASN B 131 ? 0.1371 0.1453 0.1204 -0.0512 -0.0535 0.0371 131 ASN B C 2957 O O . ASN B 131 ? 0.1491 0.1977 0.1295 -0.0468 -0.0646 0.0411 131 ASN B O 2958 C CB . ASN B 131 ? 0.1379 0.1745 0.1214 -0.0682 -0.0436 0.0329 131 ASN B CB 2959 C CG . ASN B 131 ? 0.1638 0.1641 0.1409 -0.0541 -0.0237 0.0282 131 ASN B CG 2960 O OD1 . ASN B 131 ? 0.1859 0.1703 0.1158 -0.0597 -0.0166 0.0301 131 ASN B OD1 2961 N ND2 . ASN B 131 ? 0.1944 0.1728 0.1893 -0.0544 -0.0008 0.0144 131 ASN B ND2 2962 N N . LEU B 132 ? 0.1050 0.1450 0.1182 -0.0419 -0.0436 0.0294 132 LEU B N 2963 C CA . LEU B 132 ? 0.1012 0.1597 0.1401 -0.0345 -0.0344 0.0392 132 LEU B CA 2964 C C . LEU B 132 ? 0.0920 0.1594 0.1157 -0.0355 -0.0312 0.0480 132 LEU B C 2965 O O . LEU B 132 ? 0.0951 0.1811 0.1395 -0.0333 -0.0351 0.0467 132 LEU B O 2966 C CB . LEU B 132 ? 0.1560 0.1513 0.1502 -0.0429 -0.0350 0.0537 132 LEU B CB 2967 C CG . LEU B 132 ? 0.1873 0.2321 0.1763 -0.0686 -0.0269 0.0724 132 LEU B CG 2968 C CD1 . LEU B 132 ? 0.2081 0.2874 0.2767 -0.1379 -0.0970 0.1447 132 LEU B CD1 2969 C CD2 . LEU B 132 ? 0.3873 0.3386 0.2098 -0.2165 -0.1458 0.1792 132 LEU B CD2 2970 N N . LEU B 133 ? 0.0923 0.1437 0.1220 -0.0274 -0.0260 0.0497 133 LEU B N 2971 C CA . LEU B 133 ? 0.1117 0.1454 0.1472 -0.0220 -0.0330 0.0487 133 LEU B CA 2972 C C . LEU B 133 ? 0.1016 0.1359 0.1622 -0.0193 -0.0347 0.0494 133 LEU B C 2973 O O . LEU B 133 ? 0.1338 0.1818 0.1954 0.0129 -0.0330 0.0736 133 LEU B O 2974 C CB . LEU B 133 ? 0.0821 0.1487 0.1436 -0.0069 -0.0117 0.0170 133 LEU B CB 2975 C CG . LEU B 133 ? 0.1301 0.1482 0.1379 -0.0306 -0.0278 0.0241 133 LEU B CG 2976 C CD1 . LEU B 133 ? 0.1310 0.2308 0.1581 -0.0478 -0.0437 0.0335 133 LEU B CD1 2977 C CD2 . LEU B 133 ? 0.1482 0.1583 0.1450 -0.0114 -0.0131 0.0603 133 LEU B CD2 2978 N N . LEU B 134 ? 0.1135 0.1734 0.1480 -0.0263 -0.0332 0.0744 134 LEU B N 2979 C CA . LEU B 134 ? 0.1344 0.2313 0.1792 -0.0462 -0.0442 0.1247 134 LEU B CA 2980 C C . LEU B 134 ? 0.1437 0.2755 0.1564 -0.0591 -0.0467 0.1218 134 LEU B C 2981 O O . LEU B 134 ? 0.1440 0.3362 0.3177 -0.0638 -0.0945 0.2031 134 LEU B O 2982 C CB . LEU B 134 ? 0.1388 0.2369 0.1503 -0.0712 -0.0606 0.1161 134 LEU B CB 2983 C CG . LEU B 134 ? 0.1477 0.2393 0.1471 -0.0781 -0.0426 0.0853 134 LEU B CG 2984 C CD1 . LEU B 134 ? 0.1501 0.2361 0.1559 -0.0477 -0.0483 0.0890 134 LEU B CD1 2985 C CD2 . LEU B 134 ? 0.1750 0.2318 0.1746 -0.0824 -0.0101 0.0672 134 LEU B CD2 2986 N N . ARG B 135 ? 0.1313 0.2834 0.1603 -0.0725 -0.0359 0.1032 135 ARG B N 2987 C CA . ARG B 135 ? 0.1329 0.3072 0.1823 -0.0753 -0.0722 0.1057 135 ARG B CA 2988 C C . ARG B 135 ? 0.0991 0.2984 0.2478 -0.0555 -0.0740 0.0942 135 ARG B C 2989 O O . ARG B 135 ? 0.1015 0.4223 0.2802 -0.0358 -0.0769 0.1365 135 ARG B O 2990 C CB . ARG B 135 ? 0.1513 0.2954 0.2155 -0.0960 -0.0731 0.0573 135 ARG B CB 2991 C CG . ARG B 135 ? 0.2035 0.4054 0.3137 -0.1741 -0.1394 0.1596 135 ARG B CG 2992 C CD . ARG B 135 ? 0.2530 0.3897 0.5386 -0.2023 -0.1392 0.1410 135 ARG B CD 2993 N NE . ARG B 135 ? 0.4292 0.4191 0.6463 -0.2155 -0.2836 0.3246 135 ARG B NE 2994 C CZ . ARG B 135 ? 0.4136 0.4224 0.8481 -0.2657 -0.1754 0.3667 135 ARG B CZ 2995 N NH1 . ARG B 135 ? 0.6932 0.4697 1.1889 -0.3946 -0.0525 0.2482 135 ARG B NH1 2996 N NH2 . ARG B 135 ? 0.2733 0.5278 0.8836 -0.2033 -0.3348 0.5572 135 ARG B NH2 2997 N N . GLU B 136 ? 0.1058 0.2491 0.2361 -0.0246 -0.0580 0.0823 136 GLU B N 2998 C CA . GLU B 136 ? 0.1543 0.2684 0.2253 0.0080 -0.0300 0.1382 136 GLU B CA 2999 C C . GLU B 136 ? 0.1220 0.2536 0.2477 -0.0005 -0.0200 0.1114 136 GLU B C 3000 O O . GLU B 136 ? 0.1295 0.3235 0.3251 0.0373 -0.0169 0.1517 136 GLU B O 3001 C CB . GLU B 136 ? 0.1250 0.2801 0.2193 -0.0266 -0.0319 0.1205 136 GLU B CB 3002 C CG . GLU B 136 ? 0.1774 0.2493 0.2378 -0.0071 -0.0274 0.1153 136 GLU B CG 3003 C CD . GLU B 136 ? 0.2016 0.2253 0.1640 -0.0283 -0.0123 0.0671 136 GLU B CD 3004 O OE1 . GLU B 136 ? 0.1970 0.2089 0.1919 -0.0075 -0.0368 0.0767 136 GLU B OE1 3005 O OE2 . GLU B 136 ? 0.2345 0.2874 0.3302 0.0268 0.0319 -0.0329 136 GLU B OE2 3006 N N . ILE B 137 ? 0.1427 0.2748 0.2834 -0.0052 -0.0172 0.1537 137 ILE B N 3007 C CA . ILE B 137 ? 0.1630 0.2795 0.3993 0.0046 -0.0385 0.2017 137 ILE B CA 3008 C C . ILE B 137 ? 0.1514 0.3824 0.3762 0.1199 0.0572 0.2364 137 ILE B C 3009 O O . ILE B 137 ? 0.2333 0.4044 0.4783 0.1735 0.0435 0.2691 137 ILE B O 3010 C CB . ILE B 137 ? 0.1591 0.2374 0.6119 0.0092 -0.0320 0.1632 137 ILE B CB 3011 C CG1 . ILE B 137 ? 0.1760 0.2472 0.7352 0.0171 0.0414 0.2403 137 ILE B CG1 3012 C CG2 . ILE B 137 ? 0.1632 0.1992 0.6111 -0.0219 -0.1197 0.0722 137 ILE B CG2 3013 C CD1 . ILE B 137 ? 0.2847 0.2288 0.4869 0.0220 -0.0427 0.0447 137 ILE B CD1 3014 N N . GLY B 138 ? 0.1523 0.4376 0.3572 0.0763 -0.0116 0.2566 138 GLY B N 3015 C CA . GLY B 138 ? 0.1716 0.4577 0.4134 0.0512 -0.0361 0.3311 138 GLY B CA 3016 C C . GLY B 138 ? 0.1794 0.4747 0.3560 0.0086 -0.0572 0.2909 138 GLY B C 3017 O O . GLY B 138 ? 0.1426 0.6140 0.4647 -0.0009 -0.0489 0.4138 138 GLY B O 3018 N N . GLY B 139 ? 0.1574 0.5189 0.3794 0.0134 -0.0173 0.3302 139 GLY B N 3019 C CA . GLY B 139 ? 0.1576 0.4916 0.3534 -0.0224 -0.0340 0.2970 139 GLY B CA 3020 C C . GLY B 139 ? 0.2345 0.4894 0.2062 -0.0837 -0.0555 0.2292 139 GLY B C 3021 O O . GLY B 139 ? 0.1887 0.5077 0.2103 -0.0080 -0.0656 0.1949 139 GLY B O 3022 N N . PRO B 140 ? 0.2028 0.4971 0.1747 -0.1963 -0.1019 0.1372 140 PRO B N 3023 C CA . PRO B 140 ? 0.2613 0.4760 0.1468 -0.2213 -0.0738 0.0884 140 PRO B CA 3024 C C . PRO B 140 ? 0.2528 0.4857 0.1634 -0.2151 -0.0772 0.1048 140 PRO B C 3025 O O . PRO B 140 ? 0.2514 0.4753 0.1484 -0.2080 -0.0573 0.0880 140 PRO B O 3026 C CB . PRO B 140 ? 0.3210 0.4865 0.1694 -0.2554 -0.0474 0.0659 140 PRO B CB 3027 C CG . PRO B 140 ? 0.3697 0.4823 0.2008 -0.2761 -0.0392 0.0460 140 PRO B CG 3028 C CD . PRO B 140 ? 0.3121 0.5016 0.2261 -0.2682 -0.0855 0.1128 140 PRO B CD 3029 N N . ALA B 141 ? 0.2855 0.5053 0.1782 -0.2384 -0.1259 0.1591 141 ALA B N 3030 C CA . ALA B 141 ? 0.3030 0.5387 0.2336 -0.2215 -0.1331 0.2270 141 ALA B CA 3031 C C . ALA B 141 ? 0.2359 0.4453 0.2477 -0.1635 -0.1423 0.2380 141 ALA B C 3032 O O . ALA B 141 ? 0.2411 0.4503 0.3187 -0.1877 -0.1655 0.2622 141 ALA B O 3033 C CB . ALA B 141 ? 0.2925 0.5253 0.2836 -0.2113 -0.1194 0.1581 141 ALA B CB 3034 N N . ALA B 142 ? 0.1763 0.4164 0.2462 -0.1274 -0.0918 0.2162 142 ALA B N 3035 C CA . ALA B 142 ? 0.1312 0.4370 0.2706 -0.0837 -0.0430 0.1988 142 ALA B CA 3036 C C . ALA B 142 ? 0.1516 0.3278 0.2571 -0.0366 -0.0875 0.1718 142 ALA B C 3037 O O . ALA B 142 ? 0.1586 0.3337 0.2277 -0.0185 -0.0235 0.1617 142 ALA B O 3038 C CB . ALA B 142 ? 0.1509 0.6506 0.2797 -0.1099 -0.0690 0.3130 142 ALA B CB 3039 N N . MET B 143 ? 0.1479 0.2946 0.2036 -0.0640 -0.0738 0.1368 143 MET B N 3040 C CA . MET B 143 ? 0.1501 0.2751 0.1641 -0.0540 -0.0610 0.0909 143 MET B CA 3041 C C . MET B 143 ? 0.1432 0.3042 0.1708 -0.0548 -0.0516 0.1128 143 MET B C 3042 O O . MET B 143 ? 0.1315 0.2511 0.1701 -0.0164 -0.0502 0.1121 143 MET B O 3043 C CB . MET B 143 ? 0.1520 0.2800 0.1433 -0.0647 -0.0454 0.0627 143 MET B CB 3044 C CG . MET B 143 ? 0.1543 0.2344 0.1547 -0.0503 -0.0590 0.0990 143 MET B CG 3045 S SD . MET B 143 ? 0.1942 0.2349 0.1505 -0.0302 -0.0739 0.0777 143 MET B SD 3046 C CE . MET B 143 ? 0.1276 0.2303 0.1775 0.0269 -0.0364 0.0558 143 MET B CE 3047 N N . THR B 144 ? 0.1603 0.3116 0.2106 -0.0927 -0.1208 0.1497 144 THR B N 3048 C CA . THR B 144 ? 0.1380 0.3170 0.1986 -0.0811 -0.0905 0.1448 144 THR B CA 3049 C C . THR B 144 ? 0.1713 0.3289 0.2100 -0.0542 -0.0931 0.1681 144 THR B C 3050 O O . THR B 144 ? 0.1624 0.3213 0.2259 -0.0481 -0.0718 0.1487 144 THR B O 3051 C CB . THR B 144 ? 0.1613 0.3572 0.2034 -0.0773 -0.0974 0.1530 144 THR B CB 3052 O OG1 . THR B 144 ? 0.1715 0.3420 0.1971 -0.1046 -0.0852 0.1222 144 THR B OG1 3053 C CG2 . THR B 144 ? 0.2263 0.4119 0.2580 -0.0233 -0.0505 0.2288 144 THR B CG2 3054 N N . GLN B 145 ? 0.1490 0.3373 0.2197 -0.0428 -0.1096 0.1670 145 GLN B N 3055 C CA . GLN B 145 ? 0.1735 0.3147 0.2969 -0.0142 -0.1003 0.2081 145 GLN B CA 3056 C C . GLN B 145 ? 0.1332 0.3226 0.2421 0.0153 -0.0244 0.1755 145 GLN B C 3057 O O . GLN B 145 ? 0.1473 0.3217 0.2881 0.0051 -0.0234 0.1737 145 GLN B O 3058 C CB . GLN B 145 ? 0.1547 0.3162 0.4648 0.0078 -0.1041 0.1867 145 GLN B CB 3059 C CG . GLN B 145 ? 0.1818 0.3832 0.5960 0.0730 -0.0833 0.1823 145 GLN B CG 3060 C CD . GLN B 145 ? 0.1743 0.5189 0.4360 0.0232 -0.0926 0.1104 145 GLN B CD 3061 O OE1 . GLN B 145 ? 0.2600 0.4235 0.3843 0.0520 -0.0995 0.1082 145 GLN B OE1 3062 N NE2 . GLN B 145 ? 0.2564 0.6571 0.3554 -0.1286 -0.0567 -0.0518 145 GLN B NE2 3063 N N . TYR B 146 ? 0.1346 0.3246 0.1953 0.0236 -0.0142 0.1472 146 TYR B N 3064 C CA . TYR B 146 ? 0.1169 0.2878 0.2445 0.0187 -0.0336 0.1365 146 TYR B CA 3065 C C . TYR B 146 ? 0.1468 0.2421 0.2483 0.0322 -0.0188 0.1582 146 TYR B C 3066 O O . TYR B 146 ? 0.1299 0.2391 0.2782 0.0317 0.0156 0.1373 146 TYR B O 3067 C CB . TYR B 146 ? 0.1335 0.2769 0.1871 -0.0252 -0.0237 0.1272 146 TYR B CB 3068 C CG . TYR B 146 ? 0.1272 0.2480 0.2266 -0.0260 -0.0369 0.1179 146 TYR B CG 3069 C CD1 . TYR B 146 ? 0.1420 0.2612 0.2805 -0.0116 -0.0713 0.1124 146 TYR B CD1 3070 C CD2 . TYR B 146 ? 0.1537 0.3491 0.1809 -0.0601 -0.0129 0.1074 146 TYR B CD2 3071 C CE1 . TYR B 146 ? 0.1871 0.1859 0.3101 -0.0424 -0.0974 0.1183 146 TYR B CE1 3072 C CE2 . TYR B 146 ? 0.1835 0.3342 0.1822 -0.0732 -0.0411 0.1358 146 TYR B CE2 3073 C CZ . TYR B 146 ? 0.2004 0.3278 0.2556 -0.0489 -0.0822 0.1120 146 TYR B CZ 3074 O OH . TYR B 146 ? 0.2178 0.3208 0.2669 -0.0765 -0.0993 0.1232 146 TYR B OH 3075 N N . PHE B 147 ? 0.1110 0.2463 0.2072 -0.0038 -0.0544 0.1289 147 PHE B N 3076 C CA . PHE B 147 ? 0.1223 0.2058 0.2089 0.0026 -0.0448 0.1034 147 PHE B CA 3077 C C . PHE B 147 ? 0.1370 0.2194 0.2478 0.0139 -0.0138 0.1098 147 PHE B C 3078 O O . PHE B 147 ? 0.1969 0.1924 0.2175 0.0429 0.0045 0.0784 147 PHE B O 3079 C CB . PHE B 147 ? 0.1681 0.1929 0.1962 -0.0108 -0.0319 0.1021 147 PHE B CB 3080 C CG . PHE B 147 ? 0.1264 0.1641 0.1974 -0.0405 -0.0326 0.0801 147 PHE B CG 3081 C CD1 . PHE B 147 ? 0.0983 0.2029 0.1826 -0.0398 -0.0278 0.0460 147 PHE B CD1 3082 C CD2 . PHE B 147 ? 0.1761 0.1509 0.1417 -0.0018 -0.0401 0.0474 147 PHE B CD2 3083 C CE1 . PHE B 147 ? 0.1162 0.2002 0.1642 -0.0299 -0.0130 0.0239 147 PHE B CE1 3084 C CE2 . PHE B 147 ? 0.1753 0.1510 0.1723 -0.0047 -0.0502 0.0390 147 PHE B CE2 3085 C CZ . PHE B 147 ? 0.1367 0.1512 0.1739 -0.0116 -0.0297 0.0395 147 PHE B CZ 3086 N N . ARG B 148 ? 0.1309 0.2564 0.2527 0.0350 -0.0058 0.1533 148 ARG B N 3087 C CA . ARG B 148 ? 0.1686 0.2544 0.2832 0.0243 -0.0065 0.1624 148 ARG B CA 3088 C C . ARG B 148 ? 0.2171 0.2771 0.3227 0.0760 0.0137 0.1484 148 ARG B C 3089 O O . ARG B 148 ? 0.3006 0.2660 0.3127 0.0966 0.0049 0.1490 148 ARG B O 3090 C CB . ARG B 148 ? 0.2461 0.3537 0.3219 0.0525 -0.0792 0.2044 148 ARG B CB 3091 C CG . ARG B 148 ? 0.1586 0.4226 0.2888 0.0281 -0.0928 0.2059 148 ARG B CG 3092 C CD . ARG B 148 ? 0.2095 0.4479 0.4159 0.0512 -0.0067 0.2449 148 ARG B CD 3093 N NE . ARG B 148 ? 0.2091 0.4832 0.3379 0.0019 -0.0401 0.2474 148 ARG B NE 3094 C CZ . ARG B 148 ? 0.3168 0.4280 0.2593 0.0506 -0.0801 0.1349 148 ARG B CZ 3095 N NH1 . ARG B 148 ? 0.1704 0.2455 0.2411 0.0050 -0.0236 0.0895 148 ARG B NH1 3096 N NH2 . ARG B 148 ? 0.5304 0.5094 0.3096 0.0510 -0.1555 0.0094 148 ARG B NH2 3097 N N . LYS B 149 ? 0.1488 0.2984 0.3221 0.0923 0.0181 0.1425 149 LYS B N 3098 C CA . LYS B 149 ? 0.1878 0.2635 0.3688 0.1065 0.0524 0.1322 149 LYS B CA 3099 C C . LYS B 149 ? 0.2263 0.2746 0.3389 0.0866 0.0546 0.1177 149 LYS B C 3100 O O . LYS B 149 ? 0.3885 0.3186 0.3287 0.1400 -0.0046 0.0836 149 LYS B O 3101 C CB . LYS B 149 ? 0.2096 0.3361 0.3815 0.0713 0.0810 0.1333 149 LYS B CB 3102 C CG . LYS B 149 ? 0.2036 0.3538 0.4040 0.0849 0.0965 0.1216 149 LYS B CG 3103 C CD . LYS B 149 ? 0.3631 0.5090 0.3256 -0.0961 0.0203 0.1210 149 LYS B CD 3104 C CE . LYS B 149 ? 0.6279 0.7626 0.2540 -0.0161 -0.1181 0.0974 149 LYS B CE 3105 N NZ . LYS B 149 ? 0.8903 0.9984 0.3665 -0.0322 0.1598 0.0916 149 LYS B NZ 3106 N N . ILE B 150 ? 0.2099 0.2600 0.3520 0.0611 0.0264 0.1556 150 ILE B N 3107 C CA . ILE B 150 ? 0.2287 0.2694 0.2651 0.0640 0.0672 0.1102 150 ILE B CA 3108 C C . ILE B 150 ? 0.3298 0.2142 0.2919 -0.0068 0.0547 0.0954 150 ILE B C 3109 O O . ILE B 150 ? 0.3330 0.2348 0.3059 -0.0318 0.0759 0.0660 150 ILE B O 3110 C CB . ILE B 150 ? 0.2311 0.2264 0.2326 0.0267 0.0356 0.0811 150 ILE B CB 3111 C CG1 . ILE B 150 ? 0.2263 0.2323 0.2704 0.0400 0.0311 0.0727 150 ILE B CG1 3112 C CG2 . ILE B 150 ? 0.2328 0.3442 0.2918 0.0611 0.0655 0.1527 150 ILE B CG2 3113 C CD1 . ILE B 150 ? 0.1066 0.2261 0.7626 -0.0058 -0.0367 0.1365 150 ILE B CD1 3114 N N . GLY B 151 ? 0.3509 0.2053 0.2929 0.0614 0.0927 0.1156 151 GLY B N 3115 C CA . GLY B 151 ? 0.3068 0.1677 0.2973 0.0187 0.0562 0.0813 151 GLY B CA 3116 C C . GLY B 151 ? 0.2838 0.1680 0.2704 -0.0095 0.0429 0.0750 151 GLY B C 3117 O O . GLY B 151 ? 0.3229 0.2111 0.3472 0.0136 0.0869 0.1242 151 GLY B O 3118 N N . ASP B 152 ? 0.2393 0.1766 0.2482 0.0056 -0.0255 0.0458 152 ASP B N 3119 C CA . ASP B 152 ? 0.1866 0.1772 0.2091 -0.0001 -0.0371 0.0776 152 ASP B CA 3120 C C . ASP B 152 ? 0.1856 0.2401 0.1966 -0.0138 -0.0324 0.0960 152 ASP B C 3121 O O . ASP B 152 ? 0.1818 0.2197 0.2123 -0.0006 -0.0477 0.0810 152 ASP B O 3122 C CB . ASP B 152 ? 0.1850 0.2138 0.2230 0.0241 -0.0299 0.0937 152 ASP B CB 3123 C CG . ASP B 152 ? 0.1984 0.1363 0.1730 -0.0197 -0.0785 0.0481 152 ASP B CG 3124 O OD1 . ASP B 152 ? 0.1635 0.2539 0.1787 -0.0133 -0.0779 0.0699 152 ASP B OD1 3125 O OD2 . ASP B 152 ? 0.2213 0.1492 0.1791 0.0024 -0.0532 0.0637 152 ASP B OD2 3126 N N . SER B 153 ? 0.2235 0.2021 0.2098 0.0323 -0.0164 0.0969 153 SER B N 3127 C CA . SER B 153 ? 0.3291 0.2737 0.2132 0.0960 -0.0556 0.0875 153 SER B CA 3128 C C . SER B 153 ? 0.1912 0.2441 0.1900 0.0037 -0.0370 0.1052 153 SER B C 3129 O O . SER B 153 ? 0.1902 0.3507 0.1930 0.0284 -0.0397 0.0907 153 SER B O 3130 C CB . SER B 153 ? 0.4735 0.2859 0.3292 0.1276 -0.1691 0.1046 153 SER B CB 3131 O OG . SER B 153 ? 0.6494 0.3463 0.5264 0.0697 -0.0061 0.2642 153 SER B OG 3132 N N . VAL B 154 ? 0.1735 0.2284 0.2066 -0.0172 -0.0400 0.0863 154 VAL B N 3133 C CA . VAL B 154 ? 0.1668 0.2325 0.2215 -0.0210 -0.0179 0.1008 154 VAL B CA 3134 C C . VAL B 154 ? 0.1444 0.2228 0.1878 -0.0424 -0.0319 0.0747 154 VAL B C 3135 O O . VAL B 154 ? 0.1542 0.2622 0.1733 -0.0449 -0.0544 0.0715 154 VAL B O 3136 C CB . VAL B 154 ? 0.1777 0.1980 0.2958 -0.0417 -0.0047 0.0799 154 VAL B CB 3137 C CG1 . VAL B 154 ? 0.1597 0.2114 0.3612 -0.0245 -0.0251 0.0639 154 VAL B CG1 3138 C CG2 . VAL B 154 ? 0.2010 0.2122 0.2956 -0.0111 -0.0037 0.1199 154 VAL B CG2 3139 N N . SER B 155 ? 0.1487 0.1918 0.1858 -0.0155 -0.0442 0.0630 155 SER B N 3140 C CA . SER B 155 ? 0.1196 0.1702 0.1515 -0.0222 -0.0120 0.0259 155 SER B CA 3141 C C . SER B 155 ? 0.1287 0.2058 0.1446 -0.0280 -0.0309 0.0310 155 SER B C 3142 O O . SER B 155 ? 0.1249 0.2136 0.2387 -0.0167 -0.0271 0.0371 155 SER B O 3143 C CB . SER B 155 ? 0.1194 0.1556 0.1625 -0.0282 -0.0356 0.0300 155 SER B CB 3144 O OG . SER B 155 ? 0.1713 0.1930 0.2008 -0.0315 -0.0736 0.0258 155 SER B OG 3145 N N . ARG B 156 ? 0.1314 0.1916 0.1475 -0.0382 -0.0388 0.0387 156 ARG B N 3146 C CA . ARG B 156 ? 0.1363 0.2025 0.1378 -0.0536 -0.0493 0.0716 156 ARG B CA 3147 C C . ARG B 156 ? 0.1578 0.1948 0.1079 -0.0553 -0.0442 0.0486 156 ARG B C 3148 O O . ARG B 156 ? 0.1333 0.2021 0.1537 -0.0504 -0.0622 0.0672 156 ARG B O 3149 C CB . ARG B 156 ? 0.1537 0.2135 0.1494 -0.0142 -0.0599 0.0686 156 ARG B CB 3150 C CG . ARG B 156 ? 0.1527 0.1950 0.1312 -0.0399 -0.0585 0.0621 156 ARG B CG 3151 C CD . ARG B 156 ? 0.2081 0.2349 0.1429 -0.0257 -0.0804 0.0611 156 ARG B CD 3152 N NE . ARG B 156 ? 0.1818 0.3282 0.1571 -0.0769 -0.1017 0.1034 156 ARG B NE 3153 C CZ . ARG B 156 ? 0.2415 0.2623 0.1405 -0.0645 -0.0932 0.0828 156 ARG B CZ 3154 N NH1 . ARG B 156 ? 0.3323 0.3519 0.1576 -0.1383 -0.0903 0.1124 156 ARG B NH1 3155 N NH2 . ARG B 156 ? 0.3126 0.2770 0.1711 -0.0961 -0.1126 0.0743 156 ARG B NH2 3156 N N . LEU B 157 ? 0.1469 0.2124 0.1560 -0.0694 -0.0503 0.0720 157 LEU B N 3157 C CA . LEU B 157 ? 0.1683 0.2078 0.1227 -0.0714 -0.0373 0.0456 157 LEU B CA 3158 C C . LEU B 157 ? 0.1732 0.2282 0.1287 -0.0888 -0.0501 0.0749 157 LEU B C 3159 O O . LEU B 157 ? 0.1473 0.3079 0.2092 -0.0930 -0.0224 0.0338 157 LEU B O 3160 C CB . LEU B 157 ? 0.1967 0.2366 0.1291 -0.1029 -0.0543 0.0667 157 LEU B CB 3161 C CG . LEU B 157 ? 0.2398 0.2388 0.1272 -0.0817 -0.0760 0.0675 157 LEU B CG 3162 C CD1 . LEU B 157 ? 0.2565 0.2810 0.1750 -0.0503 -0.0459 0.0776 157 LEU B CD1 3163 C CD2 . LEU B 157 ? 0.2284 0.2366 0.1603 -0.1058 -0.0683 0.0831 157 LEU B CD2 3164 N N . ASP B 158 ? 0.1979 0.2275 0.1209 -0.0829 -0.0657 0.0637 158 ASP B N 3165 C CA . ASP B 158 ? 0.2313 0.2444 0.1461 -0.1139 -0.0801 0.0750 158 ASP B CA 3166 C C . ASP B 158 ? 0.2342 0.2461 0.1498 -0.1130 -0.0801 0.0623 158 ASP B C 3167 O O . ASP B 158 ? 0.2217 0.2836 0.2290 -0.1354 -0.0678 0.0766 158 ASP B O 3168 C CB . ASP B 158 ? 0.2050 0.2226 0.1263 -0.0911 -0.0917 0.0453 158 ASP B CB 3169 C CG . ASP B 158 ? 0.1899 0.2397 0.1475 -0.0930 -0.0798 0.0815 158 ASP B CG 3170 O OD1 . ASP B 158 ? 0.2130 0.2930 0.2342 -0.0817 -0.1150 0.1158 158 ASP B OD1 3171 O OD2 . ASP B 158 ? 0.2110 0.2247 0.1500 -0.0932 -0.0991 0.0819 158 ASP B OD2 3172 N N . ARG B 159 ? 0.2478 0.2391 0.1412 -0.1053 -0.0563 0.0763 159 ARG B N 3173 C CA . ARG B 159 ? 0.2486 0.2354 0.1406 -0.1313 -0.0695 0.0673 159 ARG B CA 3174 C C . ARG B 159 ? 0.2145 0.2447 0.1395 -0.1418 -0.0690 0.0716 159 ARG B C 3175 O O . ARG B 159 ? 0.2324 0.2151 0.1447 -0.0906 -0.0805 0.0458 159 ARG B O 3176 C CB . ARG B 159 ? 0.2855 0.2395 0.1395 -0.1418 -0.0607 0.0430 159 ARG B CB 3177 C CG . ARG B 159 ? 0.2640 0.3325 0.1451 -0.1408 -0.0926 0.0281 159 ARG B CG 3178 C CD . ARG B 159 ? 0.3122 0.2898 0.1238 -0.1600 -0.0772 0.0272 159 ARG B CD 3179 N NE . ARG B 159 ? 0.2728 0.2445 0.1353 -0.1170 -0.0767 0.0478 159 ARG B NE 3180 C CZ . ARG B 159 ? 0.2893 0.2026 0.1025 -0.0956 -0.0818 0.0495 159 ARG B CZ 3181 N NH1 . ARG B 159 ? 0.4007 0.2976 0.1249 -0.1138 -0.0702 -0.0025 159 ARG B NH1 3182 N NH2 . ARG B 159 ? 0.3205 0.3170 0.1206 -0.1713 -0.0236 0.0318 159 ARG B NH2 3183 N N . LYS B 160 ? 0.2389 0.2150 0.1562 -0.1057 -0.1060 0.0788 160 LYS B N 3184 C CA . LYS B 160 ? 0.1847 0.2325 0.1522 -0.0874 -0.0766 0.0764 160 LYS B CA 3185 C C . LYS B 160 ? 0.2036 0.1895 0.1057 -0.0931 -0.0655 0.0481 160 LYS B C 3186 O O . LYS B 160 ? 0.2139 0.2396 0.1235 -0.0903 -0.0585 0.0692 160 LYS B O 3187 C CB . LYS B 160 ? 0.2106 0.2712 0.1574 -0.1074 -0.0450 0.0654 160 LYS B CB 3188 C CG . LYS B 160 ? 0.2407 0.2786 0.2025 -0.1346 -0.1022 0.0613 160 LYS B CG 3189 C CD . LYS B 160 ? 0.2772 0.3206 0.3161 -0.1667 -0.0516 0.0694 160 LYS B CD 3190 C CE . LYS B 160 ? 0.3296 0.3825 0.3867 -0.2519 -0.0137 0.0198 160 LYS B CE 3191 N NZ . LYS B 160 ? 0.4467 0.3382 0.3177 -0.1942 0.0195 0.0728 160 LYS B NZ 3192 N N . GLU B 161 ? 0.1937 0.1903 0.1207 -0.0689 -0.0524 0.0501 161 GLU B N 3193 C CA . GLU B 161 ? 0.2117 0.1954 0.1483 -0.0536 -0.0482 0.0343 161 GLU B CA 3194 C C . GLU B 161 ? 0.2385 0.1967 0.1531 -0.0588 -0.0222 0.0368 161 GLU B C 3195 O O . GLU B 161 ? 0.2678 0.1632 0.1854 -0.0670 0.0054 0.0296 161 GLU B O 3196 C CB . GLU B 161 ? 0.2055 0.2785 0.1468 -0.0340 -0.0545 0.0357 161 GLU B CB 3197 C CG . GLU B 161 ? 0.3789 0.2930 0.1376 -0.0235 -0.1103 0.0193 161 GLU B CG 3198 C CD . GLU B 161 ? 0.4927 0.2669 0.1917 -0.1657 -0.0496 -0.0675 161 GLU B CD 3199 O OE1 . GLU B 161 ? 0.7594 0.2974 0.1449 -0.2780 -0.0820 -0.0339 161 GLU B OE1 3200 O OE2 . GLU B 161 ? 0.3750 0.2609 0.1928 -0.1159 -0.0843 -0.0349 161 GLU B OE2 3201 N N . PRO B 162 ? 0.2729 0.1889 0.1812 -0.0631 0.0006 0.0264 162 PRO B N 3202 C CA . PRO B 162 ? 0.2674 0.1901 0.1829 -0.0359 0.0212 0.0311 162 PRO B CA 3203 C C . PRO B 162 ? 0.2918 0.1969 0.1863 -0.1173 -0.0382 0.0364 162 PRO B C 3204 O O . PRO B 162 ? 0.2609 0.2509 0.1456 -0.0918 0.0037 0.0109 162 PRO B O 3205 C CB . PRO B 162 ? 0.3131 0.1814 0.3502 -0.0220 0.0228 0.0311 162 PRO B CB 3206 C CG . PRO B 162 ? 0.3556 0.2096 0.3712 -0.0329 0.0329 -0.0296 162 PRO B CG 3207 C CD . PRO B 162 ? 0.3381 0.1990 0.2173 -0.0645 -0.0033 0.0062 162 PRO B CD 3208 N N . GLU B 163 ? 0.2959 0.2645 0.1452 -0.1349 -0.0239 0.0042 163 GLU B N 3209 C CA . GLU B 163 ? 0.3419 0.2822 0.1217 -0.1763 -0.0387 -0.0167 163 GLU B CA 3210 C C . GLU B 163 ? 0.2693 0.2615 0.1093 -0.0996 -0.0443 0.0076 163 GLU B C 3211 O O . GLU B 163 ? 0.2435 0.2589 0.1211 -0.0951 -0.0183 -0.0037 163 GLU B O 3212 C CB . GLU B 163 ? 0.3524 0.2902 0.1630 -0.1251 -0.0722 -0.0387 163 GLU B CB 3213 C CG . GLU B 163 ? 0.3495 0.2563 0.2168 -0.1303 -0.0496 -0.0023 163 GLU B CG 3214 C CD . GLU B 163 ? 0.3094 0.2500 0.2749 -0.1635 -0.0962 0.0097 163 GLU B CD 3215 O OE1 . GLU B 163 ? 0.2715 0.2875 0.2575 -0.1450 -0.0517 0.0311 163 GLU B OE1 3216 O OE2 . GLU B 163 ? 0.3068 0.3090 0.3077 -0.1578 -0.1283 0.0594 163 GLU B OE2 3217 N N . MET B 164 ? 0.2132 0.2436 0.1045 -0.1008 -0.0407 0.0184 164 MET B N 3218 C CA . MET B 164 ? 0.2216 0.2383 0.1537 -0.0994 -0.0691 0.0246 164 MET B CA 3219 C C . MET B 164 ? 0.2164 0.2257 0.1099 -0.0957 -0.0731 0.0359 164 MET B C 3220 O O . MET B 164 ? 0.2231 0.2283 0.1503 -0.0775 -0.0235 0.0546 164 MET B O 3221 C CB . MET B 164 ? 0.1992 0.2403 0.2139 -0.1060 -0.0520 -0.0115 164 MET B CB 3222 C CG . MET B 164 ? 0.2842 0.3997 0.1514 -0.1923 -0.0464 0.0303 164 MET B CG 3223 S SD A MET B 164 ? 0.3139 0.2699 0.1256 -0.1550 -0.0949 0.0424 164 MET B SD 3224 S SD B MET B 164 ? 0.4640 0.5819 0.2597 0.0700 -0.1872 -0.1010 164 MET B SD 3225 C CE A MET B 164 ? 0.3606 0.3687 0.1127 -0.0315 -0.1579 0.0082 164 MET B CE 3226 C CE B MET B 164 ? 0.2022 0.6272 0.5546 0.2439 -0.3020 -0.3711 164 MET B CE 3227 N N . GLY B 165 ? 0.2175 0.2196 0.0903 -0.0973 -0.0433 0.0402 165 GLY B N 3228 C CA . GLY B 165 ? 0.2176 0.2419 0.0969 -0.0775 -0.0449 0.0295 165 GLY B CA 3229 C C . GLY B 165 ? 0.2019 0.1760 0.1088 -0.0616 -0.0483 0.0272 165 GLY B C 3230 O O . GLY B 165 ? 0.1982 0.1754 0.1607 -0.0439 -0.0489 -0.0025 165 GLY B O 3231 N N . ASP B 166 ? 0.2096 0.2152 0.1056 -0.0701 -0.0481 0.0278 166 ASP B N 3232 C CA . ASP B 166 ? 0.2511 0.1883 0.1249 -0.1021 -0.0375 -0.0085 166 ASP B CA 3233 C C . ASP B 166 ? 0.2341 0.1548 0.1148 -0.0490 -0.0344 0.0292 166 ASP B C 3234 O O . ASP B 166 ? 0.2830 0.1969 0.1344 -0.0565 0.0037 -0.0002 166 ASP B O 3235 C CB . ASP B 166 ? 0.2426 0.2745 0.1237 -0.0777 -0.0366 -0.0345 166 ASP B CB 3236 C CG . ASP B 166 ? 0.2494 0.3271 0.2260 -0.1431 0.0046 -0.1149 166 ASP B CG 3237 O OD1 . ASP B 166 ? 0.4104 0.2666 0.2844 -0.2292 0.0118 -0.0431 166 ASP B OD1 3238 O OD2 . ASP B 166 ? 0.3480 0.5928 0.2724 -0.2321 -0.0478 -0.2020 166 ASP B OD2 3239 N N . ASN B 167 ? 0.2206 0.1571 0.1154 -0.0466 -0.0370 0.0358 167 ASN B N 3240 C CA . ASN B 167 ? 0.2057 0.1420 0.1033 -0.0312 -0.0195 0.0177 167 ASN B CA 3241 C C . ASN B 167 ? 0.2078 0.1471 0.1044 0.0034 -0.0223 0.0379 167 ASN B C 3242 O O . ASN B 167 ? 0.2237 0.1747 0.1251 -0.0402 0.0084 -0.0303 167 ASN B O 3243 C CB . ASN B 167 ? 0.2339 0.1662 0.1113 -0.0494 -0.0342 0.0288 167 ASN B CB 3244 C CG . ASN B 167 ? 0.2208 0.1479 0.1040 -0.0334 -0.0444 0.0027 167 ASN B CG 3245 O OD1 . ASN B 167 ? 0.2158 0.2078 0.1708 -0.0205 -0.0489 0.0013 167 ASN B OD1 3246 N ND2 . ASN B 167 ? 0.1753 0.1444 0.1380 -0.0392 -0.0016 0.0067 167 ASN B ND2 3247 N N . THR B 168 ? 0.2425 0.1951 0.1021 -0.0562 -0.0329 0.0055 168 THR B N 3248 C CA . THR B 168 ? 0.3077 0.1557 0.1024 -0.0652 -0.0320 0.0043 168 THR B CA 3249 C C . THR B 168 ? 0.2750 0.1529 0.1299 -0.0663 -0.0217 -0.0003 168 THR B C 3250 O O . THR B 168 ? 0.2739 0.1545 0.1064 -0.0416 -0.0329 0.0221 168 THR B O 3251 C CB . THR B 168 ? 0.4149 0.2637 0.1392 -0.1914 -0.1099 -0.0002 168 THR B CB 3252 O OG1 . THR B 168 ? 0.4247 0.2320 0.1931 -0.1671 -0.0345 -0.0356 168 THR B OG1 3253 C CG2 . THR B 168 ? 0.4314 0.4579 0.1434 -0.2090 -0.0830 -0.0018 168 THR B CG2 3254 N N . PRO B 169 ? 0.3661 0.1412 0.1251 -0.0544 0.0279 -0.0023 169 PRO B N 3255 C CA . PRO B 169 ? 0.3933 0.1540 0.2036 0.0176 0.1126 0.0750 169 PRO B CA 3256 C C . PRO B 169 ? 0.3990 0.1798 0.1506 0.0147 0.0607 0.0253 169 PRO B C 3257 O O . PRO B 169 ? 0.6668 0.1771 0.1037 0.0172 -0.0213 0.0152 169 PRO B O 3258 C CB . PRO B 169 ? 0.4503 0.1888 0.3207 0.0427 0.1885 0.0790 169 PRO B CB 3259 C CG . PRO B 169 ? 0.4822 0.1730 0.2569 0.0385 0.1403 0.0370 169 PRO B CG 3260 C CD . PRO B 169 ? 0.4947 0.1711 0.1400 0.0030 0.0929 0.0224 169 PRO B CD 3261 N N . GLY B 170 ? 0.2697 0.1696 0.1649 -0.0081 0.0080 0.0382 170 GLY B N 3262 C CA . GLY B 170 ? 0.2903 0.1988 0.2720 0.0115 0.0374 0.0920 170 GLY B CA 3263 C C . GLY B 170 ? 0.2500 0.1721 0.1312 -0.0272 -0.0389 0.0439 170 GLY B C 3264 O O . GLY B 170 ? 0.2826 0.2049 0.1589 0.0062 -0.0251 0.0603 170 GLY B O 3265 N N . ASP B 171 ? 0.2920 0.1733 0.1038 -0.0354 -0.0308 0.0291 171 ASP B N 3266 C CA . ASP B 171 ? 0.2766 0.1819 0.1030 -0.0350 -0.0463 0.0462 171 ASP B CA 3267 C C . ASP B 171 ? 0.2157 0.2046 0.1058 -0.0643 -0.0475 0.0224 171 ASP B C 3268 O O . ASP B 171 ? 0.2377 0.2892 0.1323 -0.0436 -0.0769 0.0216 171 ASP B O 3269 C CB . ASP B 171 ? 0.2892 0.1835 0.1937 -0.0734 -0.0830 0.0574 171 ASP B CB 3270 C CG . ASP B 171 ? 0.2989 0.2249 0.1300 -0.1094 -0.0959 0.0253 171 ASP B CG 3271 O OD1 . ASP B 171 ? 0.3059 0.2481 0.1604 -0.1080 -0.0330 -0.0129 171 ASP B OD1 3272 O OD2 . ASP B 171 ? 0.3500 0.2403 0.2088 -0.1277 -0.0859 0.0678 171 ASP B OD2 3273 N N . LEU B 172 ? 0.2321 0.2010 0.0856 -0.0648 -0.0703 0.0103 172 LEU B N 3274 C CA . LEU B 172 ? 0.2428 0.1739 0.0995 -0.0797 -0.0446 0.0147 172 LEU B CA 3275 C C . LEU B 172 ? 0.1671 0.1792 0.1070 -0.0501 -0.0542 0.0345 172 LEU B C 3276 O O . LEU B 172 ? 0.1599 0.2041 0.1028 -0.0393 -0.0586 0.0288 172 LEU B O 3277 C CB . LEU B 172 ? 0.3202 0.1879 0.1449 -0.0442 -0.0282 0.0603 172 LEU B CB 3278 C CG . LEU B 172 ? 0.3889 0.2811 0.3357 0.0010 0.0794 0.1795 172 LEU B CG 3279 C CD1 . LEU B 172 ? 0.6001 0.2059 0.4775 0.0534 0.0781 0.1646 172 LEU B CD1 3280 C CD2 . LEU B 172 ? 0.4998 0.4009 0.5140 -0.1646 0.0521 0.2477 172 LEU B CD2 3281 N N . ARG B 173 ? 0.1773 0.1872 0.0967 -0.0576 -0.0492 0.0437 173 ARG B N 3282 C CA . ARG B 173 ? 0.1867 0.2312 0.0908 -0.1010 -0.0761 0.0526 173 ARG B CA 3283 C C . ARG B 173 ? 0.1648 0.1956 0.0941 -0.0615 -0.0659 0.0447 173 ARG B C 3284 O O . ARG B 173 ? 0.1747 0.1715 0.1131 -0.0567 -0.0510 0.0338 173 ARG B O 3285 C CB . ARG B 173 ? 0.2694 0.2622 0.1074 -0.1497 -0.0969 0.0599 173 ARG B CB 3286 C CG . ARG B 173 ? 0.3384 0.2699 0.1892 -0.1590 -0.1727 0.0564 173 ARG B CG 3287 C CD . ARG B 173 ? 0.3444 0.2940 0.1760 -0.1860 -0.1502 0.0520 173 ARG B CD 3288 N NE . ARG B 173 ? 0.4245 0.3142 0.1533 -0.2012 -0.1141 0.0196 173 ARG B NE 3289 C CZ . ARG B 173 ? 0.4074 0.2895 0.1822 -0.1894 -0.1267 0.0500 173 ARG B CZ 3290 N NH1 . ARG B 173 ? 0.3986 0.3045 0.2030 -0.1972 -0.1659 0.0957 173 ARG B NH1 3291 N NH2 . ARG B 173 ? 0.4365 0.3106 0.1690 -0.1801 -0.1267 0.0291 173 ARG B NH2 3292 N N . ASP B 174 ? 0.1571 0.1917 0.0970 -0.0515 -0.0651 0.0480 174 ASP B N 3293 C CA . ASP B 174 ? 0.1532 0.1669 0.0918 -0.0582 -0.0450 0.0647 174 ASP B CA 3294 C C . ASP B 174 ? 0.1486 0.1684 0.1036 -0.0571 -0.0565 0.0474 174 ASP B C 3295 O O . ASP B 174 ? 0.1660 0.1912 0.1380 -0.0549 -0.0788 0.0666 174 ASP B O 3296 C CB . ASP B 174 ? 0.1585 0.1686 0.1239 -0.0535 -0.0788 0.0443 174 ASP B CB 3297 C CG . ASP B 174 ? 0.1940 0.2058 0.1357 -0.1018 -0.0713 0.0612 174 ASP B CG 3298 O OD1 . ASP B 174 ? 0.1750 0.2228 0.1696 -0.0853 -0.0739 0.0708 174 ASP B OD1 3299 O OD2 . ASP B 174 ? 0.2433 0.2306 0.1713 -0.1169 -0.0887 0.0349 174 ASP B OD2 3300 N N . THR B 175 ? 0.1452 0.1670 0.0886 -0.0559 -0.0463 0.0402 175 THR B N 3301 C CA . THR B 175 ? 0.1491 0.1629 0.0735 -0.0618 -0.0396 0.0279 175 THR B CA 3302 C C . THR B 175 ? 0.1305 0.1689 0.0800 -0.0525 -0.0612 0.0294 175 THR B C 3303 O O . THR B 175 ? 0.1361 0.1636 0.1345 -0.0530 -0.0403 0.0189 175 THR B O 3304 C CB . THR B 175 ? 0.1861 0.1571 0.1057 -0.0545 -0.0188 0.0350 175 THR B CB 3305 O OG1 . THR B 175 ? 0.2523 0.1699 0.1096 -0.0437 -0.0635 0.0440 175 THR B OG1 3306 C CG2 . THR B 175 ? 0.1922 0.2137 0.0794 -0.0550 -0.0264 0.0061 175 THR B CG2 3307 N N . THR B 176 ? 0.1252 0.1314 0.1173 -0.0303 -0.0569 0.0256 176 THR B N 3308 C CA . THR B 176 ? 0.1156 0.1234 0.1195 -0.0312 -0.0489 0.0336 176 THR B CA 3309 C C . THR B 176 ? 0.1137 0.1288 0.1007 -0.0236 -0.0467 0.0333 176 THR B C 3310 O O . THR B 176 ? 0.1554 0.1456 0.1217 -0.0458 -0.0185 0.0044 176 THR B O 3311 C CB . THR B 176 ? 0.1374 0.1279 0.1159 -0.0399 -0.0321 0.0286 176 THR B CB 3312 O OG1 . THR B 176 ? 0.1768 0.1404 0.1175 -0.0397 -0.0250 0.0273 176 THR B OG1 3313 C CG2 . THR B 176 ? 0.1389 0.1707 0.0945 -0.0342 -0.0377 0.0276 176 THR B CG2 3314 N N . THR B 177 ? 0.1164 0.1373 0.1126 -0.0326 -0.0217 0.0168 177 THR B N 3315 C CA . THR B 177 ? 0.1146 0.1491 0.1066 -0.0300 -0.0372 0.0286 177 THR B CA 3316 C C . THR B 177 ? 0.1187 0.1264 0.0946 -0.0348 -0.0208 0.0220 177 THR B C 3317 O O . THR B 177 ? 0.1276 0.1397 0.1090 -0.0252 -0.0108 0.0341 177 THR B O 3318 C CB . THR B 177 ? 0.1831 0.1548 0.0772 -0.0437 -0.0150 0.0330 177 THR B CB 3319 O OG1 . THR B 177 ? 0.1642 0.1516 0.1117 -0.0216 -0.0278 0.0372 177 THR B OG1 3320 C CG2 . THR B 177 ? 0.2310 0.1467 0.1176 -0.0307 -0.0644 0.0336 177 THR B CG2 3321 N N . PRO B 178 ? 0.1181 0.1262 0.0916 -0.0256 -0.0314 0.0206 178 PRO B N 3322 C CA . PRO B 178 ? 0.1280 0.1144 0.0854 -0.0293 -0.0328 0.0357 178 PRO B CA 3323 C C . PRO B 178 ? 0.1055 0.1116 0.0954 -0.0412 -0.0313 0.0254 178 PRO B C 3324 O O . PRO B 178 ? 0.1208 0.1170 0.1024 -0.0221 -0.0182 0.0323 178 PRO B O 3325 C CB . PRO B 178 ? 0.1261 0.1488 0.0913 -0.0295 -0.0325 0.0174 178 PRO B CB 3326 C CG . PRO B 178 ? 0.1332 0.1287 0.1147 -0.0302 -0.0230 0.0046 178 PRO B CG 3327 C CD . PRO B 178 ? 0.1240 0.1564 0.1015 -0.0403 -0.0228 0.0080 178 PRO B CD 3328 N N . ILE B 179 ? 0.1177 0.1211 0.1023 -0.0230 -0.0275 0.0376 179 ILE B N 3329 C CA . ILE B 179 ? 0.1275 0.1219 0.1026 -0.0154 -0.0486 0.0352 179 ILE B CA 3330 C C . ILE B 179 ? 0.1432 0.0878 0.1167 -0.0244 -0.0226 0.0306 179 ILE B C 3331 O O . ILE B 179 ? 0.1475 0.1341 0.1048 -0.0128 -0.0337 0.0340 179 ILE B O 3332 C CB . ILE B 179 ? 0.1370 0.1252 0.1173 -0.0326 -0.0314 0.0454 179 ILE B CB 3333 C CG1 . ILE B 179 ? 0.1708 0.1214 0.1551 -0.0434 -0.0202 0.0345 179 ILE B CG1 3334 C CG2 . ILE B 179 ? 0.1931 0.1646 0.1080 -0.0291 -0.0366 0.0713 179 ILE B CG2 3335 C CD1 . ILE B 179 ? 0.1659 0.1729 0.1402 -0.0322 -0.0158 0.0120 179 ILE B CD1 3336 N N . ALA B 180 ? 0.1236 0.1171 0.1132 -0.0101 -0.0243 0.0237 180 ALA B N 3337 C CA . ALA B 180 ? 0.1249 0.1591 0.1350 -0.0187 -0.0353 0.0594 180 ALA B CA 3338 C C . ALA B 180 ? 0.1166 0.1300 0.1138 -0.0192 -0.0285 0.0251 180 ALA B C 3339 O O . ALA B 180 ? 0.1208 0.1519 0.1281 0.0004 -0.0128 0.0361 180 ALA B O 3340 C CB . ALA B 180 ? 0.1520 0.2220 0.1374 -0.0708 -0.0423 0.0732 180 ALA B CB 3341 N N . MET B 181 ? 0.1129 0.1327 0.0986 -0.0224 -0.0182 0.0290 181 MET B N 3342 C CA . MET B 181 ? 0.1249 0.1155 0.1015 -0.0255 -0.0293 0.0223 181 MET B CA 3343 C C . MET B 181 ? 0.1023 0.1386 0.0902 -0.0186 -0.0283 0.0257 181 MET B C 3344 O O . MET B 181 ? 0.1309 0.1067 0.0956 -0.0134 -0.0007 0.0300 181 MET B O 3345 C CB . MET B 181 ? 0.1330 0.1318 0.0973 -0.0200 -0.0316 0.0220 181 MET B CB 3346 C CG . MET B 181 ? 0.1375 0.1178 0.1018 -0.0139 -0.0343 0.0200 181 MET B CG 3347 S SD . MET B 181 ? 0.1361 0.1343 0.1232 -0.0218 -0.0208 0.0351 181 MET B SD 3348 C CE . MET B 181 ? 0.1487 0.2492 0.1295 -0.0838 -0.0268 0.0221 181 MET B CE 3349 N N . ALA B 182 ? 0.1357 0.1232 0.0721 -0.0316 -0.0096 0.0202 182 ALA B N 3350 C CA . ALA B 182 ? 0.1150 0.0995 0.0957 -0.0180 -0.0285 0.0185 182 ALA B CA 3351 C C . ALA B 182 ? 0.1048 0.0961 0.1075 -0.0221 -0.0364 0.0098 182 ALA B C 3352 O O . ALA B 182 ? 0.1134 0.1062 0.1102 -0.0009 -0.0221 0.0110 182 ALA B O 3353 C CB . ALA B 182 ? 0.1147 0.1223 0.0999 -0.0131 -0.0289 0.0314 182 ALA B CB 3354 N N . ARG B 183 ? 0.1243 0.0999 0.1191 -0.0150 -0.0310 0.0232 183 ARG B N 3355 C CA . ARG B 183 ? 0.1148 0.1041 0.1412 -0.0071 -0.0287 0.0360 183 ARG B CA 3356 C C . ARG B 183 ? 0.1314 0.0906 0.1138 0.0049 -0.0197 0.0341 183 ARG B C 3357 O O . ARG B 183 ? 0.1407 0.1179 0.1355 -0.0120 -0.0016 0.0212 183 ARG B O 3358 C CB . ARG B 183 ? 0.1232 0.1195 0.1355 -0.0020 -0.0149 0.0520 183 ARG B CB 3359 C CG . ARG B 183 ? 0.1477 0.1084 0.1193 -0.0186 -0.0588 0.0339 183 ARG B CG 3360 C CD . ARG B 183 ? 0.1870 0.1408 0.1706 -0.0246 -0.0493 0.0824 183 ARG B CD 3361 N NE . ARG B 183 ? 0.2207 0.1292 0.1379 -0.0361 -0.0395 0.0500 183 ARG B NE 3362 C CZ . ARG B 183 ? 0.1838 0.1190 0.1384 -0.0120 -0.0401 0.0519 183 ARG B CZ 3363 N NH1 . ARG B 183 ? 0.2186 0.1405 0.1355 -0.0094 -0.0402 0.0508 183 ARG B NH1 3364 N NH2 . ARG B 183 ? 0.2114 0.1414 0.1765 -0.0401 -0.0393 0.0753 183 ARG B NH2 3365 N N . THR B 184 ? 0.1037 0.1176 0.1092 -0.0034 -0.0120 0.0246 184 THR B N 3366 C CA . THR B 184 ? 0.1010 0.1221 0.1257 -0.0064 0.0000 0.0221 184 THR B CA 3367 C C . THR B 184 ? 0.1217 0.1155 0.0978 -0.0058 0.0047 0.0011 184 THR B C 3368 O O . THR B 184 ? 0.1335 0.1070 0.1229 -0.0102 0.0118 0.0160 184 THR B O 3369 C CB . THR B 184 ? 0.1296 0.1295 0.0981 -0.0083 -0.0158 0.0280 184 THR B CB 3370 O OG1 . THR B 184 ? 0.1698 0.1757 0.1557 -0.0026 -0.0628 0.0437 184 THR B OG1 3371 C CG2 . THR B 184 ? 0.1552 0.1590 0.1546 -0.0537 -0.0341 0.0355 184 THR B CG2 3372 N N . VAL B 185 ? 0.1197 0.0936 0.1000 -0.0054 -0.0121 0.0040 185 VAL B N 3373 C CA . VAL B 185 ? 0.1277 0.1086 0.0973 -0.0039 0.0005 0.0123 185 VAL B CA 3374 C C . VAL B 185 ? 0.1189 0.1000 0.0943 -0.0074 -0.0165 0.0130 185 VAL B C 3375 O O . VAL B 185 ? 0.1287 0.1235 0.0998 0.0012 -0.0150 0.0169 185 VAL B O 3376 C CB . VAL B 185 ? 0.1213 0.1153 0.1032 -0.0016 0.0029 0.0173 185 VAL B CB 3377 C CG1 . VAL B 185 ? 0.1281 0.1365 0.1134 0.0011 -0.0053 0.0163 185 VAL B CG1 3378 C CG2 . VAL B 185 ? 0.1568 0.1220 0.0972 0.0230 -0.0079 0.0153 185 VAL B CG2 3379 N N . ALA B 186 ? 0.1365 0.0998 0.0949 -0.0058 -0.0246 0.0166 186 ALA B N 3380 C CA . ALA B 186 ? 0.1317 0.0942 0.1245 -0.0060 0.0027 0.0157 186 ALA B CA 3381 C C . ALA B 186 ? 0.1308 0.1014 0.1184 -0.0101 -0.0077 0.0156 186 ALA B C 3382 O O . ALA B 186 ? 0.1428 0.1077 0.1250 0.0092 0.0009 0.0090 186 ALA B O 3383 C CB . ALA B 186 ? 0.1364 0.1034 0.1799 -0.0247 -0.0110 0.0180 186 ALA B CB 3384 N N . LYS B 187 ? 0.1214 0.1310 0.1329 -0.0007 0.0011 0.0116 187 LYS B N 3385 C CA . LYS B 187 ? 0.1244 0.1221 0.1444 0.0043 -0.0081 0.0118 187 LYS B CA 3386 C C . LYS B 187 ? 0.1145 0.1219 0.1343 -0.0129 -0.0091 0.0122 187 LYS B C 3387 O O . LYS B 187 ? 0.1368 0.1365 0.1774 0.0030 0.0091 0.0101 187 LYS B O 3388 C CB . LYS B 187 ? 0.1590 0.1389 0.1944 -0.0065 -0.0627 0.0641 187 LYS B CB 3389 C CG . LYS B 187 ? 0.1833 0.4219 0.2939 0.0833 -0.1327 -0.1600 187 LYS B CG 3390 C CD . LYS B 187 ? 0.3607 0.3875 0.3224 0.2590 -0.1563 -0.1317 187 LYS B CD 3391 C CE . LYS B 187 ? 0.5160 0.5321 0.4889 0.1036 -0.1308 0.0124 187 LYS B CE 3392 N NZ . LYS B 187 ? 0.4651 0.6967 0.4993 0.1370 -0.1169 0.2034 187 LYS B NZ 3393 N N . VAL B 188 ? 0.1117 0.1221 0.1535 -0.0101 -0.0185 0.0099 188 VAL B N 3394 C CA . VAL B 188 ? 0.1005 0.1214 0.1672 -0.0140 0.0112 0.0019 188 VAL B CA 3395 C C . VAL B 188 ? 0.1252 0.1130 0.1465 -0.0129 0.0205 0.0025 188 VAL B C 3396 O O . VAL B 188 ? 0.1302 0.1453 0.1766 -0.0073 0.0349 0.0242 188 VAL B O 3397 C CB . VAL B 188 ? 0.1322 0.1257 0.1634 -0.0298 -0.0023 -0.0062 188 VAL B CB 3398 C CG1 . VAL B 188 ? 0.1328 0.1260 0.1597 -0.0225 0.0030 -0.0083 188 VAL B CG1 3399 C CG2 . VAL B 188 ? 0.1973 0.2291 0.1254 -0.0715 0.0041 -0.0112 188 VAL B CG2 3400 N N . LEU B 189 ? 0.1269 0.1032 0.1235 -0.0230 0.0036 0.0172 189 LEU B N 3401 C CA . LEU B 189 ? 0.1556 0.1031 0.1255 -0.0226 0.0006 0.0024 189 LEU B CA 3402 C C . LEU B 189 ? 0.1946 0.1053 0.1340 -0.0303 0.0137 -0.0066 189 LEU B C 3403 O O . LEU B 189 ? 0.1938 0.1219 0.1435 -0.0257 -0.0029 -0.0034 189 LEU B O 3404 C CB . LEU B 189 ? 0.1572 0.1162 0.1168 -0.0048 -0.0159 0.0218 189 LEU B CB 3405 C CG . LEU B 189 ? 0.1493 0.1156 0.1384 -0.0040 -0.0170 0.0097 189 LEU B CG 3406 C CD1 . LEU B 189 ? 0.1507 0.1753 0.1446 0.0265 -0.0174 0.0103 189 LEU B CD1 3407 C CD2 . LEU B 189 ? 0.1829 0.1348 0.2637 -0.0058 0.0254 0.0536 189 LEU B CD2 3408 N N . TYR B 190 ? 0.1596 0.1013 0.1574 -0.0232 -0.0056 -0.0027 190 TYR B N 3409 C CA . TYR B 190 ? 0.1723 0.1046 0.1470 -0.0324 -0.0179 -0.0029 190 TYR B CA 3410 C C . TYR B 190 ? 0.1796 0.1175 0.1789 -0.0114 0.0111 -0.0145 190 TYR B C 3411 O O . TYR B 190 ? 0.2174 0.1430 0.2542 0.0114 -0.0134 -0.0518 190 TYR B O 3412 C CB . TYR B 190 ? 0.1623 0.1035 0.1469 -0.0246 -0.0283 0.0016 190 TYR B CB 3413 C CG . TYR B 190 ? 0.1700 0.1194 0.1828 -0.0124 -0.0471 0.0049 190 TYR B CG 3414 C CD1 . TYR B 190 ? 0.1724 0.1146 0.2228 -0.0082 -0.0381 -0.0246 190 TYR B CD1 3415 C CD2 . TYR B 190 ? 0.1977 0.1946 0.2141 -0.0090 -0.0773 0.0325 190 TYR B CD2 3416 C CE1 . TYR B 190 ? 0.2079 0.1706 0.2907 0.0384 -0.0758 -0.0575 190 TYR B CE1 3417 C CE2 . TYR B 190 ? 0.2024 0.1728 0.2938 -0.0095 -0.0665 0.0887 190 TYR B CE2 3418 C CZ . TYR B 190 ? 0.2518 0.1396 0.3370 0.0330 -0.0729 0.0213 190 TYR B CZ 3419 O OH . TYR B 190 ? 0.3038 0.1969 0.4042 0.0901 -0.1715 -0.0780 190 TYR B OH 3420 N N . GLY B 191 ? 0.1858 0.1031 0.2249 -0.0019 -0.0290 0.0038 191 GLY B N 3421 C CA . GLY B 191 ? 0.1872 0.1136 0.2736 0.0046 -0.0036 0.0377 191 GLY B CA 3422 C C . GLY B 191 ? 0.1886 0.1065 0.3168 -0.0002 0.0120 0.0063 191 GLY B C 3423 O O . GLY B 191 ? 0.1952 0.1542 0.3527 0.0327 0.0260 0.0316 191 GLY B O 3424 N N . GLY B 192 ? 0.1626 0.1114 0.2952 -0.0047 0.0165 -0.0114 192 GLY B N 3425 C CA . GLY B 192 ? 0.1840 0.1967 0.2883 0.0065 0.0470 -0.0590 192 GLY B CA 3426 C C . GLY B 192 ? 0.1692 0.1479 0.3140 -0.0214 0.0673 -0.0146 192 GLY B C 3427 O O . GLY B 192 ? 0.1665 0.1440 0.3877 0.0126 0.0621 0.0077 192 GLY B O 3428 N N . ALA B 193 ? 0.1571 0.1376 0.2023 0.0147 0.0043 0.0278 193 ALA B N 3429 C CA . ALA B 193 ? 0.1625 0.1494 0.1923 0.0158 -0.0257 0.0554 193 ALA B CA 3430 C C . ALA B 193 ? 0.0932 0.1714 0.2451 0.0335 -0.0135 0.0749 193 ALA B C 3431 O O . ALA B 193 ? 0.1243 0.1624 0.2182 0.0219 -0.0189 0.0262 193 ALA B O 3432 C CB . ALA B 193 ? 0.1709 0.1826 0.2250 -0.0282 -0.0111 0.0025 193 ALA B CB 3433 N N . LEU B 194 ? 0.1344 0.1349 0.1946 0.0095 -0.0139 0.0491 194 LEU B N 3434 C CA . LEU B 194 ? 0.1072 0.1152 0.1848 -0.0106 -0.0238 0.0199 194 LEU B CA 3435 C C . LEU B 194 ? 0.1159 0.1184 0.1949 0.0072 0.0030 0.0111 194 LEU B C 3436 O O . LEU B 194 ? 0.1512 0.1257 0.1735 -0.0106 -0.0041 0.0016 194 LEU B O 3437 C CB . LEU B 194 ? 0.1368 0.1149 0.1694 0.0157 -0.0149 0.0085 194 LEU B CB 3438 C CG . LEU B 194 ? 0.1372 0.1312 0.1505 -0.0019 -0.0473 0.0145 194 LEU B CG 3439 C CD1 . LEU B 194 ? 0.1103 0.1347 0.1741 -0.0010 0.0165 -0.0009 194 LEU B CD1 3440 C CD2 . LEU B 194 ? 0.1305 0.1408 0.2398 -0.0039 -0.0507 0.0038 194 LEU B CD2 3441 N N . THR B 195 ? 0.1099 0.1261 0.2094 0.0131 0.0210 0.0045 195 THR B N 3442 C CA . THR B 195 ? 0.1279 0.1295 0.2134 0.0285 0.0299 -0.0096 195 THR B CA 3443 C C . THR B 195 ? 0.1476 0.1272 0.2367 0.0213 -0.0067 -0.0223 195 THR B C 3444 O O . THR B 195 ? 0.1126 0.1206 0.1819 0.0095 -0.0003 0.0087 195 THR B O 3445 C CB . THR B 195 ? 0.1664 0.1410 0.2094 -0.0048 0.0371 -0.0235 195 THR B CB 3446 O OG1 . THR B 195 ? 0.1563 0.1339 0.2137 -0.0097 0.0369 -0.0135 195 THR B OG1 3447 C CG2 . THR B 195 ? 0.1366 0.1514 0.4743 0.0057 0.0480 -0.0193 195 THR B CG2 3448 N N . SER B 196 ? 0.1702 0.1603 0.2530 0.0129 -0.0096 -0.0401 196 SER B N 3449 C CA . SER B 196 ? 0.1556 0.1703 0.2076 0.0102 0.0099 -0.0173 196 SER B CA 3450 C C . SER B 196 ? 0.1794 0.1679 0.1263 0.0067 0.0249 -0.0225 196 SER B C 3451 O O . SER B 196 ? 0.1703 0.1565 0.1700 0.0031 0.0043 -0.0245 196 SER B O 3452 C CB A SER B 196 ? 0.3517 0.1582 0.2500 0.0413 -0.0659 -0.0452 196 SER B CB 3453 C CB B SER B 196 ? 0.3214 0.1542 0.2380 0.0582 -0.0574 -0.0348 196 SER B CB 3454 O OG A SER B 196 ? 0.4768 0.2789 0.4433 -0.0284 -0.2661 -0.0526 196 SER B OG 3455 O OG B SER B 196 ? 0.3280 0.3787 0.2757 0.0982 0.0038 -0.2082 196 SER B OG 3456 N N . THR B 197 ? 0.1706 0.1721 0.1461 0.0166 0.0178 -0.0143 197 THR B N 3457 C CA . THR B 197 ? 0.1799 0.1532 0.1653 -0.0070 -0.0036 -0.0304 197 THR B CA 3458 C C . THR B 197 ? 0.1594 0.1487 0.1251 0.0053 0.0299 0.0147 197 THR B C 3459 O O . THR B 197 ? 0.1683 0.1469 0.1317 0.0097 0.0020 0.0107 197 THR B O 3460 C CB . THR B 197 ? 0.3592 0.2249 0.1851 -0.0216 0.1482 -0.0145 197 THR B CB 3461 O OG1 . THR B 197 ? 0.4172 0.3805 0.2093 -0.0862 0.0966 -0.0864 197 THR B OG1 3462 C CG2 . THR B 197 ? 0.3701 0.2666 0.2661 -0.0010 0.1377 0.0784 197 THR B CG2 3463 N N . SER B 198 ? 0.1305 0.1276 0.1461 -0.0048 0.0199 0.0019 198 SER B N 3464 C CA . SER B 198 ? 0.1132 0.1289 0.1465 -0.0052 0.0038 -0.0013 198 SER B CA 3465 C C . SER B 198 ? 0.1160 0.1189 0.1248 -0.0001 -0.0020 -0.0032 198 SER B C 3466 O O . SER B 198 ? 0.1291 0.1182 0.1238 0.0067 -0.0116 -0.0101 198 SER B O 3467 C CB . SER B 198 ? 0.1138 0.1196 0.1689 -0.0008 0.0020 0.0119 198 SER B CB 3468 O OG . SER B 198 ? 0.1019 0.1400 0.2129 -0.0091 0.0023 0.0203 198 SER B OG 3469 N N . THR B 199 ? 0.1143 0.1045 0.1406 0.0118 0.0072 0.0062 199 THR B N 3470 C CA . THR B 199 ? 0.1175 0.1102 0.1224 0.0035 -0.0011 0.0146 199 THR B CA 3471 C C . THR B 199 ? 0.1184 0.1038 0.1302 -0.0060 -0.0083 0.0194 199 THR B C 3472 O O . THR B 199 ? 0.1207 0.1365 0.1208 0.0096 -0.0062 0.0094 199 THR B O 3473 C CB . THR B 199 ? 0.1053 0.1080 0.1487 0.0094 -0.0054 0.0117 199 THR B CB 3474 O OG1 . THR B 199 ? 0.1245 0.1157 0.1554 0.0020 -0.0159 0.0215 199 THR B OG1 3475 C CG2 . THR B 199 ? 0.1290 0.1333 0.1968 0.0009 0.0119 0.0492 199 THR B CG2 3476 N N . HIS B 200 ? 0.1260 0.1131 0.1240 0.0117 -0.0054 0.0128 200 HIS B N 3477 C CA . HIS B 200 ? 0.1261 0.1326 0.1175 0.0079 -0.0154 0.0071 200 HIS B CA 3478 C C . HIS B 200 ? 0.1218 0.1373 0.1033 0.0140 -0.0319 0.0007 200 HIS B C 3479 O O . HIS B 200 ? 0.1230 0.1449 0.1348 0.0215 -0.0139 0.0113 200 HIS B O 3480 C CB . HIS B 200 ? 0.1886 0.1355 0.1161 -0.0092 -0.0183 0.0004 200 HIS B CB 3481 C CG . HIS B 200 ? 0.2519 0.2323 0.1299 0.0386 -0.0414 0.0023 200 HIS B CG 3482 N ND1 . HIS B 200 ? 0.2839 0.3495 0.3114 -0.0020 -0.1729 0.0370 200 HIS B ND1 3483 C CD2 . HIS B 200 ? 0.3574 0.3135 0.1378 0.0754 -0.0364 0.0689 200 HIS B CD2 3484 C CE1 . HIS B 200 ? 0.3063 0.3447 0.2342 0.1459 -0.1076 -0.0660 200 HIS B CE1 3485 N NE2 . HIS B 200 ? 0.4070 0.2848 0.2383 0.1693 -0.1050 -0.0347 200 HIS B NE2 3486 N N . THR B 201 ? 0.1201 0.1267 0.1032 0.0019 0.0066 0.0192 201 THR B N 3487 C CA . THR B 201 ? 0.1396 0.1337 0.0925 -0.0023 -0.0118 0.0191 201 THR B CA 3488 C C . THR B 201 ? 0.1210 0.1037 0.1013 0.0073 -0.0158 0.0150 201 THR B C 3489 O O . THR B 201 ? 0.1149 0.1072 0.1009 0.0035 -0.0309 0.0179 201 THR B O 3490 C CB . THR B 201 ? 0.1577 0.1338 0.1420 -0.0204 0.0378 0.0062 201 THR B CB 3491 O OG1 . THR B 201 ? 0.1852 0.1834 0.1453 -0.0351 0.0360 -0.0114 201 THR B OG1 3492 C CG2 . THR B 201 ? 0.1685 0.1328 0.1576 -0.0158 -0.0090 0.0039 201 THR B CG2 3493 N N . ILE B 202 ? 0.0965 0.1028 0.0957 0.0013 -0.0164 0.0111 202 ILE B N 3494 C CA . ILE B 202 ? 0.1019 0.1085 0.1046 -0.0058 -0.0039 0.0174 202 ILE B CA 3495 C C . ILE B 202 ? 0.1049 0.1113 0.1092 -0.0047 -0.0013 0.0061 202 ILE B C 3496 O O . ILE B 202 ? 0.0949 0.1277 0.1090 0.0004 -0.0199 -0.0055 202 ILE B O 3497 C CB . ILE B 202 ? 0.1183 0.1436 0.0982 -0.0069 -0.0149 0.0103 202 ILE B CB 3498 C CG1 . ILE B 202 ? 0.1604 0.1507 0.1238 0.0005 -0.0519 -0.0135 202 ILE B CG1 3499 C CG2 . ILE B 202 ? 0.1606 0.1226 0.1345 0.0211 -0.0094 0.0225 202 ILE B CG2 3500 C CD1 . ILE B 202 ? 0.1700 0.1942 0.1332 -0.0175 -0.0643 0.0037 202 ILE B CD1 3501 N N . GLU B 203 ? 0.0968 0.1176 0.1033 -0.0015 -0.0157 0.0064 203 GLU B N 3502 C CA . GLU B 203 ? 0.1077 0.1047 0.1141 -0.0114 0.0037 -0.0042 203 GLU B CA 3503 C C . GLU B 203 ? 0.0880 0.1160 0.0826 -0.0208 -0.0167 -0.0102 203 GLU B C 3504 O O . GLU B 203 ? 0.0814 0.1279 0.1124 -0.0137 -0.0126 -0.0046 203 GLU B O 3505 C CB . GLU B 203 ? 0.1472 0.1162 0.1957 -0.0434 0.0043 -0.0214 203 GLU B CB 3506 C CG . GLU B 203 ? 0.1445 0.1893 0.3027 -0.0401 -0.0074 -0.1049 203 GLU B CG 3507 C CD . GLU B 203 ? 0.1602 0.2703 0.2382 -0.1003 0.0462 -0.0984 203 GLU B CD 3508 O OE1 . GLU B 203 ? 0.3394 0.2143 0.1837 -0.1308 0.0283 -0.0977 203 GLU B OE1 3509 O OE2 . GLU B 203 ? 0.2721 0.4601 0.2682 -0.1771 0.1318 -0.0946 203 GLU B OE2 3510 N N . ARG B 204 ? 0.0955 0.1147 0.0909 -0.0034 -0.0035 -0.0094 204 ARG B N 3511 C CA . ARG B 204 ? 0.0871 0.1104 0.0897 -0.0132 -0.0235 -0.0045 204 ARG B CA 3512 C C . ARG B 204 ? 0.0837 0.1157 0.0973 -0.0184 -0.0198 -0.0155 204 ARG B C 3513 O O . ARG B 204 ? 0.0989 0.1194 0.0869 -0.0054 -0.0184 0.0049 204 ARG B O 3514 C CB . ARG B 204 ? 0.1305 0.1528 0.0894 -0.0072 -0.0028 0.0052 204 ARG B CB 3515 C CG . ARG B 204 ? 0.1190 0.1616 0.1041 0.0010 -0.0067 -0.0084 204 ARG B CG 3516 C CD . ARG B 204 ? 0.1418 0.1064 0.1294 0.0090 -0.0226 -0.0065 204 ARG B CD 3517 N NE . ARG B 204 ? 0.1330 0.1269 0.1060 -0.0245 -0.0325 0.0138 204 ARG B NE 3518 C CZ . ARG B 204 ? 0.1403 0.0955 0.1152 -0.0204 -0.0397 -0.0045 204 ARG B CZ 3519 N NH1 . ARG B 204 ? 0.1275 0.1143 0.1184 -0.0197 -0.0356 0.0121 204 ARG B NH1 3520 N NH2 . ARG B 204 ? 0.1327 0.1268 0.1037 -0.0218 -0.0341 0.0159 204 ARG B NH2 3521 N N . TRP B 205 ? 0.0873 0.0999 0.1023 -0.0267 -0.0226 0.0028 205 TRP B N 3522 C CA . TRP B 205 ? 0.0877 0.1185 0.1096 -0.0272 -0.0229 -0.0110 205 TRP B CA 3523 C C . TRP B 205 ? 0.0936 0.1108 0.1001 -0.0069 -0.0249 0.0090 205 TRP B C 3524 O O . TRP B 205 ? 0.1104 0.1051 0.1156 -0.0120 -0.0128 -0.0121 205 TRP B O 3525 C CB . TRP B 205 ? 0.0934 0.1105 0.1160 -0.0147 -0.0257 -0.0085 205 TRP B CB 3526 C CG . TRP B 205 ? 0.0852 0.1564 0.1245 -0.0184 -0.0216 -0.0032 205 TRP B CG 3527 C CD1 . TRP B 205 ? 0.0906 0.1825 0.1232 -0.0247 -0.0020 -0.0069 205 TRP B CD1 3528 C CD2 . TRP B 205 ? 0.0904 0.1304 0.1240 -0.0206 -0.0139 -0.0226 205 TRP B CD2 3529 N NE1 . TRP B 205 ? 0.1044 0.1997 0.1217 -0.0342 0.0036 -0.0021 205 TRP B NE1 3530 C CE2 . TRP B 205 ? 0.0973 0.1407 0.1440 -0.0221 -0.0091 0.0065 205 TRP B CE2 3531 C CE3 . TRP B 205 ? 0.0922 0.1219 0.1230 -0.0023 -0.0170 -0.0139 205 TRP B CE3 3532 C CZ2 . TRP B 205 ? 0.0926 0.1660 0.1758 -0.0126 -0.0020 -0.0073 205 TRP B CZ2 3533 C CZ3 . TRP B 205 ? 0.1071 0.1810 0.1685 -0.0358 -0.0380 -0.0074 205 TRP B CZ3 3534 C CH2 . TRP B 205 ? 0.1026 0.1695 0.1773 -0.0405 -0.0165 -0.0335 205 TRP B CH2 3535 N N . LEU B 206 ? 0.0811 0.1046 0.0948 -0.0110 -0.0256 -0.0040 206 LEU B N 3536 C CA . LEU B 206 ? 0.0707 0.0879 0.1016 -0.0019 -0.0303 0.0012 206 LEU B CA 3537 C C . LEU B 206 ? 0.0735 0.0902 0.0794 -0.0052 -0.0240 0.0122 206 LEU B C 3538 O O . LEU B 206 ? 0.0969 0.1057 0.0712 0.0131 -0.0273 0.0057 206 LEU B O 3539 C CB . LEU B 206 ? 0.0879 0.1030 0.0866 0.0162 -0.0174 0.0092 206 LEU B CB 3540 C CG . LEU B 206 ? 0.1220 0.1367 0.1011 0.0191 -0.0374 0.0130 206 LEU B CG 3541 C CD1 . LEU B 206 ? 0.2744 0.1263 0.1575 0.0682 -0.0930 0.0070 206 LEU B CD1 3542 C CD2 . LEU B 206 ? 0.1614 0.1396 0.1049 0.0147 -0.0628 0.0002 206 LEU B CD2 3543 N N . ILE B 207 ? 0.0937 0.1138 0.0804 0.0066 -0.0290 0.0039 207 ILE B N 3544 C CA . ILE B 207 ? 0.0784 0.1145 0.0692 -0.0051 -0.0117 0.0140 207 ILE B CA 3545 C C . ILE B 207 ? 0.1002 0.1133 0.0500 -0.0074 -0.0205 0.0160 207 ILE B C 3546 O O . ILE B 207 ? 0.0911 0.1306 0.1056 -0.0002 -0.0223 0.0239 207 ILE B O 3547 C CB . ILE B 207 ? 0.0920 0.1256 0.0764 0.0030 -0.0214 0.0044 207 ILE B CB 3548 C CG1 . ILE B 207 ? 0.0823 0.1225 0.1010 -0.0124 -0.0145 -0.0131 207 ILE B CG1 3549 C CG2 . ILE B 207 ? 0.1278 0.1524 0.1041 -0.0202 -0.0558 0.0260 207 ILE B CG2 3550 C CD1 . ILE B 207 ? 0.1338 0.1149 0.0806 -0.0318 -0.0127 0.0001 207 ILE B CD1 3551 N N . GLY B 208 ? 0.0877 0.1012 0.0803 0.0060 -0.0203 0.0102 208 GLY B N 3552 C CA . GLY B 208 ? 0.1101 0.0947 0.0976 -0.0068 -0.0076 0.0162 208 GLY B CA 3553 C C . GLY B 208 ? 0.1011 0.0906 0.1092 -0.0017 -0.0206 0.0091 208 GLY B C 3554 O O . GLY B 208 ? 0.1475 0.0945 0.1108 -0.0112 -0.0011 0.0123 208 GLY B O 3555 N N . ASN B 209 ? 0.1086 0.0816 0.1037 -0.0058 -0.0378 -0.0053 209 ASN B N 3556 C CA . ASN B 209 ? 0.1253 0.0974 0.1075 0.0093 -0.0244 -0.0077 209 ASN B CA 3557 C C . ASN B 209 ? 0.1059 0.1004 0.0997 0.0006 -0.0360 -0.0067 209 ASN B C 3558 O O . ASN B 209 ? 0.1160 0.1243 0.1025 -0.0101 -0.0336 0.0005 209 ASN B O 3559 C CB . ASN B 209 ? 0.1867 0.1247 0.1078 -0.0047 -0.0745 0.0138 209 ASN B CB 3560 C CG . ASN B 209 ? 0.1829 0.1002 0.1196 -0.0259 -0.0205 0.0031 209 ASN B CG 3561 O OD1 . ASN B 209 ? 0.1830 0.1646 0.1465 -0.0576 -0.0268 -0.0175 209 ASN B OD1 3562 N ND2 . ASN B 209 ? 0.1859 0.1422 0.2003 -0.0376 0.0244 -0.0370 209 ASN B ND2 3563 N N . GLN B 210 ? 0.1050 0.0878 0.0981 0.0071 -0.0443 0.0027 210 GLN B N 3564 C CA . GLN B 210 ? 0.1157 0.0967 0.1032 0.0133 -0.0346 0.0091 210 GLN B CA 3565 C C . GLN B 210 ? 0.1074 0.1047 0.1035 0.0129 -0.0372 0.0114 210 GLN B C 3566 O O . GLN B 210 ? 0.1501 0.1362 0.1384 0.0459 -0.0237 0.0092 210 GLN B O 3567 C CB . GLN B 210 ? 0.1351 0.0900 0.0927 0.0193 -0.0301 0.0080 210 GLN B CB 3568 C CG . GLN B 210 ? 0.1540 0.0989 0.0938 -0.0135 -0.0414 0.0030 210 GLN B CG 3569 C CD . GLN B 210 ? 0.1647 0.1034 0.1254 -0.0050 0.0038 -0.0034 210 GLN B CD 3570 O OE1 . GLN B 210 ? 0.2202 0.0995 0.2598 -0.0153 0.0501 -0.0054 210 GLN B OE1 3571 N NE2 . GLN B 210 ? 0.2554 0.1744 0.2467 0.0053 0.1186 0.0213 210 GLN B NE2 3572 N N . THR B 211 ? 0.0915 0.0948 0.1052 -0.0024 -0.0389 0.0075 211 THR B N 3573 C CA . THR B 211 ? 0.1302 0.0867 0.1137 -0.0089 -0.0207 0.0089 211 THR B CA 3574 C C . THR B 211 ? 0.0874 0.1048 0.1343 0.0025 -0.0203 0.0093 211 THR B C 3575 O O . THR B 211 ? 0.1142 0.1499 0.1406 -0.0044 -0.0091 0.0179 211 THR B O 3576 C CB . THR B 211 ? 0.1181 0.1172 0.1043 -0.0134 -0.0158 -0.0173 211 THR B CB 3577 O OG1 . THR B 211 ? 0.1423 0.1416 0.1268 0.0122 -0.0269 0.0183 211 THR B OG1 3578 C CG2 . THR B 211 ? 0.1673 0.1660 0.1213 -0.0597 -0.0284 -0.0073 211 THR B CG2 3579 N N . GLY B 212 ? 0.1103 0.1095 0.1680 -0.0235 -0.0083 -0.0018 212 GLY B N 3580 C CA . GLY B 212 ? 0.1174 0.1020 0.1711 -0.0076 -0.0299 0.0324 212 GLY B CA 3581 C C . GLY B 212 ? 0.1146 0.0959 0.1597 -0.0141 -0.0387 0.0001 212 GLY B C 3582 O O . GLY B 212 ? 0.1434 0.1130 0.1936 -0.0269 -0.0593 0.0280 212 GLY B O 3583 N N . ASP B 213 ? 0.0977 0.1270 0.1767 -0.0021 -0.0116 0.0377 213 ASP B N 3584 C CA . ASP B 213 ? 0.1212 0.1437 0.1966 0.0097 -0.0331 0.0430 213 ASP B CA 3585 C C . ASP B 213 ? 0.0882 0.1915 0.2303 -0.0009 -0.0347 0.0455 213 ASP B C 3586 O O . ASP B 213 ? 0.1195 0.1974 0.3137 -0.0248 -0.0722 0.0581 213 ASP B O 3587 C CB . ASP B 213 ? 0.1525 0.1637 0.2363 0.0228 -0.0503 0.0633 213 ASP B CB 3588 C CG . ASP B 213 ? 0.1860 0.1575 0.2437 -0.0064 -0.0425 0.0784 213 ASP B CG 3589 O OD1 . ASP B 213 ? 0.3199 0.1955 0.2787 0.0323 -0.0355 0.1261 213 ASP B OD1 3590 O OD2 . ASP B 213 ? 0.1559 0.1854 0.2074 -0.0044 -0.0440 0.0789 213 ASP B OD2 3591 N N . ALA B 214 ? 0.1238 0.1406 0.2325 0.0049 0.0053 0.0211 214 ALA B N 3592 C CA . ALA B 214 ? 0.0929 0.1447 0.2520 0.0147 -0.0134 0.0156 214 ALA B CA 3593 C C . ALA B 214 ? 0.0952 0.1452 0.2296 -0.0124 -0.0018 0.0127 214 ALA B C 3594 O O . ALA B 214 ? 0.0976 0.1849 0.2483 -0.0064 0.0098 0.0056 214 ALA B O 3595 C CB . ALA B 214 ? 0.1727 0.1396 0.3493 0.0159 0.0737 -0.0087 214 ALA B CB 3596 N N . THR B 215 ? 0.1346 0.1364 0.1500 0.0059 -0.0211 -0.0077 215 THR B N 3597 C CA . THR B 215 ? 0.1231 0.1409 0.1839 -0.0086 -0.0148 0.0117 215 THR B CA 3598 C C . THR B 215 ? 0.1200 0.1359 0.1448 0.0046 -0.0237 0.0094 215 THR B C 3599 O O . THR B 215 ? 0.1058 0.1551 0.1673 0.0077 -0.0109 0.0124 215 THR B O 3600 C CB . THR B 215 ? 0.1504 0.1759 0.1695 -0.0243 -0.0402 0.0102 215 THR B CB 3601 O OG1 . THR B 215 ? 0.1158 0.1911 0.2514 -0.0100 -0.0147 0.0251 215 THR B OG1 3602 C CG2 . THR B 215 ? 0.2146 0.1975 0.2315 -0.0083 -0.0760 -0.0273 215 THR B CG2 3603 N N . LEU B 216 ? 0.0931 0.1470 0.1778 -0.0038 -0.0133 0.0246 216 LEU B N 3604 C CA . LEU B 216 ? 0.1154 0.1230 0.2146 -0.0016 0.0060 0.0372 216 LEU B CA 3605 C C . LEU B 216 ? 0.1229 0.1255 0.2205 -0.0265 -0.0066 0.0137 216 LEU B C 3606 O O . LEU B 216 ? 0.1220 0.1308 0.2800 -0.0347 -0.0055 0.0193 216 LEU B O 3607 C CB . LEU B 216 ? 0.1401 0.1495 0.2868 0.0280 0.0240 0.0741 216 LEU B CB 3608 C CG . LEU B 216 ? 0.1379 0.1991 0.2620 0.0472 0.0506 0.0809 216 LEU B CG 3609 C CD1 . LEU B 216 ? 0.1187 0.1821 0.1888 0.0214 -0.0360 0.0061 216 LEU B CD1 3610 C CD2 . LEU B 216 ? 0.1214 0.1558 0.2200 -0.0295 -0.0207 0.0247 216 LEU B CD2 3611 N N . ARG B 217 ? 0.1251 0.2043 0.1767 -0.0782 0.0019 -0.0226 217 ARG B N 3612 C CA . ARG B 217 ? 0.1734 0.3777 0.1553 -0.1346 0.0146 -0.0592 217 ARG B CA 3613 C C . ARG B 217 ? 0.1985 0.2963 0.1229 -0.1324 -0.0365 0.0295 217 ARG B C 3614 O O . ARG B 217 ? 0.2376 0.3242 0.1595 -0.1612 -0.0586 0.0338 217 ARG B O 3615 C CB . ARG B 217 ? 0.2479 0.5983 0.1769 -0.2206 -0.0277 0.0651 217 ARG B CB 3616 C CG A ARG B 217 ? 0.2805 0.5696 0.1686 -0.1979 0.0733 0.0085 217 ARG B CG 3617 C CG B ARG B 217 ? 0.2924 0.4756 0.0944 -0.1968 -0.0076 0.0723 217 ARG B CG 3618 C CD A ARG B 217 ? 0.1887 0.4076 0.1782 -0.1252 0.0124 -0.0539 217 ARG B CD 3619 C CD B ARG B 217 ? 0.1699 0.3372 0.1501 -0.0767 0.0065 -0.0082 217 ARG B CD 3620 N NE A ARG B 217 ? 0.1906 0.2840 0.1686 -0.0983 0.0291 -0.0053 217 ARG B NE 3621 N NE B ARG B 217 ? 0.1789 0.3059 0.1911 -0.0756 0.0262 -0.0145 217 ARG B NE 3622 C CZ A ARG B 217 ? 0.1980 0.1576 0.2478 -0.0310 0.0573 -0.0660 217 ARG B CZ 3623 C CZ B ARG B 217 ? 0.2391 0.2198 0.2446 -0.0756 0.0817 -0.0142 217 ARG B CZ 3624 N NH1 A ARG B 217 ? 0.1931 0.2433 0.2913 -0.0990 0.0891 -0.1053 217 ARG B NH1 3625 N NH1 B ARG B 217 ? 0.3905 0.2553 0.2663 0.0339 0.0070 -0.1026 217 ARG B NH1 3626 N NH2 A ARG B 217 ? 0.1645 0.1731 0.2237 0.0148 0.0694 0.0162 217 ARG B NH2 3627 N NH2 B ARG B 217 ? 0.2574 0.2082 0.5253 0.0245 0.1201 -0.1215 217 ARG B NH2 3628 N N . ALA B 218 ? 0.1698 0.2277 0.1722 -0.1006 -0.0420 0.0496 218 ALA B N 3629 C CA . ALA B 218 ? 0.1772 0.2303 0.2332 -0.0860 -0.1097 0.0820 218 ALA B CA 3630 C C . ALA B 218 ? 0.1309 0.1961 0.2304 -0.0366 -0.0375 0.0707 218 ALA B C 3631 O O . ALA B 218 ? 0.1650 0.1705 0.2908 -0.0383 -0.0866 0.0656 218 ALA B O 3632 C CB . ALA B 218 ? 0.1374 0.1931 0.3499 -0.0557 -0.0649 0.0849 218 ALA B CB 3633 N N . GLY B 219 ? 0.1036 0.1962 0.2431 -0.0442 -0.0495 0.0581 219 GLY B N 3634 C CA . GLY B 219 ? 0.1122 0.1925 0.2031 -0.0291 -0.0652 0.0733 219 GLY B CA 3635 C C . GLY B 219 ? 0.1094 0.2108 0.1922 -0.0693 -0.0419 0.0605 219 GLY B C 3636 O O . GLY B 219 ? 0.1597 0.2269 0.1876 -0.0947 -0.0344 0.0423 219 GLY B O 3637 N N . PHE B 220 ? 0.1213 0.2062 0.2031 -0.0343 -0.0326 0.0923 220 PHE B N 3638 C CA . PHE B 220 ? 0.1187 0.2143 0.1839 -0.0296 -0.0476 0.0890 220 PHE B CA 3639 C C . PHE B 220 ? 0.1261 0.2142 0.1874 -0.0450 -0.0469 0.1161 220 PHE B C 3640 O O . PHE B 220 ? 0.1116 0.2323 0.2668 -0.0340 -0.0583 0.1429 220 PHE B O 3641 C CB . PHE B 220 ? 0.1187 0.1927 0.1455 -0.0621 -0.0545 0.0567 220 PHE B CB 3642 C CG . PHE B 220 ? 0.1025 0.1493 0.1278 -0.0238 -0.0311 0.0280 220 PHE B CG 3643 C CD1 . PHE B 220 ? 0.1117 0.1919 0.1120 -0.0452 -0.0340 0.0007 220 PHE B CD1 3644 C CD2 . PHE B 220 ? 0.1306 0.1519 0.1632 -0.0349 -0.0287 0.0650 220 PHE B CD2 3645 C CE1 . PHE B 220 ? 0.0872 0.2052 0.1180 -0.0066 -0.0101 0.0088 220 PHE B CE1 3646 C CE2 . PHE B 220 ? 0.1197 0.1710 0.1424 -0.0186 -0.0063 0.0523 220 PHE B CE2 3647 C CZ . PHE B 220 ? 0.1206 0.1653 0.1364 -0.0191 -0.0186 0.0174 220 PHE B CZ 3648 N N . PRO B 221 ? 0.1059 0.2388 0.1623 -0.0379 -0.0342 0.0956 221 PRO B N 3649 C CA . PRO B 221 ? 0.0925 0.2915 0.1595 -0.0278 -0.0285 0.0996 221 PRO B CA 3650 C C . PRO B 221 ? 0.0914 0.3036 0.1799 0.0085 -0.0053 0.1215 221 PRO B C 3651 O O . PRO B 221 ? 0.0935 0.3417 0.2114 0.0079 -0.0133 0.1629 221 PRO B O 3652 C CB . PRO B 221 ? 0.1065 0.3189 0.1443 -0.0293 0.0007 0.0535 221 PRO B CB 3653 C CG . PRO B 221 ? 0.0989 0.2568 0.1399 -0.0351 -0.0267 0.0512 221 PRO B CG 3654 C CD . PRO B 221 ? 0.1010 0.2233 0.1591 -0.0489 -0.0365 0.0727 221 PRO B CD 3655 N N . LYS B 222 ? 0.1010 0.3757 0.1886 0.0137 -0.0016 0.1657 222 LYS B N 3656 C CA . LYS B 222 ? 0.1257 0.3728 0.2623 0.0578 0.0515 0.1988 222 LYS B CA 3657 C C . LYS B 222 ? 0.1012 0.4047 0.1935 0.0388 0.0026 0.2008 222 LYS B C 3658 O O . LYS B 222 ? 0.1364 0.4252 0.2356 0.0391 0.0469 0.2052 222 LYS B O 3659 C CB . LYS B 222 ? 0.2527 0.3294 0.4251 0.0845 0.0221 0.2215 222 LYS B CB 3660 C CG . LYS B 222 ? 0.4756 0.3826 0.4704 0.1014 -0.1409 0.1180 222 LYS B CG 3661 C CD . LYS B 222 ? 0.3865 0.3022 0.4483 0.0097 -0.1239 0.2365 222 LYS B CD 3662 C CE . LYS B 222 ? 0.6395 0.3442 0.5720 -0.0146 -0.3335 0.2025 222 LYS B CE 3663 N NZ . LYS B 222 ? 0.9592 0.3842 0.8746 -0.0164 -0.3663 0.0290 222 LYS B NZ 3664 N N . ASP B 223 ? 0.1113 0.5096 0.1472 -0.0343 -0.0483 0.1226 223 ASP B N 3665 C CA . ASP B 223 ? 0.1527 0.5629 0.1269 -0.0769 -0.0508 0.0812 223 ASP B CA 3666 C C . ASP B 223 ? 0.1469 0.3693 0.1121 -0.1075 -0.0243 0.0288 223 ASP B C 3667 O O . ASP B 223 ? 0.1935 0.4464 0.1101 -0.1147 -0.0057 -0.0007 223 ASP B O 3668 C CB . ASP B 223 ? 0.1488 0.6569 0.3018 -0.0793 -0.0660 -0.0120 223 ASP B CB 3669 C CG . ASP B 223 ? 0.1219 0.5040 0.4854 -0.0279 0.0177 0.0883 223 ASP B CG 3670 O OD1 . ASP B 223 ? 0.2749 0.3122 0.2684 -0.0109 -0.0189 -0.0165 223 ASP B OD1 3671 O OD2 . ASP B 223 ? 0.5218 0.6780 0.5311 0.3031 0.2119 0.1542 223 ASP B OD2 3672 N N . TRP B 224 ? 0.0949 0.3775 0.1145 -0.0683 -0.0210 0.0311 224 TRP B N 3673 C CA . TRP B 224 ? 0.1173 0.2294 0.1235 -0.0635 -0.0090 0.0090 224 TRP B CA 3674 C C . TRP B 224 ? 0.1065 0.2197 0.0774 -0.0540 -0.0240 0.0070 224 TRP B C 3675 O O . TRP B 224 ? 0.1068 0.2106 0.1201 -0.0390 -0.0092 0.0233 224 TRP B O 3676 C CB . TRP B 224 ? 0.1085 0.2153 0.1148 -0.0501 -0.0024 0.0138 224 TRP B CB 3677 C CG . TRP B 224 ? 0.1584 0.2325 0.1264 -0.0903 -0.0219 0.0141 224 TRP B CG 3678 C CD1 . TRP B 224 ? 0.1469 0.2284 0.1437 -0.0758 -0.0069 -0.0131 224 TRP B CD1 3679 C CD2 . TRP B 224 ? 0.1502 0.1941 0.1223 -0.0456 0.0122 0.0018 224 TRP B CD2 3680 N NE1 . TRP B 224 ? 0.1555 0.2414 0.1807 -0.0864 0.0199 -0.0144 224 TRP B NE1 3681 C CE2 . TRP B 224 ? 0.1514 0.2589 0.1804 -0.0707 -0.0173 0.0634 224 TRP B CE2 3682 C CE3 . TRP B 224 ? 0.1225 0.2324 0.1217 -0.0167 -0.0204 0.0443 224 TRP B CE3 3683 C CZ2 . TRP B 224 ? 0.1270 0.2301 0.1850 -0.0351 0.0234 0.0439 224 TRP B CZ2 3684 C CZ3 . TRP B 224 ? 0.1447 0.3091 0.1161 -0.0387 0.0011 0.0330 224 TRP B CZ3 3685 C CH2 . TRP B 224 ? 0.1200 0.3049 0.1786 -0.0290 0.0119 0.0594 224 TRP B CH2 3686 N N . VAL B 225 ? 0.1194 0.1959 0.1016 -0.0531 -0.0176 0.0013 225 VAL B N 3687 C CA . VAL B 225 ? 0.1203 0.1654 0.0627 -0.0490 -0.0084 0.0135 225 VAL B CA 3688 C C . VAL B 225 ? 0.1132 0.1270 0.0782 -0.0114 -0.0198 0.0084 225 VAL B C 3689 O O . VAL B 225 ? 0.2504 0.1296 0.0928 -0.0455 -0.0657 0.0225 225 VAL B O 3690 C CB . VAL B 225 ? 0.1259 0.1544 0.0733 -0.0390 -0.0137 0.0204 225 VAL B CB 3691 C CG1 . VAL B 225 ? 0.1095 0.1783 0.1038 -0.0305 0.0152 -0.0054 225 VAL B CG1 3692 C CG2 . VAL B 225 ? 0.1620 0.2234 0.0840 -0.0172 -0.0224 -0.0240 225 VAL B CG2 3693 N N . VAL B 226 ? 0.1076 0.1247 0.0618 -0.0225 -0.0314 0.0263 226 VAL B N 3694 C CA . VAL B 226 ? 0.1045 0.1360 0.0696 -0.0281 -0.0352 0.0240 226 VAL B CA 3695 C C . VAL B 226 ? 0.0875 0.1190 0.0688 -0.0090 -0.0144 0.0185 226 VAL B C 3696 O O . VAL B 226 ? 0.1030 0.1217 0.0977 -0.0197 -0.0261 0.0351 226 VAL B O 3697 C CB . VAL B 226 ? 0.0915 0.2823 0.0788 -0.0522 0.0004 0.0000 226 VAL B CB 3698 C CG1 . VAL B 226 ? 0.1605 0.1995 0.0917 -0.0524 -0.0069 -0.0081 226 VAL B CG1 3699 C CG2 . VAL B 226 ? 0.1218 0.2739 0.1030 -0.0626 -0.0179 0.0107 226 VAL B CG2 3700 N N . GLY B 227 ? 0.1118 0.0946 0.0832 -0.0108 -0.0352 0.0138 227 GLY B N 3701 C CA . GLY B 227 ? 0.1286 0.1027 0.0800 -0.0208 -0.0360 0.0005 227 GLY B CA 3702 C C . GLY B 227 ? 0.1145 0.0858 0.0777 -0.0099 -0.0363 0.0150 227 GLY B C 3703 O O . GLY B 227 ? 0.1766 0.0894 0.0940 -0.0294 -0.0564 0.0150 227 GLY B O 3704 N N . GLU B 228 ? 0.1320 0.0889 0.0762 -0.0051 -0.0455 0.0061 228 GLU B N 3705 C CA . GLU B 228 ? 0.1129 0.0927 0.0727 -0.0156 -0.0262 0.0074 228 GLU B CA 3706 C C . GLU B 228 ? 0.1215 0.0909 0.0659 -0.0149 -0.0258 0.0068 228 GLU B C 3707 O O . GLU B 228 ? 0.1335 0.1034 0.0875 -0.0284 -0.0413 0.0165 228 GLU B O 3708 C CB . GLU B 228 ? 0.1152 0.1086 0.1073 -0.0163 -0.0255 -0.0095 228 GLU B CB 3709 C CG . GLU B 228 ? 0.1150 0.1141 0.1285 -0.0056 -0.0406 -0.0275 228 GLU B CG 3710 C CD . GLU B 228 ? 0.0879 0.1154 0.0831 -0.0142 -0.0273 0.0079 228 GLU B CD 3711 O OE1 . GLU B 228 ? 0.0810 0.0865 0.1013 -0.0120 -0.0282 0.0015 228 GLU B OE1 3712 O OE2 . GLU B 228 ? 0.0880 0.1365 0.0839 0.0125 -0.0249 0.0154 228 GLU B OE2 3713 N N . LYS B 229 ? 0.0915 0.0938 0.0766 -0.0129 -0.0281 0.0096 229 LYS B N 3714 C CA . LYS B 229 ? 0.1096 0.0803 0.0697 -0.0101 -0.0257 0.0139 229 LYS B CA 3715 C C . LYS B 229 ? 0.1037 0.0958 0.0737 -0.0066 -0.0251 0.0106 229 LYS B C 3716 O O . LYS B 229 ? 0.1104 0.0988 0.0750 -0.0038 -0.0131 0.0202 229 LYS B O 3717 C CB . LYS B 229 ? 0.0968 0.1149 0.0721 -0.0156 -0.0174 0.0166 229 LYS B CB 3718 C CG . LYS B 229 ? 0.0939 0.1157 0.0860 -0.0232 -0.0068 0.0074 229 LYS B CG 3719 C CD . LYS B 229 ? 0.1146 0.1294 0.0749 -0.0359 -0.0015 0.0067 229 LYS B CD 3720 C CE . LYS B 229 ? 0.1111 0.1255 0.1096 -0.0435 -0.0007 -0.0023 229 LYS B CE 3721 N NZ . LYS B 229 ? 0.1330 0.1228 0.0926 -0.0217 -0.0038 0.0218 229 LYS B NZ 3722 N N . THR B 230 ? 0.1091 0.0831 0.0833 -0.0099 -0.0101 0.0153 230 THR B N 3723 C CA . THR B 230 ? 0.1219 0.1059 0.0889 -0.0169 -0.0154 0.0014 230 THR B CA 3724 C C . THR B 230 ? 0.1202 0.1062 0.0867 -0.0302 -0.0135 0.0004 230 THR B C 3725 O O . THR B 230 ? 0.1208 0.1370 0.0988 -0.0320 -0.0106 -0.0092 230 THR B O 3726 C CB . THR B 230 ? 0.1129 0.1259 0.1103 0.0044 -0.0165 -0.0238 230 THR B CB 3727 O OG1 . THR B 230 ? 0.2246 0.1186 0.1409 -0.0019 -0.0143 0.0227 230 THR B OG1 3728 C CG2 . THR B 230 ? 0.1713 0.1733 0.1710 0.0319 -0.0806 -0.0448 230 THR B CG2 3729 N N . GLY B 231 ? 0.1282 0.1346 0.0910 -0.0219 -0.0076 -0.0148 231 GLY B N 3730 C CA . GLY B 231 ? 0.1329 0.1684 0.0913 -0.0330 -0.0051 -0.0179 231 GLY B CA 3731 C C . GLY B 231 ? 0.1506 0.1463 0.0865 -0.0519 0.0086 -0.0152 231 GLY B C 3732 O O . GLY B 231 ? 0.1675 0.1391 0.1242 -0.0596 0.0385 -0.0275 231 GLY B O 3733 N N . THR B 232 ? 0.1561 0.1633 0.1399 -0.0537 0.0032 -0.0502 232 THR B N 3734 C CA . THR B 232 ? 0.2128 0.1745 0.1143 -0.0523 0.0274 -0.0354 232 THR B CA 3735 C C . THR B 232 ? 0.2648 0.1811 0.1307 -0.0964 0.0185 -0.0469 232 THR B C 3736 O O . THR B 232 ? 0.3604 0.4232 0.1796 -0.2582 0.0723 -0.1053 232 THR B O 3737 C CB . THR B 232 ? 0.2563 0.1580 0.2083 -0.0323 0.0158 -0.0554 232 THR B CB 3738 O OG1 . THR B 232 ? 0.2533 0.1626 0.2508 -0.0228 -0.0313 -0.0107 232 THR B OG1 3739 C CG2 . THR B 232 ? 0.3439 0.2315 0.2623 0.0359 0.0855 -0.0216 232 THR B CG2 3740 N N . CYS B 233 ? 0.2116 0.2087 0.1290 -0.0787 -0.0038 -0.0362 233 CYS B N 3741 C CA . CYS B 233 ? 0.2041 0.2475 0.1476 -0.0662 -0.0173 -0.0551 233 CYS B CA 3742 C C . CYS B 233 ? 0.2208 0.2034 0.1543 -0.1015 0.0026 -0.0598 233 CYS B C 3743 O O . CYS B 233 ? 0.2080 0.2081 0.1625 -0.0543 -0.0098 -0.0524 233 CYS B O 3744 C CB . CYS B 233 ? 0.2350 0.2544 0.1959 -0.0452 -0.0437 -0.0647 233 CYS B CB 3745 S SG . CYS B 233 ? 0.1500 0.3171 0.1584 -0.0235 -0.0284 0.0258 233 CYS B SG 3746 N N . ALA B 234 ? 0.2274 0.1963 0.1224 -0.0659 -0.0213 -0.0238 234 ALA B N 3747 C CA . ALA B 234 ? 0.2409 0.2428 0.0823 -0.0645 -0.0320 -0.0083 234 ALA B CA 3748 C C . ALA B 234 ? 0.2207 0.1917 0.1012 -0.0344 -0.0229 -0.0254 234 ALA B C 3749 O O . ALA B 234 ? 0.2391 0.1978 0.1455 -0.0264 -0.0509 -0.0300 234 ALA B O 3750 C CB . ALA B 234 ? 0.2294 0.1945 0.1588 -0.0355 -0.0563 -0.0330 234 ALA B CB 3751 N N . ASN B 235 ? 0.2720 0.2388 0.0937 -0.0446 0.0014 -0.0269 235 ASN B N 3752 C CA . ASN B 235 ? 0.2770 0.2317 0.1004 -0.0453 0.0094 -0.0338 235 ASN B CA 3753 C C . ASN B 235 ? 0.2904 0.2246 0.0854 -0.0481 0.0117 -0.0269 235 ASN B C 3754 O O . ASN B 235 ? 0.2985 0.2126 0.1571 -0.0427 -0.0029 -0.0025 235 ASN B O 3755 C CB . ASN B 235 ? 0.3334 0.2605 0.0813 -0.0651 -0.0146 -0.0203 235 ASN B CB 3756 C CG . ASN B 235 ? 0.2907 0.3010 0.1084 -0.0436 0.0038 -0.0808 235 ASN B CG 3757 O OD1 . ASN B 235 ? 0.3489 0.3881 0.1906 0.0509 -0.0829 -0.1493 235 ASN B OD1 3758 N ND2 . ASN B 235 ? 0.3196 0.2938 0.1756 -0.0022 -0.0431 -0.0959 235 ASN B ND2 3759 N N . GLY B 236 ? 0.2018 0.1595 0.1448 -0.0249 -0.0150 -0.0294 236 GLY B N 3760 C CA . GLY B 236 ? 0.1985 0.2254 0.1259 -0.0605 0.0244 -0.0574 236 GLY B CA 3761 C C . GLY B 236 ? 0.1965 0.1572 0.1067 -0.0191 -0.0172 -0.0071 236 GLY B C 3762 O O . GLY B 236 ? 0.2253 0.1919 0.1459 -0.0607 0.0249 -0.0330 236 GLY B O 3763 N N . GLY B 237 ? 0.2008 0.1539 0.1111 -0.0305 -0.0170 -0.0354 237 GLY B N 3764 C CA . GLY B 237 ? 0.1994 0.1735 0.0961 -0.0472 0.0040 -0.0333 237 GLY B CA 3765 C C . GLY B 237 ? 0.2146 0.1407 0.1055 -0.0481 -0.0016 -0.0220 237 GLY B C 3766 O O . GLY B 237 ? 0.2815 0.1225 0.1202 -0.0309 0.0189 -0.0290 237 GLY B O 3767 N N . ARG B 238 ? 0.1703 0.1247 0.0946 -0.0272 -0.0012 -0.0094 238 ARG B N 3768 C CA . ARG B 238 ? 0.1055 0.1462 0.1019 -0.0350 0.0137 -0.0191 238 ARG B CA 3769 C C . ARG B 238 ? 0.1162 0.1369 0.0850 -0.0398 0.0085 -0.0068 238 ARG B C 3770 O O . ARG B 238 ? 0.1550 0.1426 0.1251 -0.0460 0.0390 -0.0154 238 ARG B O 3771 C CB . ARG B 238 ? 0.1251 0.1719 0.1207 -0.0161 0.0100 -0.0204 238 ARG B CB 3772 C CG . ARG B 238 ? 0.1368 0.1583 0.1283 -0.0118 0.0012 -0.0131 238 ARG B CG 3773 C CD . ARG B 238 ? 0.1987 0.2048 0.1998 -0.0718 -0.0535 0.0364 238 ARG B CD 3774 N NE . ARG B 238 ? 0.1695 0.2130 0.2043 -0.0259 -0.0059 0.0486 238 ARG B NE 3775 C CZ . ARG B 238 ? 0.1906 0.2233 0.1412 -0.0193 -0.0273 -0.0423 238 ARG B CZ 3776 N NH1 . ARG B 238 ? 0.2726 0.2400 0.1983 0.0867 0.0361 0.0287 238 ARG B NH1 3777 N NH2 . ARG B 238 ? 0.1820 0.2144 0.2086 -0.0105 0.0150 0.0410 238 ARG B NH2 3778 N N . ASN B 239 ? 0.1187 0.1107 0.0889 -0.0302 0.0060 -0.0010 239 ASN B N 3779 C CA . ASN B 239 ? 0.1191 0.1087 0.0893 -0.0226 -0.0049 0.0053 239 ASN B CA 3780 C C . ASN B 239 ? 0.0920 0.1099 0.0971 -0.0130 -0.0080 -0.0065 239 ASN B C 3781 O O . ASN B 239 ? 0.1346 0.1121 0.0872 -0.0173 -0.0217 0.0051 239 ASN B O 3782 C CB . ASN B 239 ? 0.1394 0.1398 0.1084 -0.0056 -0.0219 0.0169 239 ASN B CB 3783 C CG . ASN B 239 ? 0.1824 0.1794 0.1112 -0.0748 -0.0446 0.0242 239 ASN B CG 3784 O OD1 . ASN B 239 ? 0.1696 0.1441 0.0964 -0.0239 -0.0327 -0.0033 239 ASN B OD1 3785 N ND2 . ASN B 239 ? 0.2227 0.2610 0.1817 -0.1300 -0.0696 0.0213 239 ASN B ND2 3786 N N . ASP B 240 ? 0.1096 0.1047 0.0749 -0.0178 -0.0270 0.0075 240 ASP B N 3787 C CA . ASP B 240 ? 0.0988 0.1060 0.0742 -0.0257 -0.0177 0.0091 240 ASP B CA 3788 C C . ASP B 240 ? 0.1031 0.1102 0.0751 -0.0271 0.0004 0.0116 240 ASP B C 3789 O O . ASP B 240 ? 0.1245 0.1182 0.0831 -0.0296 0.0024 0.0162 240 ASP B O 3790 C CB . ASP B 240 ? 0.1214 0.1186 0.0829 -0.0132 -0.0354 0.0092 240 ASP B CB 3791 C CG . ASP B 240 ? 0.0612 0.0741 0.0999 -0.0166 -0.0300 0.0067 240 ASP B CG 3792 O OD1 . ASP B 240 ? 0.0700 0.1023 0.0887 -0.0117 -0.0227 0.0203 240 ASP B OD1 3793 O OD2 . ASP B 240 ? 0.0712 0.0982 0.1175 0.0002 -0.0296 0.0322 240 ASP B OD2 3794 N N . ILE B 241 ? 0.0921 0.0879 0.0817 -0.0203 -0.0114 0.0146 241 ILE B N 3795 C CA . ILE B 241 ? 0.0977 0.0864 0.0696 -0.0210 -0.0191 0.0165 241 ILE B CA 3796 C C . ILE B 241 ? 0.1081 0.0993 0.0709 -0.0230 -0.0177 0.0142 241 ILE B C 3797 O O . ILE B 241 ? 0.1365 0.0952 0.0725 -0.0271 -0.0265 0.0154 241 ILE B O 3798 C CB . ILE B 241 ? 0.1106 0.1008 0.0785 -0.0049 -0.0207 0.0201 241 ILE B CB 3799 C CG1 . ILE B 241 ? 0.1013 0.1427 0.0795 -0.0165 -0.0271 0.0204 241 ILE B CG1 3800 C CG2 . ILE B 241 ? 0.1263 0.1015 0.0701 -0.0270 -0.0340 0.0125 241 ILE B CG2 3801 C CD1 . ILE B 241 ? 0.1135 0.1063 0.1455 0.0032 -0.0380 0.0249 241 ILE B CD1 3802 N N . GLY B 242 ? 0.1167 0.0934 0.0762 -0.0164 -0.0303 0.0085 242 GLY B N 3803 C CA . GLY B 242 ? 0.1109 0.0969 0.0664 -0.0197 -0.0298 0.0223 242 GLY B CA 3804 C C . GLY B 242 ? 0.1151 0.0877 0.0683 -0.0031 -0.0145 0.0181 242 GLY B C 3805 O O . GLY B 242 ? 0.1248 0.0851 0.0845 -0.0105 -0.0318 0.0209 242 GLY B O 3806 N N . PHE B 243 ? 0.1593 0.0813 0.0772 -0.0171 -0.0391 0.0085 243 PHE B N 3807 C CA . PHE B 243 ? 0.1160 0.0850 0.0924 -0.0144 -0.0290 0.0109 243 PHE B CA 3808 C C . PHE B 243 ? 0.1124 0.0788 0.0785 -0.0062 -0.0286 0.0172 243 PHE B C 3809 O O . PHE B 243 ? 0.1531 0.0896 0.0887 -0.0083 -0.0475 0.0216 243 PHE B O 3810 C CB . PHE B 243 ? 0.1176 0.1003 0.0959 -0.0055 -0.0370 0.0010 243 PHE B CB 3811 C CG . PHE B 243 ? 0.1408 0.1029 0.0864 0.0003 -0.0149 0.0001 243 PHE B CG 3812 C CD1 . PHE B 243 ? 0.1199 0.1241 0.1047 -0.0150 -0.0179 0.0050 243 PHE B CD1 3813 C CD2 . PHE B 243 ? 0.1622 0.1053 0.0918 -0.0054 -0.0326 0.0028 243 PHE B CD2 3814 C CE1 . PHE B 243 ? 0.1998 0.1054 0.1378 -0.0077 -0.0209 0.0221 243 PHE B CE1 3815 C CE2 . PHE B 243 ? 0.2601 0.1599 0.1077 -0.0378 -0.0520 0.0366 243 PHE B CE2 3816 C CZ . PHE B 243 ? 0.2350 0.1359 0.1034 -0.0091 -0.0208 0.0292 243 PHE B CZ 3817 N N . PHE B 244 ? 0.1248 0.0910 0.0720 -0.0059 -0.0375 0.0100 244 PHE B N 3818 C CA . PHE B 244 ? 0.1300 0.0973 0.0960 -0.0257 -0.0426 0.0081 244 PHE B CA 3819 C C . PHE B 244 ? 0.1441 0.1095 0.0729 -0.0452 -0.0092 0.0056 244 PHE B C 3820 O O . PHE B 244 ? 0.1651 0.0949 0.0850 -0.0346 -0.0222 -0.0048 244 PHE B O 3821 C CB . PHE B 244 ? 0.1192 0.1169 0.1066 -0.0170 -0.0500 -0.0071 244 PHE B CB 3822 C CG . PHE B 244 ? 0.1457 0.1231 0.1152 -0.0159 -0.0269 0.0061 244 PHE B CG 3823 C CD1 . PHE B 244 ? 0.1462 0.1524 0.1118 -0.0279 -0.0269 0.0072 244 PHE B CD1 3824 C CD2 . PHE B 244 ? 0.1404 0.1427 0.1301 -0.0284 -0.0398 0.0078 244 PHE B CD2 3825 C CE1 . PHE B 244 ? 0.1657 0.1470 0.1135 -0.0295 -0.0290 0.0035 244 PHE B CE1 3826 C CE2 . PHE B 244 ? 0.1183 0.1787 0.1365 -0.0591 -0.0047 -0.0086 244 PHE B CE2 3827 C CZ . PHE B 244 ? 0.1135 0.1604 0.1249 -0.0275 0.0054 -0.0048 244 PHE B CZ 3828 N N . LYS B 245 ? 0.2075 0.1119 0.0960 -0.0321 -0.0442 -0.0028 245 LYS B N 3829 C CA . LYS B 245 ? 0.2086 0.1178 0.0988 -0.0261 -0.0363 -0.0210 245 LYS B CA 3830 C C . LYS B 245 ? 0.2127 0.1408 0.1195 -0.0346 -0.0775 0.0190 245 LYS B C 3831 O O . LYS B 245 ? 0.2619 0.1444 0.1577 -0.0310 -0.1041 0.0156 245 LYS B O 3832 C CB . LYS B 245 ? 0.2948 0.1245 0.1423 -0.0152 0.0248 -0.0358 245 LYS B CB 3833 C CG . LYS B 245 ? 0.2785 0.2201 0.2241 -0.0262 0.0852 -0.0758 245 LYS B CG 3834 C CD . LYS B 245 ? 0.3922 0.2913 0.2395 -0.1505 0.1211 -0.1137 245 LYS B CD 3835 C CE . LYS B 245 ? 0.3467 0.4528 0.3818 -0.1290 0.1697 -0.1249 245 LYS B CE 3836 N NZ . LYS B 245 ? 0.3854 0.7680 0.3088 -0.2169 0.1251 -0.1438 245 LYS B NZ 3837 N N . ALA B 246 ? 0.2425 0.1289 0.1299 -0.0484 -0.0916 0.0027 246 ALA B N 3838 C CA . ALA B 246 ? 0.2536 0.2104 0.1849 -0.0869 -0.1245 0.0474 246 ALA B CA 3839 C C . ALA B 246 ? 0.3178 0.2175 0.2548 -0.1230 -0.1762 0.0655 246 ALA B C 3840 O O . ALA B 246 ? 0.3367 0.2200 0.1645 -0.0504 -0.0786 0.0307 246 ALA B O 3841 C CB . ALA B 246 ? 0.1953 0.3187 0.2245 -0.0439 -0.0958 0.0632 246 ALA B CB 3842 N N . GLN B 247 ? 0.3084 0.2748 0.2389 -0.1303 -0.1434 0.0084 247 GLN B N 3843 C CA . GLN B 247 ? 0.3525 0.3316 0.3218 -0.2024 -0.0490 -0.0682 247 GLN B CA 3844 C C . GLN B 247 ? 0.4204 0.2688 0.1801 -0.1572 -0.0648 0.0033 247 GLN B C 3845 O O . GLN B 247 ? 0.4958 0.2939 0.1995 -0.1743 -0.0796 0.0468 247 GLN B O 3846 C CB . GLN B 247 ? 0.3624 0.3274 0.4495 -0.1810 0.0167 -0.0120 247 GLN B CB 3847 C CG . GLN B 247 ? 0.3426 0.4471 0.5690 -0.1612 0.0439 0.0522 247 GLN B CG 3848 C CD . GLN B 247 ? 0.4156 0.4238 0.5602 -0.1650 0.0955 0.0087 247 GLN B CD 3849 O OE1 . GLN B 247 ? 0.4251 0.5061 0.3770 -0.1397 0.1870 -0.1518 247 GLN B OE1 3850 N NE2 . GLN B 247 ? 0.4479 0.3494 0.4259 -0.2102 0.1687 -0.2170 247 GLN B NE2 3851 N N . GLU B 248 ? 0.3470 0.2630 0.1513 -0.1304 -0.1053 0.0178 248 GLU B N 3852 C CA . GLU B 248 ? 0.3822 0.2882 0.1598 -0.0974 -0.1024 -0.0186 248 GLU B CA 3853 C C . GLU B 248 ? 0.4146 0.2250 0.1670 -0.0522 -0.0945 -0.0271 248 GLU B C 3854 O O . GLU B 248 ? 0.3770 0.3494 0.2108 -0.0155 -0.0719 -0.1025 248 GLU B O 3855 C CB . GLU B 248 ? 0.5335 0.3496 0.1725 -0.1494 -0.1043 -0.0548 248 GLU B CB 3856 C CG . GLU B 248 ? 0.6687 0.4104 0.2566 -0.1542 -0.2393 -0.0897 248 GLU B CG 3857 C CD . GLU B 248 ? 0.6270 0.5507 0.3208 -0.1951 -0.3246 -0.0862 248 GLU B CD 3858 O OE1 . GLU B 248 ? 0.6785 0.6645 0.6857 -0.3521 -0.3489 0.0191 248 GLU B OE1 3859 O OE2 . GLU B 248 ? 0.5787 0.7970 0.6394 -0.1500 -0.5273 0.0525 248 GLU B OE2 3860 N N . ARG B 249 ? 0.2504 0.1656 0.1658 -0.0733 -0.0731 -0.0095 249 ARG B N 3861 C CA . ARG B 249 ? 0.2802 0.1516 0.1674 -0.0660 -0.0785 -0.0069 249 ARG B CA 3862 C C . ARG B 249 ? 0.2533 0.1340 0.1585 -0.0363 -0.0954 -0.0024 249 ARG B C 3863 O O . ARG B 249 ? 0.2285 0.1457 0.2043 -0.0282 -0.0917 -0.0121 249 ARG B O 3864 C CB . ARG B 249 ? 0.3301 0.1783 0.1595 -0.0989 -0.0716 -0.0210 249 ARG B CB 3865 C CG . ARG B 249 ? 0.4167 0.2158 0.2218 -0.1763 0.0370 -0.0551 249 ARG B CG 3866 C CD . ARG B 249 ? 0.6167 0.2249 0.2220 -0.1860 -0.0350 0.0005 249 ARG B CD 3867 N NE . ARG B 249 ? 0.7781 0.3327 0.3205 -0.1326 -0.1907 0.0645 249 ARG B NE 3868 C CZ . ARG B 249 ? 0.8892 0.3148 0.5451 -0.1352 -0.3117 0.1020 249 ARG B CZ 3869 N NH1 . ARG B 249 ? 0.7812 0.3374 0.9913 -0.1294 -0.3901 -0.0120 249 ARG B NH1 3870 N NH2 . ARG B 249 ? 0.7343 0.3917 0.4806 -0.3041 -0.2952 0.2478 249 ARG B NH2 3871 N N . ASP B 250 ? 0.2199 0.1474 0.1359 -0.0160 -0.0417 -0.0355 250 ASP B N 3872 C CA . ASP B 250 ? 0.1854 0.1510 0.1063 -0.0248 -0.0407 -0.0095 250 ASP B CA 3873 C C . ASP B 250 ? 0.1700 0.1195 0.1093 -0.0166 -0.0401 0.0021 250 ASP B C 3874 O O . ASP B 250 ? 0.1932 0.1163 0.1503 -0.0095 -0.0222 0.0126 250 ASP B O 3875 C CB . ASP B 250 ? 0.2049 0.2285 0.1451 -0.0256 -0.0040 -0.0036 250 ASP B CB 3876 C CG . ASP B 250 ? 0.3601 0.2724 0.1593 -0.0125 0.0485 0.0271 250 ASP B CG 3877 O OD1 . ASP B 250 ? 0.4838 0.2954 0.1300 0.0397 -0.0026 0.0284 250 ASP B OD1 3878 O OD2 . ASP B 250 ? 0.4420 0.5501 0.2029 0.0364 0.1076 -0.0682 250 ASP B OD2 3879 N N . TYR B 251 ? 0.1678 0.1117 0.0951 -0.0328 -0.0445 0.0129 251 TYR B N 3880 C CA . TYR B 251 ? 0.1640 0.0959 0.0938 -0.0472 -0.0140 0.0092 251 TYR B CA 3881 C C . TYR B 251 ? 0.1413 0.0800 0.1116 -0.0100 -0.0451 0.0205 251 TYR B C 3882 O O . TYR B 251 ? 0.2536 0.0998 0.1130 -0.0609 -0.0785 0.0372 251 TYR B O 3883 C CB . TYR B 251 ? 0.1626 0.1073 0.1055 -0.0330 -0.0312 -0.0005 251 TYR B CB 3884 C CG . TYR B 251 ? 0.1398 0.1026 0.1286 -0.0182 -0.0296 -0.0070 251 TYR B CG 3885 C CD1 . TYR B 251 ? 0.1487 0.1292 0.1350 -0.0378 -0.0411 0.0095 251 TYR B CD1 3886 C CD2 . TYR B 251 ? 0.1994 0.1424 0.1210 -0.0653 -0.0357 0.0107 251 TYR B CD2 3887 C CE1 . TYR B 251 ? 0.1940 0.1167 0.1772 -0.0356 -0.0676 -0.0079 251 TYR B CE1 3888 C CE2 . TYR B 251 ? 0.2196 0.1718 0.1571 -0.0921 -0.0443 0.0145 251 TYR B CE2 3889 C CZ . TYR B 251 ? 0.2018 0.1256 0.1719 -0.0566 -0.0498 -0.0099 251 TYR B CZ 3890 O OH . TYR B 251 ? 0.2552 0.1873 0.1744 -0.1138 -0.0470 -0.0253 251 TYR B OH 3891 N N . ALA B 252 ? 0.1397 0.0793 0.0872 -0.0032 -0.0226 0.0139 252 ALA B N 3892 C CA . ALA B 252 ? 0.1253 0.0864 0.0908 -0.0109 -0.0146 0.0166 252 ALA B CA 3893 C C . ALA B 252 ? 0.1284 0.0803 0.0898 -0.0154 -0.0111 0.0147 252 ALA B C 3894 O O . ALA B 252 ? 0.1463 0.0859 0.1148 -0.0245 0.0003 0.0252 252 ALA B O 3895 C CB . ALA B 252 ? 0.1185 0.1182 0.1378 -0.0075 -0.0138 0.0279 252 ALA B CB 3896 N N . VAL B 253 ? 0.1259 0.0803 0.0796 -0.0206 -0.0249 0.0068 253 VAL B N 3897 C CA . VAL B 253 ? 0.1210 0.0889 0.0953 -0.0160 -0.0199 0.0003 253 VAL B CA 3898 C C . VAL B 253 ? 0.1255 0.0973 0.0666 -0.0289 -0.0155 0.0127 253 VAL B C 3899 O O . VAL B 253 ? 0.1366 0.1070 0.0694 -0.0389 -0.0155 0.0188 253 VAL B O 3900 C CB . VAL B 253 ? 0.1147 0.1077 0.1197 -0.0157 -0.0283 -0.0089 253 VAL B CB 3901 C CG1 . VAL B 253 ? 0.1227 0.1140 0.1377 0.0042 -0.0401 0.0007 253 VAL B CG1 3902 C CG2 . VAL B 253 ? 0.1165 0.2077 0.1332 -0.0021 -0.0190 -0.0132 253 VAL B CG2 3903 N N . ALA B 254 ? 0.1149 0.0913 0.0732 -0.0129 -0.0026 0.0141 254 ALA B N 3904 C CA . ALA B 254 ? 0.1221 0.0957 0.0737 -0.0187 -0.0206 0.0105 254 ALA B CA 3905 C C . ALA B 254 ? 0.1341 0.1116 0.0563 -0.0163 -0.0146 0.0113 254 ALA B C 3906 O O . ALA B 254 ? 0.1739 0.1172 0.0834 -0.0139 0.0166 0.0190 254 ALA B O 3907 C CB . ALA B 254 ? 0.1395 0.1289 0.1108 -0.0032 -0.0408 0.0397 254 ALA B CB 3908 N N . VAL B 255 ? 0.0960 0.1084 0.0833 -0.0223 -0.0061 0.0199 255 VAL B N 3909 C CA . VAL B 255 ? 0.1056 0.1019 0.0925 -0.0183 -0.0073 0.0170 255 VAL B CA 3910 C C . VAL B 255 ? 0.1217 0.1181 0.0802 -0.0326 -0.0065 0.0153 255 VAL B C 3911 O O . VAL B 255 ? 0.1584 0.1135 0.0713 -0.0350 0.0043 0.0094 255 VAL B O 3912 C CB . VAL B 255 ? 0.0923 0.1474 0.0842 -0.0326 -0.0058 0.0159 255 VAL B CB 3913 C CG1 . VAL B 255 ? 0.1159 0.1471 0.1167 -0.0056 -0.0066 0.0006 255 VAL B CG1 3914 C CG2 . VAL B 255 ? 0.1193 0.1334 0.1120 -0.0213 -0.0321 0.0060 255 VAL B CG2 3915 N N . TYR B 256 ? 0.1332 0.1226 0.0772 -0.0319 -0.0127 0.0106 256 TYR B N 3916 C CA . TYR B 256 ? 0.1215 0.1145 0.0814 -0.0420 0.0060 0.0183 256 TYR B CA 3917 C C . TYR B 256 ? 0.1552 0.1407 0.0845 -0.0549 0.0300 0.0003 256 TYR B C 3918 O O . TYR B 256 ? 0.1406 0.1457 0.1187 -0.0432 0.0274 0.0108 256 TYR B O 3919 C CB . TYR B 256 ? 0.1423 0.1697 0.0964 -0.0495 -0.0281 0.0210 256 TYR B CB 3920 C CG . TYR B 256 ? 0.1052 0.1313 0.0946 -0.0400 -0.0501 0.0259 256 TYR B CG 3921 C CD1 . TYR B 256 ? 0.1541 0.1380 0.0834 -0.0500 -0.0113 0.0079 256 TYR B CD1 3922 C CD2 . TYR B 256 ? 0.1354 0.1367 0.1059 -0.0469 -0.0377 0.0230 256 TYR B CD2 3923 C CE1 . TYR B 256 ? 0.1112 0.1317 0.0918 -0.0535 -0.0298 -0.0037 256 TYR B CE1 3924 C CE2 . TYR B 256 ? 0.1334 0.1260 0.1221 -0.0427 -0.0354 0.0010 256 TYR B CE2 3925 C CZ . TYR B 256 ? 0.1176 0.1268 0.0844 -0.0287 -0.0313 0.0200 256 TYR B CZ 3926 O OH . TYR B 256 ? 0.1149 0.1290 0.0864 -0.0235 -0.0319 0.0081 256 TYR B OH 3927 N N . THR B 257 ? 0.1556 0.1374 0.0852 -0.0501 0.0298 -0.0016 257 THR B N 3928 C CA . THR B 257 ? 0.1544 0.1456 0.1097 -0.0564 0.0347 -0.0134 257 THR B CA 3929 C C . THR B 257 ? 0.1786 0.1359 0.1236 -0.0461 0.0372 -0.0248 257 THR B C 3930 O O . THR B 257 ? 0.1771 0.1621 0.1292 -0.0681 0.0281 -0.0386 257 THR B O 3931 C CB . THR B 257 ? 0.1544 0.1577 0.1278 -0.0359 0.0429 -0.0237 257 THR B CB 3932 O OG1 . THR B 257 ? 0.1766 0.1521 0.1315 -0.0293 0.0197 -0.0317 257 THR B OG1 3933 C CG2 . THR B 257 ? 0.1509 0.1640 0.1516 -0.0275 0.0067 -0.0258 257 THR B CG2 3934 N N . THR B 258 ? 0.1778 0.1736 0.1031 -0.0451 0.0190 -0.0192 258 THR B N 3935 C CA . THR B 258 ? 0.1683 0.1867 0.1218 -0.0550 0.0132 -0.0434 258 THR B CA 3936 C C . THR B 258 ? 0.1720 0.1829 0.1486 -0.0619 0.0265 -0.0528 258 THR B C 3937 O O . THR B 258 ? 0.1795 0.2079 0.1502 -0.0631 0.0274 -0.0367 258 THR B O 3938 C CB . THR B 258 ? 0.2256 0.2341 0.1649 -0.0259 -0.0418 -0.0597 258 THR B CB 3939 O OG1 . THR B 258 ? 0.2329 0.2847 0.2002 0.0083 -0.0452 -0.0523 258 THR B OG1 3940 C CG2 . THR B 258 ? 0.3549 0.2337 0.1518 -0.0538 -0.0709 -0.0425 258 THR B CG2 3941 N N . ALA B 259 ? 0.2018 0.1899 0.1554 -0.0493 0.0474 -0.0486 259 ALA B N 3942 C CA . ALA B 259 ? 0.1923 0.1997 0.1761 -0.0432 0.0374 -0.0286 259 ALA B CA 3943 C C . ALA B 259 ? 0.1927 0.2056 0.1605 -0.0130 0.0170 -0.0398 259 ALA B C 3944 O O . ALA B 259 ? 0.2428 0.1952 0.1656 -0.0121 0.0435 -0.0325 259 ALA B O 3945 C CB . ALA B 259 ? 0.2134 0.2463 0.1967 -0.0571 0.0174 -0.0514 259 ALA B CB 3946 N N . PRO B 260 ? 0.1908 0.2437 0.1646 -0.0038 0.0071 -0.0462 260 PRO B N 3947 C CA . PRO B 260 ? 0.2011 0.2593 0.1710 -0.0189 -0.0083 -0.0488 260 PRO B CA 3948 C C . PRO B 260 ? 0.2266 0.2480 0.1429 -0.0019 0.0033 -0.0413 260 PRO B C 3949 O O . PRO B 260 ? 0.3069 0.2515 0.2871 -0.0157 0.0917 -0.0730 260 PRO B O 3950 C CB . PRO B 260 ? 0.3089 0.2948 0.2073 0.0320 -0.0767 -0.0676 260 PRO B CB 3951 C CG . PRO B 260 ? 0.3871 0.3022 0.2413 0.0576 -0.0958 -0.0455 260 PRO B CG 3952 C CD . PRO B 260 ? 0.3421 0.2649 0.1657 -0.0122 0.0020 -0.0231 260 PRO B CD 3953 N N . LYS B 261 ? 0.2213 0.2841 0.2085 0.0060 0.0532 -0.0270 261 LYS B N 3954 C CA . LYS B 261 ? 0.2618 0.4043 0.2084 0.0803 0.0641 -0.0319 261 LYS B CA 3955 C C . LYS B 261 ? 0.2861 0.3391 0.2225 0.0815 0.0469 -0.0449 261 LYS B C 3956 O O . LYS B 261 ? 0.3626 0.5303 0.2429 0.2184 0.0190 -0.0920 261 LYS B O 3957 C CB . LYS B 261 ? 0.3091 0.5644 0.2834 0.1247 0.1303 0.0506 261 LYS B CB 3958 C CG . LYS B 261 ? 0.5391 0.6912 0.2261 0.0505 0.1213 0.0269 261 LYS B CG 3959 C CD . LYS B 261 ? 0.6475 0.7810 0.3195 -0.0403 0.1853 0.0935 261 LYS B CD 3960 C CE . LYS B 261 ? 0.6666 0.8396 0.4979 -0.0759 0.2127 0.0174 261 LYS B CE 3961 N NZ . LYS B 261 ? 0.5543 0.7041 0.7895 0.0810 0.3794 0.1008 261 LYS B NZ 3962 N N . LEU B 262 ? 0.2743 0.2280 0.2172 0.0537 0.0300 -0.0270 262 LEU B N 3963 C CA . LEU B 262 ? 0.2658 0.1914 0.2289 0.0394 0.0207 -0.0314 262 LEU B CA 3964 C C . LEU B 262 ? 0.2713 0.1983 0.2120 0.0118 0.0062 -0.0402 262 LEU B C 3965 O O . LEU B 262 ? 0.2657 0.2500 0.2457 0.0133 0.0039 -0.0114 262 LEU B O 3966 C CB . LEU B 262 ? 0.2428 0.1818 0.2325 0.0302 0.0182 -0.0287 262 LEU B CB 3967 C CG . LEU B 262 ? 0.2433 0.2409 0.2336 -0.0215 0.0302 -0.0584 262 LEU B CG 3968 C CD1 . LEU B 262 ? 0.1933 0.2632 0.2074 -0.0530 0.0350 -0.0524 262 LEU B CD1 3969 C CD2 . LEU B 262 ? 0.2619 0.3167 0.2787 -0.0080 0.0699 -0.0680 262 LEU B CD2 3970 N N . SER B 263 ? 0.2618 0.1966 0.2218 0.0027 0.0048 -0.0343 263 SER B N 3971 C CA . SER B 263 ? 0.2836 0.2059 0.1915 -0.0088 -0.0039 -0.0445 263 SER B CA 3972 C C . SER B 263 ? 0.2343 0.2192 0.2131 -0.0641 -0.0069 -0.0895 263 SER B C 3973 O O . SER B 263 ? 0.2445 0.1980 0.1825 -0.0243 -0.0244 -0.0555 263 SER B O 3974 C CB . SER B 263 ? 0.3375 0.1758 0.2543 0.0049 -0.0275 -0.0434 263 SER B CB 3975 O OG . SER B 263 ? 0.2508 0.2624 0.2887 0.0593 -0.0327 -0.0944 263 SER B OG 3976 N N . ALA B 264 ? 0.1758 0.2169 0.2844 -0.0454 0.0066 -0.0844 264 ALA B N 3977 C CA . ALA B 264 ? 0.1761 0.1935 0.2595 -0.0112 -0.0035 -0.0465 264 ALA B CA 3978 C C . ALA B 264 ? 0.1213 0.2108 0.2674 -0.0224 0.0247 -0.0622 264 ALA B C 3979 O O . ALA B 264 ? 0.1662 0.1739 0.2061 0.0035 0.0012 -0.0164 264 ALA B O 3980 C CB . ALA B 264 ? 0.2861 0.3020 0.2611 -0.1407 0.0139 -0.0772 264 ALA B CB 3981 N N . VAL B 265 ? 0.1717 0.1727 0.3371 -0.0070 -0.0225 -0.0634 265 VAL B N 3982 C CA . VAL B 265 ? 0.1974 0.1651 0.2578 0.0023 -0.0211 -0.0111 265 VAL B CA 3983 C C . VAL B 265 ? 0.1497 0.1796 0.2309 -0.0151 0.0073 -0.0501 265 VAL B C 3984 O O . VAL B 265 ? 0.1664 0.1951 0.2325 -0.0178 -0.0174 -0.0456 265 VAL B O 3985 C CB . VAL B 265 ? 0.2165 0.1971 0.3411 0.0436 -0.0290 -0.0463 265 VAL B CB 3986 C CG1 . VAL B 265 ? 0.4979 0.5980 0.5104 0.2586 0.0968 -0.1544 265 VAL B CG1 3987 C CG2 . VAL B 265 ? 0.3963 0.1875 0.5421 0.0829 -0.2461 -0.0364 265 VAL B CG2 3988 N N . GLU B 266 ? 0.1460 0.1875 0.2255 0.0076 -0.0149 -0.0328 266 GLU B N 3989 C CA . GLU B 266 ? 0.1630 0.1953 0.2016 0.0126 -0.0218 -0.0222 266 GLU B CA 3990 C C . GLU B 266 ? 0.1360 0.1781 0.2226 -0.0088 0.0142 -0.0368 266 GLU B C 3991 O O . GLU B 266 ? 0.1257 0.1869 0.1903 -0.0250 -0.0055 -0.0271 266 GLU B O 3992 C CB . GLU B 266 ? 0.1764 0.2102 0.2157 0.0196 -0.0034 -0.0525 266 GLU B CB 3993 C CG . GLU B 266 ? 0.2177 0.1903 0.3158 0.0383 0.0525 -0.0005 266 GLU B CG 3994 C CD . GLU B 266 ? 0.1960 0.2918 0.3386 0.0517 0.0498 -0.0566 266 GLU B CD 3995 O OE1 . GLU B 266 ? 0.2567 0.6947 0.3752 0.2058 0.0471 -0.0641 266 GLU B OE1 3996 O OE2 . GLU B 266 ? 0.2167 0.3378 0.3432 0.0355 0.0349 -0.0617 266 GLU B OE2 3997 N N . ARG B 267 ? 0.1471 0.1484 0.1731 -0.0144 -0.0040 -0.0348 267 ARG B N 3998 C CA . ARG B 267 ? 0.1426 0.2106 0.1466 0.0113 -0.0077 -0.0262 267 ARG B CA 3999 C C . ARG B 267 ? 0.1195 0.1655 0.1451 -0.0050 0.0082 -0.0099 267 ARG B C 4000 O O . ARG B 267 ? 0.1261 0.1598 0.1618 -0.0193 -0.0026 -0.0110 267 ARG B O 4001 C CB . ARG B 267 ? 0.1555 0.1598 0.1551 -0.0064 -0.0040 -0.0206 267 ARG B CB 4002 C CG . ARG B 267 ? 0.1746 0.1999 0.1694 0.0018 -0.0136 -0.0519 267 ARG B CG 4003 C CD . ARG B 267 ? 0.2008 0.2663 0.1574 -0.0701 0.0007 -0.0333 267 ARG B CD 4004 N NE . ARG B 267 ? 0.1766 0.2565 0.1416 -0.0137 -0.0200 -0.0146 267 ARG B NE 4005 C CZ . ARG B 267 ? 0.2385 0.2623 0.1845 -0.0117 0.0235 -0.0541 267 ARG B CZ 4006 N NH1 . ARG B 267 ? 0.2696 0.2472 0.1763 -0.0370 -0.0340 -0.0473 267 ARG B NH1 4007 N NH2 . ARG B 267 ? 0.2751 0.2724 0.1769 -0.0233 -0.0148 -0.0441 267 ARG B NH2 4008 N N . ASP B 268 ? 0.1540 0.1687 0.1531 -0.0019 -0.0078 -0.0103 268 ASP B N 4009 C CA . ASP B 268 ? 0.1294 0.1933 0.1468 0.0003 -0.0250 0.0028 268 ASP B CA 4010 C C . ASP B 268 ? 0.1380 0.1679 0.1584 -0.0028 -0.0242 0.0089 268 ASP B C 4011 O O . ASP B 268 ? 0.1515 0.1834 0.1662 -0.0153 -0.0160 -0.0056 268 ASP B O 4012 C CB . ASP B 268 ? 0.2257 0.1836 0.1567 -0.0322 -0.0141 0.0041 268 ASP B CB 4013 C CG . ASP B 268 ? 0.2231 0.1956 0.2918 -0.0362 -0.0810 0.0526 268 ASP B CG 4014 O OD1 . ASP B 268 ? 0.3805 0.1919 0.3407 -0.0786 -0.0737 0.0745 268 ASP B OD1 4015 O OD2 . ASP B 268 ? 0.1775 0.5199 0.2505 0.0166 -0.0158 0.1124 268 ASP B OD2 4016 N N . GLU B 269 ? 0.1325 0.1768 0.1953 -0.0187 -0.0301 -0.0272 269 GLU B N 4017 C CA . GLU B 269 ? 0.1356 0.1847 0.1623 -0.0205 -0.0060 -0.0046 269 GLU B CA 4018 C C . GLU B 269 ? 0.1294 0.1915 0.1472 -0.0214 -0.0048 -0.0041 269 GLU B C 4019 O O . GLU B 269 ? 0.1281 0.1850 0.2150 -0.0177 -0.0180 -0.0182 269 GLU B O 4020 C CB . GLU B 269 ? 0.1331 0.2503 0.1588 0.0131 -0.0282 -0.0185 269 GLU B CB 4021 C CG . GLU B 269 ? 0.1653 0.2496 0.2751 0.0292 -0.0562 -0.0081 269 GLU B CG 4022 C CD . GLU B 269 ? 0.1723 0.3857 0.4092 0.1121 -0.0146 0.0061 269 GLU B CD 4023 O OE1 . GLU B 269 ? 0.3494 0.5727 0.4495 0.2323 0.0997 0.0676 269 GLU B OE1 4024 O OE2 . GLU B 269 ? 0.1640 0.3407 0.5231 0.0828 -0.0340 -0.0130 269 GLU B OE2 4025 N N . LEU B 270 ? 0.1508 0.1702 0.1367 0.0022 0.0050 -0.0219 270 LEU B N 4026 C CA . LEU B 270 ? 0.1238 0.1912 0.1615 0.0210 0.0153 -0.0001 270 LEU B CA 4027 C C . LEU B 270 ? 0.1311 0.1602 0.1539 -0.0030 0.0236 0.0116 270 LEU B C 4028 O O . LEU B 270 ? 0.1177 0.1710 0.1387 -0.0240 0.0035 0.0004 270 LEU B O 4029 C CB . LEU B 270 ? 0.1336 0.1877 0.1765 0.0300 -0.0054 -0.0142 270 LEU B CB 4030 C CG . LEU B 270 ? 0.1662 0.1745 0.1486 -0.0201 -0.0227 -0.0211 270 LEU B CG 4031 C CD1 . LEU B 270 ? 0.1770 0.2726 0.2784 -0.0304 0.0548 0.0179 270 LEU B CD1 4032 C CD2 . LEU B 270 ? 0.3158 0.2193 0.1215 -0.0052 -0.0486 -0.0207 270 LEU B CD2 4033 N N . VAL B 271 ? 0.1078 0.1412 0.1343 -0.0028 -0.0057 -0.0109 271 VAL B N 4034 C CA . VAL B 271 ? 0.1304 0.1523 0.1134 -0.0332 0.0150 -0.0201 271 VAL B CA 4035 C C . VAL B 271 ? 0.1012 0.1312 0.1530 -0.0239 -0.0107 -0.0168 271 VAL B C 4036 O O . VAL B 271 ? 0.1034 0.1287 0.1395 -0.0350 0.0004 -0.0099 271 VAL B O 4037 C CB . VAL B 271 ? 0.1082 0.2016 0.1375 -0.0390 -0.0034 -0.0333 271 VAL B CB 4038 C CG1 . VAL B 271 ? 0.1134 0.1540 0.1370 -0.0257 -0.0023 -0.0075 271 VAL B CG1 4039 C CG2 . VAL B 271 ? 0.1436 0.2152 0.1340 -0.0380 -0.0100 -0.0381 271 VAL B CG2 4040 N N . ALA B 272 ? 0.1060 0.1350 0.1389 -0.0234 0.0025 -0.0223 272 ALA B N 4041 C CA . ALA B 272 ? 0.1242 0.1594 0.1231 -0.0304 -0.0106 0.0046 272 ALA B CA 4042 C C . ALA B 272 ? 0.1042 0.1575 0.1380 -0.0255 -0.0162 0.0042 272 ALA B C 4043 O O . ALA B 272 ? 0.1363 0.1508 0.1354 -0.0239 -0.0309 0.0066 272 ALA B O 4044 C CB . ALA B 272 ? 0.1051 0.1540 0.2151 -0.0320 -0.0137 0.0197 272 ALA B CB 4045 N N . SER B 273 ? 0.1058 0.1755 0.1445 -0.0247 -0.0045 -0.0043 273 SER B N 4046 C CA . SER B 273 ? 0.1302 0.1782 0.1532 -0.0252 0.0001 0.0160 273 SER B CA 4047 C C . SER B 273 ? 0.1036 0.1764 0.1298 -0.0349 0.0005 -0.0014 273 SER B C 4048 O O . SER B 273 ? 0.1117 0.1743 0.1452 -0.0366 -0.0101 -0.0114 273 SER B O 4049 C CB . SER B 273 ? 0.1195 0.1938 0.1648 -0.0091 0.0071 0.0021 273 SER B CB 4050 O OG . SER B 273 ? 0.1454 0.1621 0.2754 -0.0088 0.0233 0.0142 273 SER B OG 4051 N N . VAL B 274 ? 0.1164 0.1535 0.1524 -0.0473 -0.0121 0.0060 274 VAL B N 4052 C CA . VAL B 274 ? 0.1229 0.1625 0.1443 -0.0345 -0.0062 0.0069 274 VAL B CA 4053 C C . VAL B 274 ? 0.1181 0.1520 0.1411 -0.0537 0.0046 0.0113 274 VAL B C 4054 O O . VAL B 274 ? 0.0980 0.1447 0.1362 -0.0241 -0.0189 0.0259 274 VAL B O 4055 C CB . VAL B 274 ? 0.1284 0.1584 0.1302 -0.0365 -0.0071 0.0187 274 VAL B CB 4056 C CG1 . VAL B 274 ? 0.1218 0.1724 0.1322 -0.0291 -0.0043 -0.0084 274 VAL B CG1 4057 C CG2 . VAL B 274 ? 0.1358 0.1915 0.1391 -0.0077 -0.0214 -0.0072 274 VAL B CG2 4058 N N . GLY B 275 ? 0.1162 0.1424 0.1431 -0.0352 -0.0125 0.0165 275 GLY B N 4059 C CA . GLY B 275 ? 0.1031 0.1280 0.1403 -0.0030 -0.0366 0.0153 275 GLY B CA 4060 C C . GLY B 275 ? 0.1125 0.1281 0.1245 -0.0204 -0.0049 0.0244 275 GLY B C 4061 O O . GLY B 275 ? 0.1220 0.1294 0.1365 -0.0299 -0.0122 0.0133 275 GLY B O 4062 N N . GLN B 276 ? 0.1052 0.1629 0.1349 -0.0221 0.0016 0.0130 276 GLN B N 4063 C CA . GLN B 276 ? 0.1207 0.1584 0.1315 -0.0276 -0.0224 -0.0045 276 GLN B CA 4064 C C . GLN B 276 ? 0.0829 0.1726 0.1341 -0.0273 -0.0141 0.0037 276 GLN B C 4065 O O . GLN B 276 ? 0.1752 0.1711 0.1362 -0.0528 -0.0161 0.0005 276 GLN B O 4066 C CB . GLN B 276 ? 0.1056 0.1998 0.3064 -0.0024 0.0000 0.0216 276 GLN B CB 4067 C CG . GLN B 276 ? 0.1407 0.3487 0.3137 -0.0026 -0.0545 0.0064 276 GLN B CG 4068 C CD . GLN B 276 ? 0.1610 0.3540 0.3000 -0.0237 -0.0079 0.0208 276 GLN B CD 4069 O OE1 . GLN B 276 ? 0.3321 0.6934 0.4002 -0.1938 -0.1156 0.2754 276 GLN B OE1 4070 N NE2 . GLN B 276 ? 0.2704 0.5318 0.3209 -0.1243 -0.0869 0.0085 276 GLN B NE2 4071 N N . VAL B 277 ? 0.1189 0.1950 0.1261 -0.0717 -0.0004 0.0121 277 VAL B N 4072 C CA . VAL B 277 ? 0.1049 0.2094 0.1243 -0.0592 -0.0101 0.0243 277 VAL B CA 4073 C C . VAL B 277 ? 0.1051 0.1943 0.1253 -0.0674 -0.0154 0.0284 277 VAL B C 4074 O O . VAL B 277 ? 0.1174 0.1961 0.1330 -0.0635 -0.0340 0.0287 277 VAL B O 4075 C CB . VAL B 277 ? 0.1319 0.2230 0.1319 -0.0845 -0.0061 0.0190 277 VAL B CB 4076 C CG1 . VAL B 277 ? 0.2721 0.2270 0.1117 -0.1108 -0.0650 0.0222 277 VAL B CG1 4077 C CG2 . VAL B 277 ? 0.1565 0.3000 0.1417 -0.0807 0.0133 -0.0259 277 VAL B CG2 4078 N N . ILE B 278 ? 0.0997 0.1641 0.1210 -0.0391 -0.0268 0.0400 278 ILE B N 4079 C CA . ILE B 278 ? 0.1202 0.1539 0.1363 -0.0289 -0.0170 0.0285 278 ILE B CA 4080 C C . ILE B 278 ? 0.1141 0.1367 0.1447 -0.0529 -0.0103 0.0331 278 ILE B C 4081 O O . ILE B 278 ? 0.1370 0.1391 0.1625 -0.0380 -0.0217 0.0238 278 ILE B O 4082 C CB . ILE B 278 ? 0.1193 0.1346 0.1399 -0.0278 -0.0164 0.0196 278 ILE B CB 4083 C CG1 . ILE B 278 ? 0.1189 0.1390 0.1542 -0.0168 -0.0345 0.0461 278 ILE B CG1 4084 C CG2 . ILE B 278 ? 0.1178 0.1515 0.1699 0.0043 -0.0078 0.0309 278 ILE B CG2 4085 C CD1 . ILE B 278 ? 0.1031 0.1554 0.1306 -0.0162 -0.0165 0.0178 278 ILE B CD1 4086 N N . THR B 279 ? 0.1494 0.1380 0.1344 -0.0408 -0.0309 0.0110 279 THR B N 4087 C CA . THR B 279 ? 0.1232 0.1376 0.1308 -0.0382 -0.0113 0.0059 279 THR B CA 4088 C C . THR B 279 ? 0.1531 0.1423 0.1337 -0.0575 -0.0212 0.0180 279 THR B C 4089 O O . THR B 279 ? 0.1874 0.1615 0.1387 -0.0713 -0.0399 0.0047 279 THR B O 4090 C CB . THR B 279 ? 0.1495 0.1470 0.1269 -0.0454 -0.0229 0.0343 279 THR B CB 4091 O OG1 . THR B 279 ? 0.1275 0.1929 0.1155 -0.0667 -0.0239 0.0366 279 THR B OG1 4092 C CG2 . THR B 279 ? 0.1514 0.1783 0.1361 -0.0615 -0.0332 0.0238 279 THR B CG2 4093 N N . GLN B 280 ? 0.1205 0.1573 0.1703 -0.0512 -0.0089 0.0149 280 GLN B N 4094 C CA . GLN B 280 ? 0.1414 0.1913 0.1742 -0.0703 -0.0158 0.0216 280 GLN B CA 4095 C C . GLN B 280 ? 0.1890 0.1747 0.1584 -0.0897 -0.0321 0.0419 280 GLN B C 4096 O O . GLN B 280 ? 0.2032 0.1898 0.2080 -0.0907 -0.0510 0.0184 280 GLN B O 4097 C CB . GLN B 280 ? 0.1505 0.2268 0.1904 -0.0934 0.0096 0.0283 280 GLN B CB 4098 C CG A GLN B 280 ? 0.1150 0.3052 0.2259 -0.0434 0.0261 0.0149 280 GLN B CG 4099 C CG B GLN B 280 ? 0.1219 0.3138 0.2476 -0.1154 -0.0148 0.0476 280 GLN B CG 4100 C CD A GLN B 280 ? 0.1957 0.3505 0.4534 -0.0451 -0.1144 -0.0129 280 GLN B CD 4101 C CD B GLN B 280 ? 0.1349 0.4109 0.2049 -0.1112 -0.0087 0.0476 280 GLN B CD 4102 O OE1 A GLN B 280 ? 0.4140 0.5453 0.4139 -0.1402 -0.2409 0.0145 280 GLN B OE1 4103 O OE1 B GLN B 280 ? 0.4299 0.4322 0.4405 -0.1523 0.0845 -0.1749 280 GLN B OE1 4104 N NE2 A GLN B 280 ? 0.3476 0.5660 0.6965 -0.2636 -0.1357 0.0375 280 GLN B NE2 4105 N NE2 B GLN B 280 ? 0.1600 0.6978 0.1371 -0.2108 -0.0714 0.1375 280 GLN B NE2 4106 N N . LEU B 281 ? 0.1768 0.1629 0.1459 -0.0759 -0.0224 0.0270 281 LEU B N 4107 C CA . LEU B 281 ? 0.1897 0.1628 0.1644 -0.0879 -0.0131 0.0391 281 LEU B CA 4108 C C . LEU B 281 ? 0.1753 0.1758 0.1823 -0.0840 -0.0102 0.0109 281 LEU B C 4109 O O . LEU B 281 ? 0.2778 0.1753 0.2119 -0.1111 0.0258 0.0112 281 LEU B O 4110 C CB . LEU B 281 ? 0.1831 0.2251 0.1758 -0.0341 -0.0257 0.0066 281 LEU B CB 4111 C CG . LEU B 281 ? 0.2232 0.3477 0.2677 0.0497 0.0258 0.0957 281 LEU B CG 4112 C CD1 . LEU B 281 ? 0.1965 0.3411 0.2692 0.0102 0.0123 0.0593 281 LEU B CD1 4113 C CD2 . LEU B 281 ? 0.3675 0.3640 0.6687 0.0701 0.2004 0.3204 281 LEU B CD2 4114 N N . ILE B 282 ? 0.1613 0.1374 0.1727 -0.0581 -0.0064 0.0058 282 ILE B N 4115 C CA . ILE B 282 ? 0.1965 0.1723 0.1640 -0.0505 -0.0054 0.0238 282 ILE B CA 4116 C C . ILE B 282 ? 0.2398 0.1556 0.1678 -0.0495 -0.0112 -0.0057 282 ILE B C 4117 O O . ILE B 282 ? 0.3310 0.1694 0.2297 -0.0548 0.0064 -0.0369 282 ILE B O 4118 C CB . ILE B 282 ? 0.2155 0.1890 0.1480 -0.0592 0.0006 0.0192 282 ILE B CB 4119 C CG1 . ILE B 282 ? 0.1879 0.1803 0.1962 -0.0476 -0.0010 0.0088 282 ILE B CG1 4120 C CG2 . ILE B 282 ? 0.2166 0.2386 0.1825 -0.0690 0.0318 -0.0025 282 ILE B CG2 4121 C CD1 . ILE B 282 ? 0.2082 0.1663 0.2258 -0.0441 -0.0153 -0.0204 282 ILE B CD1 4122 N N . LEU B 283 ? 0.2152 0.1831 0.1218 -0.0664 -0.0247 -0.0062 283 LEU B N 4123 C CA . LEU B 283 ? 0.2571 0.2771 0.1802 -0.1164 -0.0602 -0.0026 283 LEU B CA 4124 C C . LEU B 283 ? 0.3326 0.3219 0.2730 -0.1849 -0.0947 0.0386 283 LEU B C 4125 O O . LEU B 283 ? 0.4447 0.4045 0.3303 -0.2727 -0.1589 0.0704 283 LEU B O 4126 C CB . LEU B 283 ? 0.2755 0.2975 0.2716 -0.1309 -0.1660 0.0241 283 LEU B CB 4127 C CG . LEU B 283 ? 0.3786 0.3028 0.2685 -0.1644 -0.1961 0.0473 283 LEU B CG 4128 C CD1 . LEU B 283 ? 0.7871 0.2442 0.3648 -0.0577 -0.3673 -0.0235 283 LEU B CD1 4129 C CD2 . LEU B 283 ? 0.4894 0.4038 0.3422 -0.2287 -0.0627 0.0337 283 LEU B CD2 4130 N N . SER B 284 ? 0.3141 0.2729 0.2551 -0.1787 -0.0492 0.0180 284 SER B N 4131 C CA . SER B 284 ? 0.3901 0.3571 0.2958 -0.2697 -0.0289 0.0044 284 SER B CA 4132 C C . SER B 284 ? 0.4652 0.3232 0.3156 -0.2815 -0.0398 0.0286 284 SER B C 4133 O O . SER B 284 ? 1.0662 0.3648 0.5171 -0.2778 -0.1046 0.1598 284 SER B O 4134 C CB . SER B 284 ? 0.4862 0.3064 0.2993 -0.2972 -0.0325 0.0513 284 SER B CB 4135 O OG . SER B 284 ? 0.4741 0.4406 0.3484 -0.2700 0.0447 0.0300 284 SER B OG 4136 S S . SO4 C . ? 0.2086 0.1241 0.2666 -0.0098 -0.0060 -0.0107 300 SO4 A S 4137 O O1 . SO4 C . ? 0.1541 0.1219 0.2734 -0.0013 0.0083 -0.0461 300 SO4 A O1 4138 O O2 . SO4 C . ? 0.3316 0.2820 0.5296 -0.1740 -0.1309 -0.0497 300 SO4 A O2 4139 O O3 . SO4 C . ? 0.2449 0.0745 0.3930 -0.0191 0.0614 -0.0788 300 SO4 A O3 4140 O O4 . SO4 C . ? 0.4382 0.2668 0.4913 0.0680 0.1888 0.1511 300 SO4 A O4 4141 S S . SO4 D . ? 0.2070 0.1937 0.2029 -0.0443 0.0236 -0.0343 300 SO4 B S 4142 O O1 . SO4 D . ? 0.6482 0.3428 0.2639 0.0727 0.1799 0.1074 300 SO4 B O1 4143 O O2 . SO4 D . ? 0.1825 0.2599 0.3520 -0.1333 0.1069 -0.1480 300 SO4 B O2 4144 O O3 . SO4 D . ? 0.4300 0.2692 0.3983 -0.1376 -0.1236 -0.1209 300 SO4 B O3 4145 O O4 . SO4 D . ? 0.1888 0.2088 0.2578 0.0001 0.0724 -0.0290 300 SO4 B O4 4146 O O . HOH E . ? 0.5182 0.4764 0.4155 -0.1679 -0.1103 -0.0068 301 HOH A O 4147 O O . HOH E . ? 0.4871 0.1677 0.4212 0.0445 -0.0648 -0.1614 302 HOH A O 4148 O O . HOH E . ? 0.2454 0.0826 0.1222 0.0208 -0.0287 -0.0077 303 HOH A O 4149 O O . HOH E . ? 0.2481 0.1102 0.1722 0.0319 -0.0596 -0.0093 304 HOH A O 4150 O O . HOH E . ? 0.4810 0.3372 0.1494 0.2033 0.0382 0.0791 305 HOH A O 4151 O O . HOH E . ? 0.1266 0.1262 0.1152 -0.0278 -0.0475 0.0164 306 HOH A O 4152 O O . HOH E . ? 0.2404 0.2385 0.2782 0.0542 -0.0140 0.0272 307 HOH A O 4153 O O . HOH E . ? 0.4377 0.6112 0.2531 -0.1804 -0.0276 -0.1490 308 HOH A O 4154 O O . HOH E . ? 0.3048 0.1285 0.0926 0.0666 -0.0810 0.0001 309 HOH A O 4155 O O . HOH E . ? 0.2615 0.1081 0.2637 -0.0016 -0.1122 0.0164 310 HOH A O 4156 O O . HOH E . ? 0.3998 0.2388 0.2379 0.0834 -0.0126 0.0640 311 HOH A O 4157 O O . HOH E . ? 0.3490 0.1407 0.1704 0.0789 -0.0597 -0.0313 312 HOH A O 4158 O O . HOH E . ? 0.2172 0.2746 0.2565 0.0392 0.0797 0.0420 313 HOH A O 4159 O O . HOH E . ? 0.3163 0.3716 0.2477 -0.0507 0.0550 0.0440 314 HOH A O 4160 O O . HOH E . ? 0.1995 0.1881 0.1676 0.0377 -0.0123 0.0162 315 HOH A O 4161 O O . HOH E . ? 0.2427 0.1835 0.2056 0.0308 -0.0812 -0.0359 316 HOH A O 4162 O O . HOH E . ? 0.1917 0.2001 0.1994 0.0301 0.0023 0.0096 317 HOH A O 4163 O O . HOH E . ? 0.3642 0.1370 0.1479 -0.0552 0.0221 -0.0108 318 HOH A O 4164 O O . HOH E . ? 0.2164 0.1632 0.1586 0.0310 -0.0534 -0.0076 319 HOH A O 4165 O O . HOH E . ? 0.1865 0.1374 0.1518 0.0000 -0.0402 0.0250 320 HOH A O 4166 O O . HOH E . ? 0.2323 0.1556 0.1684 -0.0253 -0.0705 0.0150 321 HOH A O 4167 O O . HOH E . ? 0.2738 0.1328 0.3946 0.0020 0.0416 -0.0399 322 HOH A O 4168 O O . HOH E . ? 0.2825 0.2429 0.1897 -0.0272 0.0420 -0.0358 323 HOH A O 4169 O O . HOH E . ? 0.4026 0.1940 0.3333 0.0779 -0.0024 0.0956 324 HOH A O 4170 O O . HOH E . ? 0.3160 0.2670 0.4369 -0.1025 -0.2497 0.1007 325 HOH A O 4171 O O . HOH E . ? 0.2768 0.2071 0.2688 0.0048 -0.0996 0.0749 326 HOH A O 4172 O O . HOH E . ? 0.2142 0.1395 0.1620 -0.0039 -0.0380 0.0549 327 HOH A O 4173 O O . HOH E . ? 0.3202 0.3206 0.2157 -0.0198 -0.0117 0.0087 328 HOH A O 4174 O O . HOH E . ? 0.1473 0.1328 0.1415 -0.0272 -0.0078 0.0147 329 HOH A O 4175 O O . HOH E . ? 0.3099 0.1587 0.5483 0.0500 -0.0058 0.0321 330 HOH A O 4176 O O . HOH E . ? 0.3687 0.1140 0.2798 -0.0093 -0.1320 0.0312 331 HOH A O 4177 O O . HOH E . ? 0.2641 0.1415 0.3230 0.0059 -0.0322 -0.0195 332 HOH A O 4178 O O . HOH E . ? 0.2491 0.1335 0.3269 0.0301 -0.1342 -0.0432 333 HOH A O 4179 O O . HOH E . ? 0.2297 0.1734 0.2300 -0.0261 0.0227 0.0274 334 HOH A O 4180 O O . HOH E . ? 0.2247 0.1643 0.1866 0.0539 -0.0027 -0.0024 335 HOH A O 4181 O O . HOH E . ? 0.4633 0.2013 0.4209 0.0376 0.0770 0.0215 336 HOH A O 4182 O O . HOH E . ? 0.2499 0.2397 0.1244 0.0598 -0.0509 -0.0004 337 HOH A O 4183 O O . HOH E . ? 0.2368 0.1202 0.1574 -0.0178 -0.0799 0.0027 338 HOH A O 4184 O O . HOH E . ? 0.2911 0.6413 0.4042 0.0659 0.1882 -0.0661 339 HOH A O 4185 O O . HOH E . ? 0.3192 0.2033 0.2691 0.0520 -0.0243 0.0557 340 HOH A O 4186 O O . HOH E . ? 0.2942 0.1442 0.2163 -0.0627 -0.0100 0.0094 341 HOH A O 4187 O O . HOH E . ? 0.3549 0.1832 0.2201 0.0579 -0.1118 0.0150 342 HOH A O 4188 O O . HOH E . ? 0.5756 0.3656 0.2675 0.1255 0.0702 0.0846 343 HOH A O 4189 O O . HOH E . ? 0.3327 0.1588 0.3183 -0.0112 0.0407 0.0262 344 HOH A O 4190 O O . HOH E . ? 0.2865 0.1634 0.1200 0.0157 -0.0400 0.0445 345 HOH A O 4191 O O . HOH E . ? 0.3702 0.3635 0.1486 0.0363 -0.0714 -0.0606 346 HOH A O 4192 O O . HOH E . ? 0.3819 0.2315 0.2535 0.0311 0.0128 -0.0797 347 HOH A O 4193 O O . HOH E . ? 0.4771 0.2474 0.2785 -0.0129 -0.1014 -0.0403 348 HOH A O 4194 O O . HOH E . ? 0.2537 0.2620 0.1973 -0.0386 -0.0684 0.0204 349 HOH A O 4195 O O . HOH E . ? 0.3638 0.2247 0.2559 0.0805 0.0861 0.0051 350 HOH A O 4196 O O . HOH E . ? 0.3974 0.1518 0.1777 0.0656 -0.0391 0.0179 351 HOH A O 4197 O O . HOH E . ? 0.2215 0.1972 0.2490 0.0500 -0.0889 -0.0625 352 HOH A O 4198 O O . HOH E . ? 0.3770 0.1471 0.2571 -0.0373 -0.1064 0.0082 353 HOH A O 4199 O O . HOH E . ? 0.2838 0.1348 0.3390 0.0568 0.0612 0.0582 354 HOH A O 4200 O O . HOH E . ? 0.2456 0.1360 0.1710 0.0122 0.0392 0.0054 355 HOH A O 4201 O O . HOH E . ? 0.4284 0.3155 0.4683 0.0742 -0.2184 0.1037 356 HOH A O 4202 O O . HOH E . ? 0.4865 0.4540 0.5877 -0.0259 0.0266 0.3507 357 HOH A O 4203 O O . HOH E . ? 0.3615 0.3142 0.2702 0.0150 -0.1279 -0.0148 358 HOH A O 4204 O O . HOH E . ? 0.5685 0.3383 0.2621 -0.0674 -0.0043 -0.0438 359 HOH A O 4205 O O . HOH E . ? 0.4070 0.4241 0.2985 0.0983 0.0700 0.2304 360 HOH A O 4206 O O . HOH E . ? 0.3637 0.2638 0.4138 0.0591 0.0002 0.0225 361 HOH A O 4207 O O . HOH E . ? 0.2417 0.1959 0.1747 0.0586 -0.0780 0.0190 362 HOH A O 4208 O O . HOH E . ? 0.3219 0.1593 0.2578 0.0111 -0.0178 -0.0427 363 HOH A O 4209 O O . HOH E . ? 0.4905 0.4292 0.3029 0.0224 0.0367 0.0091 364 HOH A O 4210 O O . HOH E . ? 0.2948 0.2844 0.3627 -0.0507 -0.0407 -0.0807 365 HOH A O 4211 O O . HOH E . ? 0.3021 0.1521 0.3666 -0.0701 0.1355 -0.1092 366 HOH A O 4212 O O . HOH E . ? 0.5417 0.3083 0.2878 0.0486 0.0204 0.0279 367 HOH A O 4213 O O . HOH E . ? 0.3833 0.3021 0.3745 0.0942 -0.0844 -0.0442 368 HOH A O 4214 O O . HOH E . ? 0.3520 0.2916 0.1902 -0.0053 -0.0215 -0.1211 369 HOH A O 4215 O O . HOH E . ? 0.1941 0.3474 0.3737 -0.0572 -0.0282 -0.0414 370 HOH A O 4216 O O . HOH E . ? 0.3981 0.4294 0.3392 0.1061 -0.0580 -0.0634 371 HOH A O 4217 O O . HOH E . ? 0.2235 0.2220 0.1353 -0.0207 -0.0367 -0.0411 372 HOH A O 4218 O O . HOH E . ? 0.2515 0.2547 0.3345 -0.0478 0.0452 0.0482 373 HOH A O 4219 O O . HOH E . ? 0.2743 0.1728 0.3608 -0.0136 -0.0474 -0.0199 374 HOH A O 4220 O O . HOH E . ? 0.4073 0.2917 0.3343 0.1428 0.0998 0.0598 375 HOH A O 4221 O O . HOH E . ? 0.5337 0.4195 0.3252 -0.0791 0.0457 -0.1049 376 HOH A O 4222 O O . HOH E . ? 0.5881 0.5240 0.3375 -0.2207 -0.1799 -0.0899 377 HOH A O 4223 O O . HOH E . ? 0.3918 0.2790 0.1665 0.1556 -0.0069 0.0589 378 HOH A O 4224 O O . HOH E . ? 0.3598 0.2471 0.2706 0.0122 0.1033 -0.1027 379 HOH A O 4225 O O . HOH E . ? 0.3346 0.2198 0.2993 0.0030 -0.0855 -0.0123 380 HOH A O 4226 O O . HOH E . ? 0.3910 0.1386 0.1601 0.0212 -0.0618 -0.0172 381 HOH A O 4227 O O . HOH E . ? 0.4330 0.3748 0.1683 0.1071 -0.0530 0.0262 382 HOH A O 4228 O O . HOH E . ? 0.4499 0.2029 0.2279 0.1150 -0.0752 -0.0327 383 HOH A O 4229 O O . HOH E . ? 0.3515 0.4290 0.2801 -0.0567 -0.0010 0.0180 384 HOH A O 4230 O O . HOH E . ? 0.2983 0.4446 0.3117 -0.0239 0.0388 0.0247 385 HOH A O 4231 O O . HOH E . ? 0.5571 0.4015 0.5999 0.1133 -0.2500 0.0207 386 HOH A O 4232 O O . HOH E . ? 0.4017 0.2822 0.1856 -0.0642 -0.0469 -0.0247 387 HOH A O 4233 O O . HOH E . ? 0.2490 0.6280 0.5462 -0.0370 -0.0817 -0.0401 388 HOH A O 4234 O O . HOH E . ? 0.4796 0.4681 0.4269 0.0421 0.0328 0.2146 389 HOH A O 4235 O O . HOH E . ? 0.6469 0.4168 0.4005 -0.0098 -0.2369 0.0310 390 HOH A O 4236 O O . HOH E . ? 0.3379 0.3487 0.3757 0.0411 0.1000 0.0973 391 HOH A O 4237 O O . HOH E . ? 0.4834 0.3548 0.2293 -0.0045 -0.0927 -0.0145 392 HOH A O 4238 O O . HOH E . ? 0.4384 0.3386 0.2342 0.0358 0.0574 0.0472 393 HOH A O 4239 O O . HOH E . ? 0.3636 0.2594 0.1563 0.1282 -0.0516 0.0088 394 HOH A O 4240 O O . HOH E . ? 0.4845 0.4922 0.4997 0.0956 0.2046 0.1437 395 HOH A O 4241 O O . HOH E . ? 0.3350 0.1803 0.2595 0.0099 0.0501 -0.0041 396 HOH A O 4242 O O . HOH E . ? 0.2845 0.1171 0.1516 0.0448 -0.0477 -0.0004 397 HOH A O 4243 O O . HOH E . ? 0.2271 0.1980 0.1679 0.0581 0.0060 0.0316 398 HOH A O 4244 O O . HOH E . ? 0.2655 0.3080 0.4444 0.1407 0.0282 -0.0153 399 HOH A O 4245 O O . HOH E . ? 0.2746 0.1882 0.1194 0.0771 -0.0235 0.0178 400 HOH A O 4246 O O . HOH E . ? 0.5006 0.3092 0.2552 0.1024 0.0064 -0.0341 401 HOH A O 4247 O O . HOH E . ? 0.6288 0.2308 0.1275 -0.0167 -0.0564 -0.0341 402 HOH A O 4248 O O . HOH E . ? 0.5608 0.3271 0.5530 0.0393 0.0564 0.1317 403 HOH A O 4249 O O . HOH E . ? 0.4879 0.2823 0.4035 -0.1395 -0.1501 0.0643 404 HOH A O 4250 O O . HOH E . ? 0.5296 0.5870 0.6639 0.0075 -0.0786 -0.0240 405 HOH A O 4251 O O . HOH E . ? 0.2495 0.1479 0.4440 -0.0427 -0.0057 -0.0880 406 HOH A O 4252 O O . HOH E . ? 0.5499 0.3843 0.4697 -0.0497 0.2645 0.1507 407 HOH A O 4253 O O . HOH E . ? 0.5074 0.6611 0.4309 0.0111 -0.1517 -0.0399 408 HOH A O 4254 O O . HOH E . ? 0.3802 0.3425 0.3787 0.0092 0.1611 -0.0593 409 HOH A O 4255 O O . HOH E . ? 0.2183 0.2007 0.4089 -0.0157 0.1115 -0.1086 410 HOH A O 4256 O O . HOH E . ? 0.2965 0.3574 0.3751 0.0546 0.0504 -0.0730 411 HOH A O 4257 O O . HOH E . ? 0.2296 0.2907 0.3057 0.0053 -0.0068 0.0824 412 HOH A O 4258 O O . HOH E . ? 0.5268 0.2545 0.2241 0.0624 -0.1093 -0.0815 413 HOH A O 4259 O O . HOH E . ? 0.3649 0.1687 0.2346 0.0516 0.0092 0.0707 414 HOH A O 4260 O O . HOH E . ? 0.3538 0.2419 0.2532 -0.0685 -0.0425 -0.0598 415 HOH A O 4261 O O . HOH E . ? 0.4191 0.3281 0.1440 0.1637 -0.0126 0.0761 416 HOH A O 4262 O O . HOH E . ? 0.5032 0.3680 0.1958 0.2610 -0.0609 -0.0474 417 HOH A O 4263 O O . HOH E . ? 0.3350 0.1372 0.4470 0.0322 -0.1564 0.0674 418 HOH A O 4264 O O . HOH E . ? 0.2915 0.1597 0.2192 -0.0068 -0.0644 0.0321 419 HOH A O 4265 O O . HOH E . ? 0.3622 0.2880 0.3991 -0.0003 -0.0426 -0.0300 420 HOH A O 4266 O O . HOH E . ? 0.4409 0.4938 0.1857 0.2481 0.0124 0.0171 421 HOH A O 4267 O O . HOH E . ? 0.4341 0.4023 0.2598 -0.0158 0.0775 -0.1380 422 HOH A O 4268 O O . HOH E . ? 0.4193 0.2519 0.1689 0.1084 0.0043 0.0040 423 HOH A O 4269 O O . HOH E . ? 0.8132 0.6492 0.8026 0.0255 -0.0309 -0.0061 424 HOH A O 4270 O O . HOH E . ? 0.3562 0.2209 0.3873 0.1285 -0.0425 -0.0110 425 HOH A O 4271 O O . HOH E . ? 0.3015 0.3533 0.1952 0.1347 -0.0020 0.0335 426 HOH A O 4272 O O . HOH E . ? 0.5334 0.3377 0.2583 0.0497 0.0752 0.0255 427 HOH A O 4273 O O . HOH E . ? 0.2360 0.4523 0.5125 -0.0854 0.0982 0.0746 428 HOH A O 4274 O O . HOH E . ? 0.3342 0.2694 0.2303 0.0837 -0.1140 -0.0900 429 HOH A O 4275 O O . HOH E . ? 0.3223 0.3340 0.3552 0.0712 0.0622 -0.0151 430 HOH A O 4276 O O . HOH E . ? 0.3424 0.2847 0.5399 0.1359 -0.1514 -0.0727 431 HOH A O 4277 O O . HOH E . ? 0.5883 0.3986 0.4181 0.1084 -0.2099 -0.0018 432 HOH A O 4278 O O . HOH E . ? 0.3252 0.3330 0.5569 0.0578 0.0569 0.1301 433 HOH A O 4279 O O . HOH E . ? 0.6200 0.4433 0.3890 0.0087 -0.1959 0.1352 434 HOH A O 4280 O O . HOH E . ? 0.6384 0.2583 0.4052 -0.1687 -0.3545 0.0726 435 HOH A O 4281 O O . HOH E . ? 0.6263 0.2855 0.3959 -0.0850 -0.1323 -0.0295 436 HOH A O 4282 O O . HOH E . ? 0.5386 0.4486 0.6159 0.0644 0.0801 -0.1361 437 HOH A O 4283 O O . HOH E . ? 0.4090 0.5792 0.2560 -0.1148 0.0039 0.0582 438 HOH A O 4284 O O . HOH E . ? 0.2763 0.2018 0.5826 -0.0331 -0.0875 0.0205 439 HOH A O 4285 O O . HOH E . ? 0.3050 0.5738 0.2924 0.0103 -0.1362 0.1585 440 HOH A O 4286 O O . HOH E . ? 0.5083 0.3822 0.4051 -0.1184 0.0667 0.1435 441 HOH A O 4287 O O . HOH E . ? 0.3698 0.7534 0.4264 0.1480 0.0865 -0.0242 442 HOH A O 4288 O O . HOH E . ? 0.4487 0.3083 0.5516 -0.0246 -0.0802 0.0271 443 HOH A O 4289 O O . HOH E . ? 0.4237 0.3296 0.2280 0.0645 -0.0612 -0.0183 444 HOH A O 4290 O O . HOH E . ? 0.4261 0.3218 0.2130 -0.0715 -0.1937 0.0507 445 HOH A O 4291 O O . HOH E . ? 0.3169 0.3906 0.4307 -0.0014 0.0494 -0.1212 446 HOH A O 4292 O O . HOH E . ? 0.5832 0.5675 0.5891 -0.1353 0.2049 0.0369 447 HOH A O 4293 O O . HOH E . ? 0.3473 0.3282 0.5211 -0.0440 -0.0368 -0.1531 448 HOH A O 4294 O O . HOH E . ? 0.4041 0.3154 0.5263 0.0255 0.0860 -0.0787 449 HOH A O 4295 O O . HOH E . ? 0.3066 0.1511 0.1849 -0.0294 -0.0216 -0.0091 450 HOH A O 4296 O O . HOH E . ? 0.3127 0.2040 0.3582 0.0030 -0.0502 0.1047 451 HOH A O 4297 O O . HOH E . ? 0.5597 0.2417 0.1973 0.0117 -0.1209 0.0406 452 HOH A O 4298 O O . HOH E . ? 0.3334 0.2945 0.2813 0.0582 -0.0314 0.0365 453 HOH A O 4299 O O . HOH E . ? 0.4811 0.4496 0.4630 0.1553 0.1781 0.1026 454 HOH A O 4300 O O . HOH E . ? 0.6058 0.4161 0.5685 0.0622 -0.2190 0.1337 455 HOH A O 4301 O O . HOH E . ? 0.4702 0.4824 0.5845 -0.0416 -0.1024 0.2198 456 HOH A O 4302 O O . HOH E . ? 0.3183 0.2827 0.2613 0.1553 -0.0126 0.0208 457 HOH A O 4303 O O . HOH E . ? 0.4310 0.2856 0.3001 -0.0176 -0.1253 0.0230 458 HOH A O 4304 O O . HOH E . ? 0.5576 0.4485 0.4279 0.1777 -0.1533 -0.0792 459 HOH A O 4305 O O . HOH E . ? 0.3622 0.5744 0.4873 -0.0105 0.2273 0.0954 460 HOH A O 4306 O O . HOH E . ? 0.6519 0.6615 0.4118 0.0399 0.0136 0.2354 461 HOH A O 4307 O O . HOH E . ? 0.4848 0.4415 0.3316 0.2345 -0.1369 0.0590 462 HOH A O 4308 O O . HOH E . ? 0.4829 0.3282 0.5374 -0.0024 -0.1461 -0.0173 463 HOH A O 4309 O O . HOH E . ? 0.3012 0.5927 0.2470 0.0396 0.1256 0.0577 464 HOH A O 4310 O O . HOH E . ? 0.3348 0.2556 0.2593 -0.0205 0.0329 0.0674 465 HOH A O 4311 O O . HOH E . ? 0.3006 0.5099 0.6105 0.0483 0.0151 -0.1544 466 HOH A O 4312 O O . HOH E . ? 0.4203 0.3464 0.4185 0.0447 -0.1339 -0.1241 467 HOH A O 4313 O O . HOH E . ? 0.7751 0.1777 0.4819 0.2018 -0.2627 -0.0312 468 HOH A O 4314 O O . HOH E . ? 0.3447 0.4389 0.4910 -0.1625 -0.0846 -0.0829 469 HOH A O 4315 O O . HOH E . ? 0.2898 0.3337 0.6682 -0.0490 0.0254 -0.1096 470 HOH A O 4316 O O . HOH E . ? 0.3930 0.3825 0.4875 -0.2288 0.0048 -0.0056 471 HOH A O 4317 O O . HOH E . ? 0.3340 0.2468 0.4387 0.0509 0.1087 0.0074 472 HOH A O 4318 O O . HOH E . ? 0.4447 0.3674 0.3432 -0.0193 -0.1637 -0.0122 473 HOH A O 4319 O O . HOH E . ? 0.5299 0.5385 0.4874 0.0642 -0.0251 0.0589 474 HOH A O 4320 O O . HOH E . ? 0.5332 0.4703 0.3006 0.0605 -0.0878 0.0355 475 HOH A O 4321 O O . HOH E . ? 0.5628 0.5583 0.6199 -0.0502 -0.1079 0.1211 476 HOH A O 4322 O O . HOH E . ? 0.3314 0.2411 0.5558 -0.0372 -0.0378 0.1058 477 HOH A O 4323 O O . HOH E . ? 0.4658 0.3844 0.4201 -0.1246 0.1632 -0.0446 478 HOH A O 4324 O O . HOH E . ? 0.6482 0.5026 0.7004 -0.1278 0.0985 -0.0415 479 HOH A O 4325 O O . HOH E . ? 0.5578 0.2879 0.5594 -0.0849 -0.1613 0.1174 480 HOH A O 4326 O O . HOH E . ? 0.3691 0.5194 0.4283 -0.0158 0.1401 0.0380 481 HOH A O 4327 O O . HOH E . ? 0.4474 0.2985 0.5038 0.0216 -0.0503 -0.0729 482 HOH A O 4328 O O . HOH E . ? 0.5950 0.4749 0.4555 -0.0052 -0.2612 0.0974 483 HOH A O 4329 O O . HOH E . ? 0.4679 0.3416 0.3023 0.0667 0.0425 0.0001 484 HOH A O 4330 O O . HOH E . ? 0.5792 0.5467 0.5177 0.1066 0.0099 0.1113 485 HOH A O 4331 O O . HOH E . ? 0.3459 0.4550 0.3237 -0.1522 -0.0785 0.1731 486 HOH A O 4332 O O . HOH E . ? 0.4224 0.2736 0.2771 -0.0170 -0.0399 -0.0564 487 HOH A O 4333 O O . HOH E . ? 0.3872 0.7159 0.6517 -0.2455 0.0327 0.2581 488 HOH A O 4334 O O . HOH E . ? 0.3836 0.3754 0.5129 0.0452 -0.0715 -0.0935 489 HOH A O 4335 O O . HOH E . ? 0.3313 0.5572 0.4282 0.0106 0.0185 0.1849 490 HOH A O 4336 O O . HOH E . ? 0.2021 0.5026 0.4517 0.0190 0.0274 0.2314 491 HOH A O 4337 O O . HOH E . ? 0.3215 0.3300 0.4485 -0.0619 -0.0723 0.0341 492 HOH A O 4338 O O . HOH E . ? 0.2415 0.4552 0.5115 0.0151 0.0381 0.1306 493 HOH A O 4339 O O . HOH E . ? 0.5838 0.3985 0.2301 -0.0051 -0.1323 -0.1023 494 HOH A O 4340 O O . HOH E . ? 0.4658 0.5990 0.2200 0.1087 0.0539 0.1461 495 HOH A O 4341 O O . HOH E . ? 0.4541 0.3000 0.3504 0.0819 0.0259 0.0636 496 HOH A O 4342 O O . HOH E . ? 0.5007 0.4027 0.4421 0.1888 -0.2101 -0.0028 497 HOH A O 4343 O O . HOH E . ? 0.6726 0.7441 0.4675 0.1095 0.0898 -0.0696 498 HOH A O 4344 O O . HOH E . ? 0.1995 0.3506 0.3006 -0.0259 -0.0067 0.0723 499 HOH A O 4345 O O . HOH E . ? 0.4626 0.4702 0.6252 0.1942 -0.1762 -0.1815 500 HOH A O 4346 O O . HOH E . ? 0.4971 0.6053 0.7693 -0.2740 -0.0783 -0.0324 501 HOH A O 4347 O O . HOH E . ? 0.6064 0.2721 0.5078 0.0154 -0.1338 -0.0569 502 HOH A O 4348 O O . HOH E . ? 0.5200 0.4105 0.4239 0.0537 -0.0013 0.1607 503 HOH A O 4349 O O . HOH E . ? 0.3853 0.4179 0.4132 -0.0083 0.0927 -0.1256 504 HOH A O 4350 O O . HOH E . ? 0.5803 0.3015 0.3247 -0.0660 -0.1251 -0.0299 505 HOH A O 4351 O O . HOH E . ? 0.4342 0.4404 0.4110 0.0519 -0.1826 0.0809 506 HOH A O 4352 O O . HOH E . ? 0.5597 0.3260 0.3322 0.1717 -0.0133 0.1351 507 HOH A O 4353 O O . HOH E . ? 0.6400 0.4046 0.5132 -0.3141 -0.1366 0.2247 508 HOH A O 4354 O O . HOH E . ? 0.5435 0.3892 0.4022 0.0547 -0.0291 0.0793 509 HOH A O 4355 O O . HOH E . ? 0.3217 0.3041 0.5664 0.1055 0.0834 0.1489 510 HOH A O 4356 O O . HOH E . ? 0.6494 0.5576 0.3364 0.2739 -0.1583 0.0491 511 HOH A O 4357 O O . HOH E . ? 0.4669 0.4576 0.4578 0.0983 0.0555 -0.1658 512 HOH A O 4358 O O . HOH E . ? 0.3830 0.5979 0.3702 0.1113 0.0748 0.2423 513 HOH A O 4359 O O . HOH E . ? 0.4342 0.5977 0.4578 0.2664 -0.1037 -0.1478 514 HOH A O 4360 O O . HOH E . ? 0.4541 0.4036 0.2917 0.0311 0.0134 0.0422 515 HOH A O 4361 O O . HOH E . ? 0.5904 0.4589 0.5302 -0.0272 0.0707 -0.1297 516 HOH A O 4362 O O . HOH E . ? 0.3920 0.2026 0.3581 -0.0198 -0.0710 0.0239 517 HOH A O 4363 O O . HOH E . ? 0.2299 0.0659 0.1064 0.0328 -0.0748 -0.0276 518 HOH A O 4364 O O . HOH E . ? 0.3833 0.2699 0.2101 0.1517 -0.0571 -0.0128 519 HOH A O 4365 O O . HOH E . ? 0.3891 0.2615 0.2130 -0.1240 0.0179 -0.0660 520 HOH A O 4366 O O . HOH E . ? 0.4300 0.5840 0.3865 0.0492 -0.1363 0.0112 521 HOH A O 4367 O O . HOH E . ? 0.6882 0.2887 0.4207 -0.0123 -0.2043 -0.0819 522 HOH A O 4368 O O . HOH E . ? 0.2988 0.4303 0.2964 -0.0740 0.0369 0.0572 523 HOH A O 4369 O O . HOH E . ? 0.4602 0.2252 0.6047 -0.1304 0.2211 -0.1664 524 HOH A O 4370 O O . HOH E . ? 0.2006 0.4783 0.3084 0.0284 0.0011 0.1339 525 HOH A O 4371 O O . HOH E . ? 0.3562 0.4213 0.3105 -0.0122 -0.0248 -0.0541 526 HOH A O 4372 O O . HOH E . ? 0.3795 0.3351 0.4229 0.1078 -0.0445 0.0174 527 HOH A O 4373 O O . HOH E . ? 0.3980 0.4314 0.4317 0.0421 0.0187 -0.1306 528 HOH A O 4374 O O . HOH E . ? 0.4367 0.3705 0.2863 0.0780 0.0057 0.1013 529 HOH A O 4375 O O . HOH E . ? 0.6475 0.6707 0.4872 0.0561 0.0029 0.1287 530 HOH A O 4376 O O . HOH E . ? 0.5352 0.5504 0.4784 -0.0867 -0.1803 0.2218 531 HOH A O 4377 O O . HOH E . ? 0.4398 0.4430 0.4494 0.0364 -0.2079 -0.1235 532 HOH A O 4378 O O . HOH E . ? 0.6149 0.3271 0.5968 0.0939 -0.0808 0.2413 533 HOH A O 4379 O O . HOH E . ? 0.3172 0.3723 0.3765 -0.1299 -0.0406 -0.0533 534 HOH A O 4380 O O . HOH E . ? 0.5476 0.5112 0.4554 -0.1565 -0.0038 0.1009 535 HOH A O 4381 O O . HOH E . ? 0.4008 0.3977 0.2580 0.1654 -0.0763 0.0715 536 HOH A O 4382 O O . HOH E . ? 0.6050 0.4105 0.4450 -0.1030 0.0470 -0.0768 537 HOH A O 4383 O O . HOH E . ? 0.4294 0.6135 0.3611 0.1801 0.0387 -0.1274 538 HOH A O 4384 O O . HOH E . ? 0.7076 0.5597 0.5130 -0.0461 -0.0758 0.1296 539 HOH A O 4385 O O . HOH E . ? 0.3678 0.2191 0.6363 -0.0041 0.0854 0.0104 540 HOH A O 4386 O O . HOH E . ? 0.5718 0.5052 0.5818 0.2185 -0.0515 -0.2140 541 HOH A O 4387 O O . HOH E . ? 0.4095 0.8537 0.5637 0.0493 0.1848 -0.0243 542 HOH A O 4388 O O . HOH E . ? 0.3920 0.4686 0.4576 -0.0291 -0.1918 0.0597 543 HOH A O 4389 O O . HOH E . ? 0.4559 0.4547 0.3536 0.0018 0.0524 0.0804 544 HOH A O 4390 O O . HOH E . ? 0.6627 0.6519 0.2971 -0.0870 0.0618 -0.0029 545 HOH A O 4391 O O . HOH E . ? 0.6127 0.7658 0.5817 0.1179 0.2152 -0.1200 546 HOH A O 4392 O O . HOH E . ? 0.7667 0.5238 0.7482 0.1415 -0.2370 -0.0049 547 HOH A O 4393 O O . HOH E . ? 0.4119 0.2618 0.6031 -0.0570 0.0050 -0.1061 548 HOH A O 4394 O O . HOH E . ? 0.6604 0.5926 0.6292 -0.1454 -0.1360 0.1714 549 HOH A O 4395 O O . HOH E . ? 0.5019 0.3250 0.3381 0.0044 -0.1026 0.0192 550 HOH A O 4396 O O . HOH E . ? 0.3196 0.5453 0.7173 -0.1239 0.0547 -0.2301 551 HOH A O 4397 O O . HOH E . ? 0.6296 0.2930 0.5631 0.0327 -0.1597 -0.1808 552 HOH A O 4398 O O . HOH E . ? 0.5850 0.4076 0.4429 -0.1770 0.1072 0.0031 553 HOH A O 4399 O O . HOH E . ? 0.4641 0.4942 0.3323 -0.0132 -0.0550 0.1264 554 HOH A O 4400 O O . HOH E . ? 0.6118 0.6232 0.7358 -0.0878 0.0510 0.0194 555 HOH A O 4401 O O . HOH E . ? 0.3644 0.4280 0.2972 0.0735 0.0374 -0.0548 556 HOH A O 4402 O O . HOH E . ? 0.5482 0.6469 0.5079 -0.0425 0.0682 0.0903 557 HOH A O 4403 O O . HOH E . ? 0.5521 0.2752 0.4829 -0.1139 -0.1033 0.0400 558 HOH A O 4404 O O . HOH E . ? 0.6505 0.7123 0.5486 0.0103 -0.0343 -0.0081 559 HOH A O 4405 O O . HOH E . ? 0.6391 0.4741 0.2136 0.0178 -0.0065 0.0498 560 HOH A O 4406 O O . HOH E . ? 0.6351 0.4375 0.4061 0.0621 0.2192 0.0612 561 HOH A O 4407 O O . HOH E . ? 0.5665 0.6285 0.4897 0.0288 -0.0034 -0.0276 562 HOH A O 4408 O O . HOH E . ? 0.4909 0.5938 0.5466 0.0577 0.0529 0.2179 563 HOH A O 4409 O O . HOH E . ? 0.4042 0.2808 0.3946 0.0508 -0.0972 -0.0597 564 HOH A O 4410 O O . HOH E . ? 0.2711 0.3293 0.4995 0.0502 0.0647 -0.0428 565 HOH A O 4411 O O . HOH E . ? 0.4768 0.4864 0.6037 0.0831 -0.0497 0.0091 566 HOH A O 4412 O O . HOH E . ? 0.2768 0.1463 0.2406 -0.0127 0.0061 -0.0198 567 HOH A O 4413 O O . HOH E . ? 0.5454 0.3319 0.5773 0.0085 0.0300 0.0361 568 HOH A O 4414 O O . HOH E . ? 0.4038 0.6628 0.6590 0.0991 0.0145 0.1583 569 HOH A O 4415 O O . HOH E . ? 0.8891 0.1738 0.2135 0.0862 -0.2744 -0.0151 570 HOH A O 4416 O O . HOH E . ? 0.5557 0.5244 0.4435 0.0588 0.1190 -0.0447 571 HOH A O 4417 O O . HOH E . ? 0.6535 0.3337 0.6610 0.1100 -0.1073 0.0678 572 HOH A O 4418 O O . HOH E . ? 0.4465 0.4960 0.4464 -0.0456 0.0289 0.0277 573 HOH A O 4419 O O . HOH E . ? 0.7072 0.4261 0.5920 0.1527 -0.1869 -0.1681 574 HOH A O 4420 O O . HOH E . ? 0.4956 0.4576 0.3280 0.0561 -0.2335 -0.0430 575 HOH A O 4421 O O . HOH E . ? 0.4334 0.3820 0.4965 0.0711 -0.0512 0.1333 576 HOH A O 4422 O O . HOH E . ? 0.7365 0.3669 0.3125 0.1501 0.1860 0.0534 577 HOH A O 4423 O O . HOH E . ? 0.3656 0.3830 0.6307 0.0322 0.0509 -0.1355 578 HOH A O 4424 O O . HOH E . ? 0.5752 0.3587 0.4568 0.0915 0.0109 -0.0324 579 HOH A O 4425 O O . HOH E . ? 0.4913 0.4476 0.5242 -0.0953 0.0520 -0.0795 580 HOH A O 4426 O O . HOH E . ? 0.3974 0.5310 0.6196 0.1394 -0.0093 0.1193 581 HOH A O 4427 O O . HOH E . ? 0.4289 0.6429 0.5525 -0.0946 0.1079 -0.1790 582 HOH A O 4428 O O . HOH E . ? 0.3120 0.5647 0.3346 0.0844 0.0385 0.1614 583 HOH A O 4429 O O . HOH E . ? 0.2815 0.6280 0.6052 -0.0087 -0.0549 -0.1358 584 HOH A O 4430 O O . HOH E . ? 0.6841 0.7574 0.3786 0.0242 0.0766 -0.0105 585 HOH A O 4431 O O . HOH E . ? 0.8381 0.7127 0.6798 -0.0446 -0.0544 -0.0019 586 HOH A O 4432 O O . HOH E . ? 0.4671 0.4657 0.5301 0.0797 -0.1756 0.0950 587 HOH A O 4433 O O . HOH E . ? 0.6487 0.6786 0.5600 0.1945 -0.0013 -0.0513 588 HOH A O 4434 O O . HOH E . ? 0.5361 0.5739 0.4987 -0.0881 0.1517 0.1005 589 HOH A O 4435 O O . HOH E . ? 0.4889 0.6924 0.3751 -0.0155 0.0921 0.0002 590 HOH A O 4436 O O . HOH E . ? 0.3967 0.5916 0.7168 0.1510 0.1027 -0.0392 591 HOH A O 4437 O O . HOH E . ? 0.5495 0.6854 0.7835 0.0296 0.1837 -0.0970 592 HOH A O 4438 O O . HOH E . ? 0.6095 0.4927 0.5363 -0.0227 0.0511 0.0326 593 HOH A O 4439 O O . HOH E . ? 0.4805 0.7078 0.7025 0.0911 -0.0205 -0.1041 594 HOH A O 4440 O O . HOH E . ? 0.5422 0.4342 0.5353 0.0669 -0.1284 -0.0967 595 HOH A O 4441 O O . HOH E . ? 0.4133 0.6790 0.6682 -0.1062 0.1714 0.0828 596 HOH A O 4442 O O . HOH E . ? 0.6678 0.5985 0.3347 0.0080 -0.0410 0.0255 597 HOH A O 4443 O O . HOH E . ? 0.4506 0.5873 0.2634 0.1449 0.0039 -0.1464 598 HOH A O 4444 O O . HOH E . ? 0.5056 0.6407 0.5663 0.0830 0.0907 0.1268 599 HOH A O 4445 O O . HOH E . ? 0.5873 0.5558 0.5708 -0.1762 0.1014 -0.0263 600 HOH A O 4446 O O . HOH E . ? 0.5400 0.4969 0.3651 0.1198 -0.0943 0.0263 601 HOH A O 4447 O O . HOH E . ? 0.7302 0.5372 0.4462 -0.0476 -0.0456 -0.0356 602 HOH A O 4448 O O . HOH E . ? 0.5812 0.4074 0.4152 0.0424 -0.1780 0.0272 603 HOH A O 4449 O O . HOH E . ? 0.5240 0.5914 0.4655 -0.0893 -0.0385 0.1755 604 HOH A O 4450 O O . HOH E . ? 0.8004 0.6808 0.5636 0.0630 0.0046 0.0944 605 HOH A O 4451 O O . HOH E . ? 0.3992 0.7504 0.8188 0.0914 0.1072 -0.0297 606 HOH A O 4452 O O . HOH E . ? 0.3385 0.6896 0.4946 -0.0104 0.1259 0.0834 607 HOH A O 4453 O O . HOH E . ? 0.6483 0.5438 0.5662 0.0238 -0.0324 0.0097 608 HOH A O 4454 O O . HOH E . ? 0.7166 0.6884 0.7344 -0.2796 0.0005 0.0432 609 HOH A O 4455 O O . HOH E . ? 0.6454 0.5064 0.4475 0.0801 -0.0836 0.1122 610 HOH A O 4456 O O . HOH E . ? 0.9992 1.0234 0.9936 0.0039 0.0271 -0.0862 611 HOH A O 4457 O O . HOH E . ? 0.5070 0.6344 0.6689 0.1305 -0.1050 -0.0355 612 HOH A O 4458 O O . HOH E . ? 0.7701 0.6297 0.4476 0.1036 -0.1240 0.1143 613 HOH A O 4459 O O . HOH E . ? 0.5607 0.6284 0.5315 -0.1457 0.0159 0.0828 614 HOH A O 4460 O O . HOH E . ? 0.6384 0.7001 0.4281 0.1038 -0.2406 0.0981 615 HOH A O 4461 O O . HOH E . ? 0.7335 0.4714 0.6510 -0.0234 -0.0726 0.0981 616 HOH A O 4462 O O . HOH E . ? 0.5889 0.5504 0.5816 0.1218 0.0738 0.0911 617 HOH A O 4463 O O . HOH E . ? 0.3830 0.7250 0.6126 0.0418 0.1626 -0.1097 618 HOH A O 4464 O O . HOH E . ? 0.6108 0.4510 0.6523 0.1458 -0.1150 0.0609 619 HOH A O 4465 O O . HOH E . ? 0.6714 0.6820 0.7185 -0.0337 -0.0370 -0.0601 620 HOH A O 4466 O O . HOH E . ? 0.7580 0.7928 0.9206 -0.0212 0.0611 -0.0955 621 HOH A O 4467 O O . HOH E . ? 0.7702 0.4860 0.9088 0.0197 -0.0858 -0.0144 622 HOH A O 4468 O O . HOH E . ? 0.6620 0.5342 0.4585 0.0868 -0.0426 -0.1668 623 HOH A O 4469 O O . HOH E . ? 0.4519 0.4297 0.4538 -0.0345 -0.1187 -0.0008 624 HOH A O 4470 O O . HOH E . ? 0.8660 0.7958 0.8557 -0.0344 -0.1390 -0.0955 625 HOH A O 4471 O O . HOH E . ? 0.6399 0.9071 0.7704 0.0794 0.1063 -0.0078 626 HOH A O 4472 O O . HOH E . ? 0.4175 0.4047 0.5905 0.0684 -0.0512 0.2946 627 HOH A O 4473 O O . HOH E . ? 0.5009 0.5681 0.5073 -0.2257 -0.0353 0.0037 628 HOH A O 4474 O O . HOH E . ? 0.7494 0.6075 0.6607 0.0277 -0.0723 -0.2241 629 HOH A O 4475 O O . HOH E . ? 0.5484 0.8191 0.6431 -0.0614 -0.1252 -0.1443 630 HOH A O 4476 O O . HOH E . ? 0.5369 0.6075 0.4885 -0.1048 -0.0600 -0.0277 631 HOH A O 4477 O O . HOH E . ? 0.3698 0.5747 0.6472 0.0937 -0.0821 0.0351 632 HOH A O 4478 O O . HOH E . ? 0.7512 0.8053 0.6782 -0.0073 0.1233 0.0321 633 HOH A O 4479 O O . HOH E . ? 0.4946 0.6545 0.4961 0.0917 -0.2718 -0.2116 634 HOH A O 4480 O O . HOH E . ? 0.8539 0.6325 0.5597 0.0859 -0.1174 0.1316 635 HOH A O 4481 O O . HOH E . ? 0.7095 0.4677 0.3297 0.2128 -0.0159 0.1093 636 HOH A O 4482 O O . HOH E . ? 0.7430 0.6011 0.7543 -0.3444 -0.0767 -0.1125 637 HOH A O 4483 O O . HOH E . ? 0.6482 0.5346 0.4750 0.0634 0.0182 -0.0017 638 HOH A O 4484 O O . HOH E . ? 0.6324 0.5451 0.4665 -0.0673 0.0534 -0.1665 639 HOH A O 4485 O O . HOH E . ? 0.4339 0.4938 0.3719 -0.0497 0.0696 -0.0584 640 HOH A O 4486 O O . HOH E . ? 0.8511 0.6940 0.7993 0.0035 -0.0212 0.0807 641 HOH A O 4487 O O . HOH E . ? 0.2561 0.4881 0.4850 0.0288 -0.0228 0.1496 642 HOH A O 4488 O O . HOH E . ? 0.5750 0.5487 0.4999 0.0278 -0.0624 -0.0339 643 HOH A O 4489 O O . HOH E . ? 0.6559 0.5538 0.7363 0.0816 -0.0816 0.1106 644 HOH A O 4490 O O . HOH E . ? 0.4649 0.5134 0.5468 -0.0709 0.0326 -0.1153 645 HOH A O 4491 O O . HOH E . ? 0.6079 0.2736 0.6198 -0.0966 -0.0612 -0.0644 646 HOH A O 4492 O O . HOH E . ? 0.7232 0.5785 0.7052 0.1189 -0.0454 0.0176 647 HOH A O 4493 O O . HOH E . ? 0.4519 0.4147 0.4725 -0.0434 0.0510 0.1097 648 HOH A O 4494 O O . HOH E . ? 0.5915 0.5298 0.5607 0.1245 0.0612 0.1203 649 HOH A O 4495 O O . HOH E . ? 0.6932 0.7635 0.5990 -0.1835 0.2738 0.0872 650 HOH A O 4496 O O . HOH E . ? 0.6709 0.5834 0.7557 0.0033 0.0544 -0.0814 651 HOH A O 4497 O O . HOH E . ? 0.6387 0.5931 0.5370 -0.0413 0.0888 0.1823 652 HOH A O 4498 O O . HOH E . ? 0.6815 0.7483 0.5653 -0.0432 0.1354 0.1949 653 HOH A O 4499 O O . HOH E . ? 0.6509 0.7029 0.7270 0.0286 -0.1547 -0.0216 654 HOH A O 4500 O O . HOH E . ? 0.7420 0.6711 0.6116 0.0145 -0.0017 0.1071 655 HOH A O 4501 O O . HOH E . ? 0.7498 0.7035 0.7724 -0.0733 -0.0587 0.1457 656 HOH A O 4502 O O . HOH E . ? 0.6535 0.7650 0.5689 0.0995 0.1906 -0.0245 657 HOH A O 4503 O O . HOH E . ? 0.6226 0.6478 0.7100 -0.0897 -0.1111 0.0737 658 HOH A O 4504 O O . HOH F . ? 0.5916 0.6446 0.6538 -0.2018 -0.1900 -0.0071 301 HOH B O 4505 O O . HOH F . ? 0.4639 0.4085 0.4247 -0.0187 0.2061 -0.2487 302 HOH B O 4506 O O . HOH F . ? 0.1913 0.1246 0.1974 -0.0092 -0.0331 0.0140 303 HOH B O 4507 O O . HOH F . ? 0.1478 0.1252 0.1090 -0.0225 -0.0395 0.0087 304 HOH B O 4508 O O . HOH F . ? 0.4028 0.3053 0.2189 -0.1134 -0.0403 0.0254 305 HOH B O 4509 O O . HOH F . ? 0.1799 0.1592 0.4346 0.0075 -0.1162 0.0189 306 HOH B O 4510 O O . HOH F . ? 0.1285 0.2681 0.1759 -0.0177 -0.0226 0.0075 307 HOH B O 4511 O O . HOH F . ? 0.3190 0.3448 0.1637 -0.0493 -0.0935 0.1050 308 HOH B O 4512 O O . HOH F . ? 0.1138 0.1559 0.1620 -0.0093 -0.0094 0.0256 309 HOH B O 4513 O O . HOH F . ? 0.1900 0.1614 0.1738 -0.0157 -0.0599 -0.0237 310 HOH B O 4514 O O . HOH F . ? 0.3362 0.1884 0.0970 -0.1071 -0.0872 0.0477 311 HOH B O 4515 O O . HOH F . ? 0.2620 0.1879 0.1705 -0.0622 -0.0871 0.0376 312 HOH B O 4516 O O . HOH F . ? 0.2703 0.1799 0.2683 0.0003 0.0105 0.0905 313 HOH B O 4517 O O . HOH F . ? 0.1803 0.1407 0.1003 -0.0390 -0.0528 0.0303 314 HOH B O 4518 O O . HOH F . ? 0.1440 0.2680 0.2276 -0.0505 -0.0019 -0.0342 315 HOH B O 4519 O O . HOH F . ? 0.2275 0.1924 0.1838 -0.0256 -0.0082 0.0249 316 HOH B O 4520 O O . HOH F . ? 0.2594 0.1903 0.1402 -0.0963 -0.0752 0.0094 317 HOH B O 4521 O O . HOH F . ? 0.1230 0.1290 0.1645 0.0038 -0.0028 0.0073 318 HOH B O 4522 O O . HOH F . ? 0.2082 0.2029 0.1980 -0.0411 0.0262 -0.0376 319 HOH B O 4523 O O . HOH F . ? 0.3732 0.2046 0.1354 -0.0950 -0.1000 0.0428 320 HOH B O 4524 O O . HOH F . ? 0.3243 0.3818 0.1728 0.0906 -0.0721 0.0647 321 HOH B O 4525 O O . HOH F . ? 0.3903 0.3242 0.1845 -0.0019 0.0576 0.0454 322 HOH B O 4526 O O . HOH F . ? 0.2308 0.2265 0.2995 0.0043 -0.0144 0.0879 323 HOH B O 4527 O O . HOH F . ? 0.2381 0.2481 0.2683 0.0073 0.0587 -0.0156 324 HOH B O 4528 O O . HOH F . ? 0.2706 0.2718 0.2876 -0.0217 0.0493 0.0630 325 HOH B O 4529 O O . HOH F . ? 0.5611 0.7282 0.2814 -0.0504 0.1772 0.2148 326 HOH B O 4530 O O . HOH F . ? 0.2636 0.2164 0.2081 -0.0262 0.0130 -0.0533 327 HOH B O 4531 O O . HOH F . ? 0.2070 0.1567 0.1887 -0.0349 -0.0138 0.0008 328 HOH B O 4532 O O . HOH F . ? 0.1411 0.2012 0.4641 0.0152 0.0199 0.0305 329 HOH B O 4533 O O . HOH F . ? 0.2744 0.2041 0.2681 -0.0645 -0.0977 0.0709 330 HOH B O 4534 O O . HOH F . ? 0.2604 0.1923 0.2613 0.0024 0.0510 0.0258 331 HOH B O 4535 O O . HOH F . ? 0.2334 0.3936 0.1593 -0.0644 0.0141 -0.0958 332 HOH B O 4536 O O . HOH F . ? 0.2047 0.3514 0.3384 0.0261 0.0403 -0.0483 333 HOH B O 4537 O O . HOH F . ? 0.3754 0.1480 0.2010 -0.0246 -0.0797 0.0802 334 HOH B O 4538 O O . HOH F . ? 0.3630 0.2441 0.3022 -0.0485 -0.0456 -0.0472 335 HOH B O 4539 O O . HOH F . ? 0.3093 0.2383 0.2799 -0.1020 -0.0080 0.0014 336 HOH B O 4540 O O . HOH F . ? 0.3199 0.2266 0.4560 0.1026 0.1116 0.0646 337 HOH B O 4541 O O . HOH F . ? 0.2490 0.1945 0.2385 -0.0103 -0.0105 -0.0238 338 HOH B O 4542 O O . HOH F . ? 0.2358 0.1836 0.3910 -0.0355 0.0250 0.0051 339 HOH B O 4543 O O . HOH F . ? 0.2096 0.2253 0.2259 -0.0871 0.0266 -0.0038 340 HOH B O 4544 O O . HOH F . ? 0.1665 0.2843 0.4712 -0.0556 -0.0010 -0.0632 341 HOH B O 4545 O O . HOH F . ? 0.4465 0.2518 0.3384 0.0990 -0.0419 -0.0086 342 HOH B O 4546 O O . HOH F . ? 0.2176 0.2665 0.2626 -0.0290 -0.0034 0.0456 343 HOH B O 4547 O O . HOH F . ? 0.3340 0.3441 0.3543 0.0165 -0.0944 0.0349 344 HOH B O 4548 O O . HOH F . ? 0.3863 0.3428 0.3969 -0.1114 -0.1015 0.0557 345 HOH B O 4549 O O . HOH F . ? 0.2635 0.4743 0.3523 0.0038 0.0211 -0.0243 346 HOH B O 4550 O O . HOH F . ? 0.1866 0.4272 0.2558 -0.0013 -0.0541 0.0037 347 HOH B O 4551 O O . HOH F . ? 0.4065 0.2066 0.4103 -0.0233 -0.0187 -0.1091 348 HOH B O 4552 O O . HOH F . ? 0.3819 0.1850 0.1752 0.0443 0.0431 -0.0269 349 HOH B O 4553 O O . HOH F . ? 0.4757 0.4293 0.2395 -0.1938 0.0694 -0.0157 350 HOH B O 4554 O O . HOH F . ? 0.3038 0.2449 0.1811 -0.0847 0.0238 -0.0215 351 HOH B O 4555 O O . HOH F . ? 0.3133 0.1829 0.1466 -0.0031 0.0030 0.0463 352 HOH B O 4556 O O . HOH F . ? 0.2448 0.2024 0.1846 -0.0529 0.0000 0.0070 353 HOH B O 4557 O O . HOH F . ? 0.5846 0.4895 0.2477 -0.1542 -0.0859 -0.1415 354 HOH B O 4558 O O . HOH F . ? 0.2113 0.3146 0.4321 0.0275 0.0470 -0.1473 355 HOH B O 4559 O O . HOH F . ? 0.4174 0.2002 0.2219 0.0117 0.0407 -0.0516 356 HOH B O 4560 O O . HOH F . ? 0.2662 0.2213 0.2636 0.0827 -0.1204 0.0069 357 HOH B O 4561 O O . HOH F . ? 0.2382 0.4027 0.1919 -0.1253 -0.0047 0.0511 358 HOH B O 4562 O O . HOH F . ? 0.1517 0.2323 0.6294 -0.0265 0.1646 0.0006 359 HOH B O 4563 O O . HOH F . ? 0.3788 0.2753 0.3141 -0.0580 -0.0315 -0.0825 360 HOH B O 4564 O O . HOH F . ? 0.4967 0.5055 0.1712 0.1009 0.0469 0.1321 361 HOH B O 4565 O O . HOH F . ? 0.2695 0.2476 0.3449 -0.0634 -0.0482 -0.0566 362 HOH B O 4566 O O . HOH F . ? 0.1478 0.3355 0.4469 -0.0165 -0.0664 -0.0485 363 HOH B O 4567 O O . HOH F . ? 0.2048 0.2904 0.2356 -0.0949 0.0201 0.0115 364 HOH B O 4568 O O . HOH F . ? 0.1967 0.1945 0.4189 -0.0552 -0.0424 0.0238 365 HOH B O 4569 O O . HOH F . ? 0.2530 0.2851 0.3313 -0.0565 0.0150 0.0604 366 HOH B O 4570 O O . HOH F . ? 0.3607 0.3311 0.5169 0.0511 0.0117 0.0486 367 HOH B O 4571 O O . HOH F . ? 0.3246 0.1874 0.1768 -0.0520 0.0541 0.0030 368 HOH B O 4572 O O . HOH F . ? 0.1863 0.4307 0.3025 -0.0812 0.0371 -0.0056 369 HOH B O 4573 O O . HOH F . ? 0.3082 0.2782 0.1766 -0.1456 0.0361 -0.0535 370 HOH B O 4574 O O . HOH F . ? 0.4820 0.3991 0.4378 -0.2078 -0.2457 0.1366 371 HOH B O 4575 O O . HOH F . ? 0.2304 0.2720 0.1320 -0.0064 -0.0394 -0.0152 372 HOH B O 4576 O O . HOH F . ? 0.2175 0.3083 0.1841 -0.0587 0.0174 -0.0570 373 HOH B O 4577 O O . HOH F . ? 0.2271 0.3273 0.4143 0.0605 -0.0478 0.1372 374 HOH B O 4578 O O . HOH F . ? 0.1716 0.1496 0.1918 -0.0025 -0.0353 0.0185 375 HOH B O 4579 O O . HOH F . ? 0.1531 0.3819 0.2934 -0.0263 -0.0172 0.1231 376 HOH B O 4580 O O . HOH F . ? 0.4204 0.2383 0.2758 -0.0678 -0.0884 -0.0164 377 HOH B O 4581 O O . HOH F . ? 0.1373 0.1305 0.3244 0.0002 -0.0116 0.0287 378 HOH B O 4582 O O . HOH F . ? 0.3737 0.3032 0.3395 0.0746 -0.0816 0.1171 379 HOH B O 4583 O O . HOH F . ? 0.3768 0.6128 0.1890 -0.0791 0.0427 0.0727 380 HOH B O 4584 O O . HOH F . ? 0.3446 0.4283 0.4004 -0.0620 -0.0326 0.1195 381 HOH B O 4585 O O . HOH F . ? 0.2156 0.1444 0.3165 -0.0088 -0.0706 -0.0130 382 HOH B O 4586 O O . HOH F . ? 0.3053 0.1977 0.1957 -0.0312 -0.0201 -0.0076 383 HOH B O 4587 O O . HOH F . ? 0.2911 0.3529 0.4273 -0.1609 0.1695 -0.0194 384 HOH B O 4588 O O . HOH F . ? 0.4239 0.2175 0.4415 -0.0002 0.0271 -0.0796 385 HOH B O 4589 O O . HOH F . ? 0.5641 0.2781 0.4209 -0.2048 -0.1344 0.1446 386 HOH B O 4590 O O . HOH F . ? 0.1921 0.3227 0.4700 0.0498 -0.0131 -0.1338 387 HOH B O 4591 O O . HOH F . ? 0.2597 0.2753 0.2200 -0.0536 -0.0835 0.0277 388 HOH B O 4592 O O . HOH F . ? 0.3214 0.3011 0.4263 0.0100 -0.0123 0.0375 389 HOH B O 4593 O O . HOH F . ? 0.2566 0.5179 0.4101 0.0009 -0.0863 0.0526 390 HOH B O 4594 O O . HOH F . ? 0.2881 0.2740 0.5654 -0.0010 -0.0760 -0.0952 391 HOH B O 4595 O O . HOH F . ? 0.7686 0.3714 0.3865 0.1973 -0.2028 0.0641 392 HOH B O 4596 O O . HOH F . ? 0.2639 0.4711 0.4631 -0.0618 -0.1219 0.1053 393 HOH B O 4597 O O . HOH F . ? 0.3080 0.2925 0.4033 0.0945 0.1563 -0.0162 394 HOH B O 4598 O O . HOH F . ? 0.3461 0.5872 0.3347 0.2179 0.0865 0.2606 395 HOH B O 4599 O O . HOH F . ? 0.4039 0.3777 0.2388 -0.1468 0.0708 0.0185 396 HOH B O 4600 O O . HOH F . ? 0.3565 0.3778 0.3333 0.0429 -0.1237 -0.0685 397 HOH B O 4601 O O . HOH F . ? 0.3071 0.1979 0.0928 -0.1315 -0.0280 -0.0218 398 HOH B O 4602 O O . HOH F . ? 0.2983 0.6179 0.4250 0.0783 0.1138 0.2167 399 HOH B O 4603 O O . HOH F . ? 0.5602 0.3950 0.4521 0.0049 -0.3489 0.0086 400 HOH B O 4604 O O . HOH F . ? 0.3188 0.4049 0.2910 -0.0958 0.0495 0.0121 401 HOH B O 4605 O O . HOH F . ? 0.1822 0.2437 0.3198 -0.0821 0.0174 0.0222 402 HOH B O 4606 O O . HOH F . ? 0.6617 0.3762 0.2331 -0.0910 -0.1402 0.1032 403 HOH B O 4607 O O . HOH F . ? 0.4149 0.3324 0.1654 -0.0781 -0.0824 0.0165 404 HOH B O 4608 O O . HOH F . ? 0.2642 0.1932 0.3611 0.0337 0.0550 0.0558 405 HOH B O 4609 O O . HOH F . ? 0.5320 0.2723 0.3332 -0.1338 0.0964 -0.1103 406 HOH B O 4610 O O . HOH F . ? 0.2040 0.2158 0.1846 -0.0054 -0.0292 0.0410 407 HOH B O 4611 O O . HOH F . ? 0.2203 0.2912 0.2380 -0.0585 0.0457 0.0377 408 HOH B O 4612 O O . HOH F . ? 0.4460 0.2787 0.1883 0.0011 0.0270 0.0431 409 HOH B O 4613 O O . HOH F . ? 0.3195 0.2987 0.5407 -0.0414 -0.0291 -0.1735 410 HOH B O 4614 O O . HOH F . ? 0.3855 0.2196 0.3499 0.0779 -0.0302 0.0574 411 HOH B O 4615 O O . HOH F . ? 0.3729 0.3169 0.3553 0.0025 0.1546 0.0966 412 HOH B O 4616 O O . HOH F . ? 0.5014 0.5020 0.4756 0.1262 0.0846 0.2913 413 HOH B O 4617 O O . HOH F . ? 0.4322 0.6692 0.2436 -0.0099 0.1379 0.0558 414 HOH B O 4618 O O . HOH F . ? 0.4827 0.3711 0.2644 -0.0700 -0.1558 -0.0041 415 HOH B O 4619 O O . HOH F . ? 0.3931 0.1900 0.3064 -0.0814 0.0037 -0.0252 416 HOH B O 4620 O O . HOH F . ? 0.2143 0.2371 0.2409 -0.0225 -0.0292 0.0393 417 HOH B O 4621 O O . HOH F . ? 0.5421 0.3494 0.3180 -0.0450 -0.1912 -0.0814 418 HOH B O 4622 O O . HOH F . ? 0.1844 0.2668 0.3199 -0.0220 0.0396 0.0334 419 HOH B O 4623 O O . HOH F . ? 0.5991 0.3388 0.3629 0.1050 0.0381 0.1287 420 HOH B O 4624 O O . HOH F . ? 0.4599 0.4585 0.4900 -0.0693 0.0468 0.1737 421 HOH B O 4625 O O . HOH F . ? 0.6696 0.4003 0.2774 0.0450 0.0826 0.1074 422 HOH B O 4626 O O . HOH F . ? 0.4869 0.4062 0.2711 -0.2173 -0.1687 0.0910 423 HOH B O 4627 O O . HOH F . ? 0.3208 0.2996 0.2560 -0.1021 -0.0565 -0.1136 424 HOH B O 4628 O O . HOH F . ? 0.2153 0.2973 0.4518 0.0363 0.0145 0.1091 425 HOH B O 4629 O O . HOH F . ? 0.6377 0.7859 0.6545 0.0474 0.0281 0.0696 426 HOH B O 4630 O O . HOH F . ? 0.3176 0.2719 0.1695 -0.0875 -0.0519 0.0410 427 HOH B O 4631 O O . HOH F . ? 0.3075 0.3645 0.2327 -0.0882 -0.0205 0.0599 428 HOH B O 4632 O O . HOH F . ? 0.3594 0.6659 0.2792 -0.0070 -0.0033 0.2569 429 HOH B O 4633 O O . HOH F . ? 0.2878 0.3876 0.3526 -0.0602 -0.0860 0.0035 430 HOH B O 4634 O O . HOH F . ? 0.1794 0.4316 0.1533 -0.0302 -0.0024 0.0569 431 HOH B O 4635 O O . HOH F . ? 0.2752 0.2394 0.2673 -0.0257 -0.0560 0.0082 432 HOH B O 4636 O O . HOH F . ? 0.4133 0.3617 0.2629 -0.1255 -0.1086 0.1510 433 HOH B O 4637 O O . HOH F . ? 0.2269 0.3394 0.5161 0.0908 -0.1433 -0.0037 434 HOH B O 4638 O O . HOH F . ? 0.5745 0.3702 0.3395 0.2339 0.2131 0.1530 435 HOH B O 4639 O O . HOH F . ? 0.5271 0.2473 0.3231 0.1426 -0.0191 0.1398 436 HOH B O 4640 O O . HOH F . ? 0.5078 0.4902 0.4947 -0.1251 0.0517 -0.0622 437 HOH B O 4641 O O . HOH F . ? 0.2889 0.1822 0.2732 0.0126 0.0228 -0.0628 438 HOH B O 4642 O O . HOH F . ? 0.4765 0.5148 0.5214 0.0354 0.1614 0.1402 439 HOH B O 4643 O O . HOH F . ? 0.5884 0.5493 0.4524 -0.1772 -0.1536 0.2763 440 HOH B O 4644 O O . HOH F . ? 0.5416 0.3627 0.2763 0.1669 -0.1003 0.0089 441 HOH B O 4645 O O . HOH F . ? 0.2995 0.4801 0.4360 0.0342 0.0444 0.0203 442 HOH B O 4646 O O . HOH F . ? 0.4272 0.4078 0.1911 -0.1491 -0.1810 0.0000 443 HOH B O 4647 O O . HOH F . ? 0.5937 0.3309 0.3612 0.1141 -0.2502 -0.1154 444 HOH B O 4648 O O . HOH F . ? 0.4550 0.2911 0.4207 0.1242 0.1730 0.0718 445 HOH B O 4649 O O . HOH F . ? 0.4599 0.2970 0.4920 0.0198 -0.1065 -0.1536 446 HOH B O 4650 O O . HOH F . ? 0.6186 0.5592 0.5959 -0.0807 0.0933 -0.1447 447 HOH B O 4651 O O . HOH F . ? 0.5342 0.4153 0.5516 -0.0030 -0.0925 0.1735 448 HOH B O 4652 O O . HOH F . ? 0.4154 0.5190 0.3585 0.1606 -0.1535 -0.0109 449 HOH B O 4653 O O . HOH F . ? 0.4243 0.3545 0.2588 -0.1264 -0.1168 0.1584 450 HOH B O 4654 O O . HOH F . ? 0.5484 0.5099 0.4497 0.0175 0.1137 -0.0818 451 HOH B O 4655 O O . HOH F . ? 0.3988 0.7116 0.4700 -0.1855 -0.1433 -0.0425 452 HOH B O 4656 O O . HOH F . ? 0.5279 0.3821 0.4542 -0.1583 0.0406 -0.1682 453 HOH B O 4657 O O . HOH F . ? 0.5618 0.1722 0.5796 0.0089 -0.0673 0.1131 454 HOH B O 4658 O O . HOH F . ? 0.2608 0.4350 0.3716 0.0127 0.0295 0.0846 455 HOH B O 4659 O O . HOH F . ? 0.3157 0.4357 0.4269 0.0731 -0.0119 0.1252 456 HOH B O 4660 O O . HOH F . ? 0.2019 0.4016 0.6285 -0.0231 -0.0512 0.2447 457 HOH B O 4661 O O . HOH F . ? 0.3286 0.3129 0.3488 0.1107 0.0306 0.0570 458 HOH B O 4662 O O . HOH F . ? 0.5246 0.4783 0.3834 -0.0358 0.0050 0.1234 459 HOH B O 4663 O O . HOH F . ? 0.2604 0.2331 0.2624 0.0048 -0.0031 0.0036 460 HOH B O 4664 O O . HOH F . ? 0.5279 0.5172 0.3368 -0.1333 0.1985 0.0313 461 HOH B O 4665 O O . HOH F . ? 0.7571 0.5738 0.3126 0.0768 -0.0618 -0.0046 462 HOH B O 4666 O O . HOH F . ? 0.4199 0.5850 0.5433 0.1248 0.0417 -0.0452 463 HOH B O 4667 O O . HOH F . ? 0.3206 0.3339 0.4076 0.0836 -0.1507 -0.1995 464 HOH B O 4668 O O . HOH F . ? 0.3077 0.4101 0.3133 -0.0721 -0.0994 0.1009 465 HOH B O 4669 O O . HOH F . ? 0.2330 0.3690 0.3273 -0.0750 -0.0844 0.0936 466 HOH B O 4670 O O . HOH F . ? 0.1819 0.1454 0.2359 -0.0056 -0.0449 0.0161 467 HOH B O 4671 O O . HOH F . ? 0.2172 0.2307 0.1912 -0.0757 0.0268 0.0143 468 HOH B O 4672 O O . HOH F . ? 0.5398 0.4387 0.2529 0.0316 -0.0326 -0.0608 469 HOH B O 4673 O O . HOH F . ? 0.2930 0.4036 0.1800 -0.0669 -0.1042 0.0973 470 HOH B O 4674 O O . HOH F . ? 0.3771 0.4539 0.2018 -0.1835 -0.1426 0.0719 471 HOH B O 4675 O O . HOH F . ? 0.2300 0.1764 0.1933 -0.0062 -0.0437 0.0072 472 HOH B O 4676 O O . HOH F . ? 0.2225 0.2300 0.2181 0.0085 -0.0480 0.0626 473 HOH B O 4677 O O . HOH F . ? 0.3655 0.4027 0.1663 0.2385 -0.0006 0.0515 474 HOH B O 4678 O O . HOH F . ? 0.6212 0.4648 0.5904 0.2483 0.1060 0.0344 475 HOH B O 4679 O O . HOH F . ? 0.5790 0.6305 0.3943 -0.0533 0.2098 -0.0562 476 HOH B O 4680 O O . HOH F . ? 0.2844 0.5608 0.5701 0.0558 0.0729 -0.0701 477 HOH B O 4681 O O . HOH F . ? 0.3994 0.5029 0.2288 -0.0045 -0.0054 0.1138 478 HOH B O 4682 O O . HOH F . ? 0.3705 0.2737 0.3668 0.0528 -0.0017 -0.1180 479 HOH B O 4683 O O . HOH F . ? 0.4131 0.3900 0.4057 -0.0334 -0.0522 -0.1096 480 HOH B O 4684 O O . HOH F . ? 0.3013 0.1707 0.1655 0.0080 -0.0752 0.0433 481 HOH B O 4685 O O . HOH F . ? 0.2638 0.4856 0.4590 0.0831 0.0677 0.2594 482 HOH B O 4686 O O . HOH F . ? 0.5162 0.4876 0.3748 -0.0023 0.0724 -0.0295 483 HOH B O 4687 O O . HOH F . ? 0.2759 0.4486 0.2928 0.0369 -0.0549 -0.0911 484 HOH B O 4688 O O . HOH F . ? 0.2580 0.2769 0.3184 0.0400 0.0076 0.0533 485 HOH B O 4689 O O . HOH F . ? 0.6368 0.2932 0.4114 0.1324 0.1633 -0.0152 486 HOH B O 4690 O O . HOH F . ? 0.2062 0.4431 0.4581 -0.0626 0.0466 -0.0613 487 HOH B O 4691 O O . HOH F . ? 0.5177 0.2372 0.5025 0.0140 0.1225 0.0076 488 HOH B O 4692 O O . HOH F . ? 0.3219 0.3110 0.3228 0.0066 -0.0209 0.0656 489 HOH B O 4693 O O . HOH F . ? 0.5221 0.4232 0.3058 0.1522 -0.1672 -0.0328 490 HOH B O 4694 O O . HOH F . ? 0.2988 0.4585 0.2172 -0.1404 0.0446 0.1330 491 HOH B O 4695 O O . HOH F . ? 0.2903 0.4232 0.3816 -0.1404 -0.1895 0.2206 492 HOH B O 4696 O O . HOH F . ? 0.6472 0.5436 0.5876 0.0960 0.0477 -0.0780 493 HOH B O 4697 O O . HOH F . ? 0.5548 0.4018 0.2983 -0.2343 -0.0209 -0.0626 494 HOH B O 4698 O O . HOH F . ? 0.4832 0.3442 0.3870 -0.1067 0.0529 0.0571 495 HOH B O 4699 O O . HOH F . ? 0.4196 0.6426 0.3033 -0.0321 -0.0358 0.0356 496 HOH B O 4700 O O . HOH F . ? 0.3060 0.5007 0.6030 0.1358 -0.0256 -0.0302 497 HOH B O 4701 O O . HOH F . ? 0.2375 0.3024 0.4974 -0.0464 0.0953 -0.0835 498 HOH B O 4702 O O . HOH F . ? 0.3299 0.3794 0.3593 -0.0372 0.0121 -0.0209 499 HOH B O 4703 O O . HOH F . ? 0.3907 0.2091 0.2876 -0.0307 0.0631 0.0059 500 HOH B O 4704 O O . HOH F . ? 0.3742 0.5131 0.2046 -0.1830 -0.0970 0.0470 501 HOH B O 4705 O O . HOH F . ? 0.3951 0.2837 0.2696 -0.0678 0.0290 -0.0084 502 HOH B O 4706 O O . HOH F . ? 0.3841 0.4663 0.4819 -0.0788 0.0141 -0.1329 503 HOH B O 4707 O O . HOH F . ? 0.4693 0.4112 0.3743 0.0014 0.0737 0.1446 504 HOH B O 4708 O O . HOH F . ? 0.3946 0.3710 0.3200 -0.0219 -0.1246 0.0224 505 HOH B O 4709 O O . HOH F . ? 0.6245 0.4329 0.6374 -0.2522 -0.0495 0.0563 506 HOH B O 4710 O O . HOH F . ? 0.5598 0.3832 0.4197 0.0026 -0.2846 0.0546 507 HOH B O 4711 O O . HOH F . ? 0.5538 0.5093 0.5201 0.2872 -0.1159 -0.0901 508 HOH B O 4712 O O . HOH F . ? 0.4154 0.2068 0.2873 -0.0328 -0.0780 -0.0612 509 HOH B O 4713 O O . HOH F . ? 0.7050 0.4953 0.4608 0.0845 -0.0999 0.1338 510 HOH B O 4714 O O . HOH F . ? 0.3329 0.7006 0.4910 -0.0115 -0.0053 0.1079 511 HOH B O 4715 O O . HOH F . ? 0.4538 0.1826 0.5393 0.0394 -0.0935 -0.1237 512 HOH B O 4716 O O . HOH F . ? 0.4990 0.5705 0.4260 0.0302 -0.2202 0.0641 513 HOH B O 4717 O O . HOH F . ? 0.5477 0.1825 0.2110 -0.0598 0.0575 -0.0739 514 HOH B O 4718 O O . HOH F . ? 0.5635 0.6715 0.7192 -0.1481 0.0467 0.0443 515 HOH B O 4719 O O . HOH F . ? 0.3330 0.2383 0.4442 -0.0427 -0.0372 -0.1001 516 HOH B O 4720 O O . HOH F . ? 0.4561 0.4642 0.2600 -0.0950 -0.1307 -0.0015 517 HOH B O 4721 O O . HOH F . ? 0.4705 0.6458 0.2441 -0.0252 0.0729 -0.1282 518 HOH B O 4722 O O . HOH F . ? 0.3518 0.4691 0.5414 0.1858 -0.0578 0.0117 519 HOH B O 4723 O O . HOH F . ? 0.4254 0.5555 0.4981 0.0336 -0.0333 0.0676 520 HOH B O 4724 O O . HOH F . ? 0.4878 0.4223 0.5075 -0.2030 -0.1068 0.1459 521 HOH B O 4725 O O . HOH F . ? 0.6332 0.5443 0.4538 -0.0897 -0.0019 0.0780 522 HOH B O 4726 O O . HOH F . ? 0.3322 0.4925 0.4289 -0.0730 -0.1504 0.0594 523 HOH B O 4727 O O . HOH F . ? 0.5130 0.3543 0.5184 0.0196 -0.1251 -0.1717 524 HOH B O 4728 O O . HOH F . ? 0.5201 0.5830 0.7110 -0.0887 0.0341 0.2064 525 HOH B O 4729 O O . HOH F . ? 0.3624 0.4853 0.3400 0.0181 -0.0750 0.1187 526 HOH B O 4730 O O . HOH F . ? 0.3072 0.3361 0.5574 -0.0046 0.1468 -0.0847 527 HOH B O 4731 O O . HOH F . ? 0.4402 0.5968 0.6083 0.1308 0.1438 -0.1531 528 HOH B O 4732 O O . HOH F . ? 0.4936 0.5220 0.3946 -0.1375 0.1497 0.0416 529 HOH B O 4733 O O . HOH F . ? 0.2646 0.3313 0.3689 -0.1210 -0.0416 -0.0964 530 HOH B O 4734 O O . HOH F . ? 0.2847 0.3608 0.6117 0.0292 0.0089 0.0993 531 HOH B O 4735 O O . HOH F . ? 0.4097 0.5203 0.3951 -0.1298 0.0973 -0.0255 532 HOH B O 4736 O O . HOH F . ? 0.2929 0.6533 0.4607 0.0781 0.1608 0.0159 533 HOH B O 4737 O O . HOH F . ? 0.6334 0.4672 0.4633 0.0883 0.1009 0.0544 534 HOH B O 4738 O O . HOH F . ? 0.4514 0.2915 0.5180 0.0009 0.0893 -0.1610 535 HOH B O 4739 O O . HOH F . ? 0.7113 0.7352 0.7489 0.0432 -0.0883 -0.0028 536 HOH B O 4740 O O . HOH F . ? 0.6174 0.2197 0.4643 -0.0455 -0.1356 0.0487 537 HOH B O 4741 O O . HOH F . ? 0.6125 0.6311 0.6388 0.1596 -0.0274 -0.1576 538 HOH B O 4742 O O . HOH F . ? 0.3058 0.2981 0.2361 -0.0430 0.0018 -0.0356 539 HOH B O 4743 O O . HOH F . ? 0.3868 0.3132 0.3283 0.0102 -0.1700 -0.1750 540 HOH B O 4744 O O . HOH F . ? 0.4432 0.3420 0.2251 -0.0234 0.0061 -0.0223 541 HOH B O 4745 O O . HOH F . ? 0.2255 0.3428 0.3517 0.0704 -0.0063 -0.0935 542 HOH B O 4746 O O . HOH F . ? 0.1400 0.2171 0.2991 -0.0188 -0.0056 0.0313 543 HOH B O 4747 O O . HOH F . ? 0.2800 0.2600 0.4010 0.0578 -0.0839 0.0373 544 HOH B O 4748 O O . HOH F . ? 0.2776 0.3849 0.3325 -0.1064 -0.0722 0.0706 545 HOH B O 4749 O O . HOH F . ? 0.2630 0.5786 0.4700 0.0150 0.0568 0.1488 546 HOH B O 4750 O O . HOH F . ? 0.4715 0.4717 0.3310 0.0902 -0.0059 -0.0122 547 HOH B O 4751 O O . HOH F . ? 0.6239 0.5972 0.5469 -0.0048 -0.0486 0.0854 548 HOH B O 4752 O O . HOH F . ? 0.5365 0.5594 0.5525 0.0233 -0.1943 -0.0122 549 HOH B O 4753 O O . HOH F . ? 0.2468 0.2111 0.7114 0.0342 0.0228 -0.1120 550 HOH B O 4754 O O . HOH F . ? 0.6476 0.2398 0.5191 -0.0212 -0.1747 0.1210 551 HOH B O 4755 O O . HOH F . ? 0.3542 0.2993 0.4829 -0.0222 -0.0619 -0.0066 552 HOH B O 4756 O O . HOH F . ? 0.4378 0.5337 0.3841 -0.0890 -0.1137 0.2309 553 HOH B O 4757 O O . HOH F . ? 0.3995 0.5550 0.2475 0.1248 0.1035 0.0411 554 HOH B O 4758 O O . HOH F . ? 0.7547 0.4664 0.6316 0.3143 -0.1672 0.0892 555 HOH B O 4759 O O . HOH F . ? 0.6015 0.5710 0.6891 -0.1074 -0.1583 0.1086 556 HOH B O 4760 O O . HOH F . ? 0.3363 0.3858 0.6816 -0.0377 0.0767 0.0759 557 HOH B O 4761 O O . HOH F . ? 0.8574 0.7889 0.6343 0.2206 0.0736 -0.0641 558 HOH B O 4762 O O . HOH F . ? 0.4684 0.2212 0.5530 -0.1219 0.1119 -0.0870 559 HOH B O 4763 O O . HOH F . ? 0.5599 0.4889 0.5525 0.0235 -0.0460 -0.0544 560 HOH B O 4764 O O . HOH F . ? 0.4820 0.4883 0.3733 -0.1365 -0.1172 0.1065 561 HOH B O 4765 O O . HOH F . ? 0.2990 0.3222 0.5113 0.0018 -0.0433 -0.1242 562 HOH B O 4766 O O . HOH F . ? 0.4138 0.5311 0.4890 -0.2131 -0.0861 0.0221 563 HOH B O 4767 O O . HOH F . ? 0.6612 0.3623 0.5352 -0.0097 -0.2402 -0.0076 564 HOH B O 4768 O O . HOH F . ? 0.4337 0.5646 0.3205 -0.0491 -0.0174 -0.0908 565 HOH B O 4769 O O . HOH F . ? 0.7487 0.6095 0.5564 0.0473 -0.0140 -0.0309 566 HOH B O 4770 O O . HOH F . ? 0.5065 0.6359 0.7213 0.1612 0.0578 0.0327 567 HOH B O 4771 O O . HOH F . ? 0.6312 0.5781 0.3499 -0.0178 -0.1086 0.0450 568 HOH B O 4772 O O . HOH F . ? 0.5827 0.6428 0.2653 -0.1217 0.0488 0.0688 569 HOH B O 4773 O O . HOH F . ? 0.6884 0.5836 0.2748 -0.0559 -0.0221 0.0662 570 HOH B O 4774 O O . HOH F . ? 0.5228 0.4658 0.4160 -0.0125 -0.2080 0.0409 571 HOH B O 4775 O O . HOH F . ? 0.6754 0.4719 0.4362 -0.0923 0.0537 0.0191 572 HOH B O 4776 O O . HOH F . ? 0.5568 0.4340 0.3738 -0.0340 0.0967 0.0378 573 HOH B O 4777 O O . HOH F . ? 0.6908 0.5938 0.5739 -0.0177 -0.1824 0.0421 574 HOH B O 4778 O O . HOH F . ? 0.7217 0.7154 0.7041 0.0082 -0.0577 0.0139 575 HOH B O 4779 O O . HOH F . ? 0.5427 0.5960 0.4833 0.1556 -0.1354 0.1201 576 HOH B O 4780 O O . HOH F . ? 0.7818 0.7625 0.7370 -0.0411 0.0090 0.0888 577 HOH B O 4781 O O . HOH F . ? 0.7299 0.3847 0.3692 0.0278 -0.1692 -0.0526 578 HOH B O 4782 O O . HOH F . ? 0.5857 0.6133 0.3446 -0.0798 -0.0197 -0.0702 579 HOH B O 4783 O O . HOH F . ? 0.6318 0.6708 0.6294 0.0919 -0.0224 -0.0651 580 HOH B O 4784 O O . HOH F . ? 0.3939 0.5290 0.3089 0.0083 0.0212 0.0537 581 HOH B O 4785 O O . HOH F . ? 0.2471 0.3867 0.5294 0.0485 0.0143 0.1321 582 HOH B O 4786 O O . HOH F . ? 0.5341 0.5321 0.4996 0.0258 0.0279 0.0526 583 HOH B O 4787 O O . HOH F . ? 0.7068 0.6392 0.6150 0.0467 0.1021 -0.1175 584 HOH B O 4788 O O . HOH F . ? 0.7543 0.6730 0.5239 -0.1150 -0.1789 -0.0704 585 HOH B O 4789 O O . HOH F . ? 0.4791 0.5546 0.5253 -0.1751 -0.0106 0.1539 586 HOH B O 4790 O O . HOH F . ? 0.6852 0.6936 0.4568 0.0756 -0.0833 -0.1256 587 HOH B O 4791 O O . HOH F . ? 0.4138 0.8341 0.6761 0.2207 0.1926 -0.0877 588 HOH B O 4792 O O . HOH F . ? 0.3751 0.4014 0.4373 0.0407 -0.0205 0.1857 589 HOH B O 4793 O O . HOH F . ? 0.4424 0.4958 0.5596 0.2567 -0.1626 -0.0147 590 HOH B O 4794 O O . HOH F . ? 0.5999 0.3913 0.2431 -0.0425 0.0146 -0.0843 591 HOH B O 4795 O O . HOH F . ? 0.3439 0.5178 0.5814 -0.0059 0.0105 0.1185 592 HOH B O 4796 O O . HOH F . ? 0.4509 0.4867 0.4843 -0.1305 0.0133 0.0709 593 HOH B O 4797 O O . HOH F . ? 0.3943 0.5377 0.3851 -0.0072 0.1307 -0.0647 594 HOH B O 4798 O O . HOH F . ? 0.4183 0.3702 0.5054 -0.1447 -0.0803 -0.0381 595 HOH B O 4799 O O . HOH F . ? 0.5561 0.4933 0.6266 -0.1098 -0.0702 0.1154 596 HOH B O 4800 O O . HOH F . ? 0.3474 0.5815 0.4918 0.1915 -0.0327 0.1353 597 HOH B O 4801 O O . HOH F . ? 0.5825 0.3932 0.4884 0.0714 -0.1751 -0.0790 598 HOH B O 4802 O O . HOH F . ? 0.3073 0.3617 0.4595 -0.0112 -0.1248 0.0611 599 HOH B O 4803 O O . HOH F . ? 0.5528 0.3615 0.6639 -0.2173 0.0622 0.0817 600 HOH B O 4804 O O . HOH F . ? 0.6052 0.6559 0.6530 0.1641 0.0422 -0.2192 601 HOH B O 4805 O O . HOH F . ? 0.4482 0.3401 0.5822 0.0588 -0.1148 -0.2033 602 HOH B O 4806 O O . HOH F . ? 0.3659 0.5801 0.5192 0.1112 -0.0934 -0.1656 603 HOH B O 4807 O O . HOH F . ? 0.4548 0.5269 0.7610 -0.1125 0.1785 0.0433 604 HOH B O 4808 O O . HOH F . ? 0.2735 0.5445 0.5942 -0.0623 -0.0842 0.0246 605 HOH B O 4809 O O . HOH F . ? 0.6192 0.7113 0.5057 0.0504 -0.1042 0.1110 606 HOH B O 4810 O O . HOH F . ? 0.8012 0.5485 0.5251 -0.0747 -0.2203 -0.1031 607 HOH B O 4811 O O . HOH F . ? 0.7997 0.7901 0.7461 0.1319 -0.0215 -0.0714 608 HOH B O 4812 O O . HOH F . ? 0.5712 0.7658 0.5924 -0.0128 0.0592 -0.0191 609 HOH B O 4813 O O . HOH F . ? 0.6518 0.3493 0.5145 0.1501 0.0389 0.1804 610 HOH B O 4814 O O . HOH F . ? 0.3545 0.5188 0.7080 0.1040 -0.0818 -0.0547 611 HOH B O 4815 O O . HOH F . ? 0.6755 0.5567 0.6325 -0.1657 0.0625 0.0643 612 HOH B O 4816 O O . HOH F . ? 0.5691 0.6118 0.5302 0.2101 -0.0220 0.0877 613 HOH B O 4817 O O . HOH F . ? 0.6890 0.4560 0.6121 0.0206 -0.0738 0.0750 614 HOH B O 4818 O O . HOH F . ? 0.7293 0.6698 0.6936 0.0299 -0.1803 0.1117 615 HOH B O 4819 O O . HOH F . ? 0.7200 0.5732 0.7058 0.0662 -0.0025 -0.1185 616 HOH B O 4820 O O . HOH F . ? 0.4826 0.4304 0.4263 -0.0626 0.0203 0.0954 617 HOH B O 4821 O O . HOH F . ? 0.5010 0.4965 0.4752 -0.0937 0.0413 0.1280 618 HOH B O 4822 O O . HOH F . ? 0.3913 0.3790 0.5131 0.0185 -0.0988 0.0364 619 HOH B O 4823 O O . HOH F . ? 0.5998 0.4768 0.6320 0.0620 0.1154 -0.1063 620 HOH B O 4824 O O . HOH F . ? 0.6931 0.5592 0.7963 -0.3075 -0.1083 0.1487 621 HOH B O 4825 O O . HOH F . ? 0.6697 0.5317 0.6060 0.1974 -0.1059 -0.1151 622 HOH B O 4826 O O . HOH F . ? 0.2889 0.4688 0.4957 -0.1655 -0.0606 0.0438 623 HOH B O 4827 O O . HOH F . ? 0.6301 0.6385 0.5716 0.0988 0.0738 -0.0842 624 HOH B O 4828 O O . HOH F . ? 0.7358 0.8571 0.7439 0.0786 -0.0259 -0.0958 625 HOH B O 4829 O O . HOH F . ? 0.5237 0.3829 0.5734 -0.0124 0.0314 -0.1300 626 HOH B O 4830 O O . HOH F . ? 0.3778 0.5042 0.4276 0.0880 0.0732 0.1019 627 HOH B O 4831 O O . HOH F . ? 0.5764 0.4168 0.6644 0.0630 -0.0045 0.1354 628 HOH B O 4832 O O . HOH F . ? 0.5480 0.5798 0.5628 -0.0227 0.0024 0.1965 629 HOH B O 4833 O O . HOH F . ? 0.4737 0.5900 0.6502 0.1318 0.0246 -0.0186 630 HOH B O 4834 O O . HOH F . ? 0.5338 0.7129 0.5546 0.0475 0.1599 -0.0005 631 HOH B O 4835 O O . HOH F . ? 0.4945 0.5025 0.4996 0.1750 -0.0425 0.1199 632 HOH B O 4836 O O . HOH F . ? 0.4272 0.6686 0.5393 0.1144 -0.1334 -0.1339 633 HOH B O 4837 O O . HOH F . ? 0.4473 0.5074 0.6332 0.2104 0.0968 0.0497 634 HOH B O 4838 O O . HOH F . ? 0.6166 0.4269 0.5567 0.1332 -0.1356 -0.0626 635 HOH B O 4839 O O . HOH F . ? 0.6611 0.5496 0.3934 0.1663 -0.0032 -0.1034 636 HOH B O 4840 O O . HOH F . ? 0.7467 0.4207 0.7067 0.0593 -0.0821 -0.0779 637 HOH B O 4841 O O . HOH F . ? 0.5609 0.6182 0.3553 -0.0851 -0.0170 -0.0610 638 HOH B O 4842 O O . HOH F . ? 0.6280 0.7362 0.5599 -0.0066 0.2091 0.1263 639 HOH B O 4843 O O . HOH F . ? 0.7803 0.6157 0.4669 -0.1025 0.0786 0.1718 640 HOH B O 4844 O O . HOH F . ? 0.6146 0.6456 0.7289 -0.0153 -0.1409 -0.0967 641 HOH B O 4845 O O . HOH F . ? 0.7462 0.5781 0.5193 -0.1853 0.0506 0.2551 642 HOH B O 4846 O O . HOH F . ? 0.4388 0.5279 0.5265 0.0201 0.0626 -0.1506 643 HOH B O 4847 O O . HOH F . ? 0.5401 0.4505 0.6420 0.0721 -0.0620 0.0028 644 HOH B O 4848 O O . HOH F . ? 0.5019 0.7293 0.5508 -0.0218 0.2403 -0.0596 645 HOH B O 4849 O O . HOH F . ? 0.9063 0.8951 0.8497 0.0279 -0.0689 -0.0442 646 HOH B O 4850 O O . HOH F . ? 0.3781 0.4583 0.7019 0.0072 0.0634 -0.1190 647 HOH B O 4851 O O . HOH F . ? 0.7875 0.6735 0.6774 -0.0293 -0.0594 -0.0747 648 HOH B O 4852 O O . HOH F . ? 0.3655 0.4892 0.3814 -0.1074 0.0972 0.0251 649 HOH B O 4853 O O . HOH F . ? 0.7166 0.6142 0.4799 0.0032 0.0322 -0.1796 650 HOH B O 4854 O O . HOH F . ? 0.5662 0.4859 0.3281 0.0854 -0.1773 0.1037 651 HOH B O 4855 O O . HOH F . ? 0.6066 0.3695 0.5188 -0.0461 -0.1611 0.0596 652 HOH B O 4856 O O . HOH F . ? 0.4687 0.6693 0.6082 0.1613 -0.1236 0.0508 653 HOH B O 4857 O O . HOH F . ? 0.6697 0.6283 0.4639 0.1159 -0.1775 0.0762 654 HOH B O 4858 O O . HOH F . ? 0.5573 0.7665 0.8035 0.1895 0.0898 -0.0934 655 HOH B O 4859 O O . HOH F . ? 0.7116 0.6214 0.3962 -0.2048 0.0101 -0.0619 656 HOH B O 4860 O O . HOH F . ? 0.7439 0.7117 0.6165 0.0030 -0.0165 -0.0435 657 HOH B O 4861 O O . HOH F . ? 0.4559 0.5924 0.5464 0.0876 -0.0450 0.0740 658 HOH B O 4862 O O . HOH F . ? 0.1762 0.2149 0.1497 -0.0707 -0.0117 0.0477 659 HOH B O 4863 O O . HOH F . ? 0.7015 0.6537 0.8032 0.1853 -0.1447 -0.0925 660 HOH B O 4864 O O . HOH F . ? 0.4175 0.4348 0.6412 -0.0003 -0.0275 0.0122 661 HOH B O 4865 O O . HOH F . ? 0.5286 0.4854 0.5975 0.0393 -0.0735 -0.0420 662 HOH B O 4866 O O . HOH F . ? 0.6845 0.7545 0.6176 0.1856 0.1848 -0.0666 663 HOH B O 4867 O O . HOH F . ? 0.6597 0.6948 0.4101 -0.0114 -0.0365 0.0557 664 HOH B O 4868 O O . HOH F . ? 0.6001 0.5765 0.7016 0.1612 -0.0417 0.0173 665 HOH B O 4869 O O . HOH F . ? 0.6037 0.5898 0.3383 -0.1209 0.0662 -0.0085 666 HOH B O 4870 O O . HOH F . ? 0.5890 0.5528 0.4886 0.0587 -0.0259 0.0653 667 HOH B O 4871 O O . HOH F . ? 0.6703 0.6850 0.5014 -0.0021 0.0345 0.0344 668 HOH B O 4872 O O . HOH F . ? 0.5371 0.7245 0.6372 -0.0160 0.2994 -0.0514 669 HOH B O 4873 O O . HOH F . ? 0.5883 0.6063 0.6366 0.0379 0.0553 -0.0410 670 HOH B O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 ILE 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 HIS 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 TYR 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 MET 181 181 181 MET MET A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 TRP 205 205 205 TRP TRP A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 PHE 220 220 220 PHE PHE A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 TRP 224 224 224 TRP TRP A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 CYS 233 233 233 CYS CYS A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 ASN 235 235 235 ASN ASN A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 PHE 243 243 243 PHE PHE A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 LYS 245 245 245 LYS ALA A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 GLN 247 247 247 GLN ALA A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 THR 258 258 258 THR THR A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 LYS 261 261 261 LYS LYS A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 SER 263 263 263 SER SER A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 GLN 276 276 276 GLN GLN A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 THR 279 279 279 THR THR A . n A 1 280 GLN 280 280 280 GLN GLN A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 THR 285 285 285 THR ALA A . n A 1 286 ASP 286 286 ? ? ? A . n A 1 287 LYS 287 287 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ARG 2 2 ? ? ? B . n B 1 3 PHE 3 3 ? ? ? B . n B 1 4 ILE 4 4 ? ? ? B . n B 1 5 HIS 5 5 ? ? ? B . n B 1 6 ALA 6 6 ? ? ? B . n B 1 7 LEU 7 7 ? ? ? B . n B 1 8 LEU 8 8 ? ? ? B . n B 1 9 LEU 9 9 ? ? ? B . n B 1 10 ALA 10 10 ? ? ? B . n B 1 11 GLY 11 11 ? ? ? B . n B 1 12 ILE 12 12 ? ? ? B . n B 1 13 ALA 13 13 ? ? ? B . n B 1 14 HIS 14 14 ? ? ? B . n B 1 15 SER 15 15 ? ? ? B . n B 1 16 ALA 16 16 ? ? ? B . n B 1 17 TYR 17 17 ? ? ? B . n B 1 18 ALA 18 18 ? ? ? B . n B 1 19 SER 19 19 19 SER ALA B . n B 1 20 GLU 20 20 20 GLU SER B . n B 1 21 LYS 21 21 21 LYS SER B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 THR 23 23 23 THR THR B . n B 1 24 PHE 24 24 24 PHE PHE B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 ARG 33 33 33 ARG ARG B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 GLN 38 38 38 GLN GLN B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 GLN 47 47 47 GLN GLN B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 GLY 53 53 53 GLY GLY B . n B 1 54 HIS 54 54 54 HIS HIS B . n B 1 55 ARG 55 55 55 ARG ARG B . n B 1 56 MET 56 56 56 MET MET B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 PHE 60 60 60 PHE PHE B . n B 1 61 ALA 61 61 61 ALA ALA B . n B 1 62 MET 62 62 62 MET MET B . n B 1 63 CYS 63 63 63 CYS CYS B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 THR 65 65 65 THR THR B . n B 1 66 PHE 66 66 66 PHE PHE B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 PHE 68 68 68 PHE PHE B . n B 1 69 PRO 69 69 69 PRO PRO B . n B 1 70 LEU 70 70 70 LEU LEU B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 ALA 72 72 72 ALA ALA B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 ARG 77 77 77 ARG ARG B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 ASP 79 79 79 ASP ASP B . n B 1 80 SER 80 80 80 SER SER B . n B 1 81 GLY 81 81 81 GLY GLY B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 ARG 84 84 84 ARG ARG B . n B 1 85 GLY 85 85 85 GLY GLY B . n B 1 86 ASP 86 86 86 ASP ASP B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 LYS 88 88 88 LYS LYS B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 SER 90 90 90 SER SER B . n B 1 91 TYR 91 91 91 TYR TYR B . n B 1 92 GLY 92 92 92 GLY GLY B . n B 1 93 PRO 93 93 93 PRO PRO B . n B 1 94 ASP 94 94 94 ASP ASP B . n B 1 95 MET 95 95 95 MET MET B . n B 1 96 ILE 96 96 96 ILE ILE B . n B 1 97 VAL 97 97 97 VAL VAL B . n B 1 98 GLU 98 98 98 GLU GLU B . n B 1 99 TRP 99 99 99 TRP TRP B . n B 1 100 SER 100 100 100 SER SER B . n B 1 101 PRO 101 101 101 PRO PRO B . n B 1 102 ALA 102 102 102 ALA ALA B . n B 1 103 THR 103 103 103 THR THR B . n B 1 104 GLU 104 104 104 GLU GLU B . n B 1 105 ARG 105 105 105 ARG ARG B . n B 1 106 PHE 106 106 106 PHE PHE B . n B 1 107 LEU 107 107 107 LEU LEU B . n B 1 108 ALA 108 108 108 ALA ALA B . n B 1 109 SER 109 109 109 SER SER B . n B 1 110 GLY 110 110 110 GLY GLY B . n B 1 111 HIS 111 111 111 HIS HIS B . n B 1 112 MET 112 112 112 MET MET B . n B 1 113 THR 113 113 113 THR THR B . n B 1 114 VAL 114 114 114 VAL VAL B . n B 1 115 LEU 115 115 115 LEU LEU B . n B 1 116 GLU 116 116 116 GLU GLU B . n B 1 117 ALA 117 117 117 ALA ALA B . n B 1 118 ALA 118 118 118 ALA ALA B . n B 1 119 GLN 119 119 119 GLN GLN B . n B 1 120 ALA 120 120 120 ALA ALA B . n B 1 121 ALA 121 121 121 ALA ALA B . n B 1 122 VAL 122 122 122 VAL VAL B . n B 1 123 GLN 123 123 123 GLN GLN B . n B 1 124 LEU 124 124 124 LEU LEU B . n B 1 125 SER 125 125 125 SER SER B . n B 1 126 ASP 126 126 126 ASP ASP B . n B 1 127 ASN 127 127 127 ASN ASN B . n B 1 128 GLY 128 128 128 GLY GLY B . n B 1 129 ALA 129 129 129 ALA ALA B . n B 1 130 THR 130 130 130 THR THR B . n B 1 131 ASN 131 131 131 ASN ASN B . n B 1 132 LEU 132 132 132 LEU LEU B . n B 1 133 LEU 133 133 133 LEU LEU B . n B 1 134 LEU 134 134 134 LEU LEU B . n B 1 135 ARG 135 135 135 ARG ARG B . n B 1 136 GLU 136 136 136 GLU GLU B . n B 1 137 ILE 137 137 137 ILE ILE B . n B 1 138 GLY 138 138 138 GLY GLY B . n B 1 139 GLY 139 139 139 GLY GLY B . n B 1 140 PRO 140 140 140 PRO PRO B . n B 1 141 ALA 141 141 141 ALA ALA B . n B 1 142 ALA 142 142 142 ALA ALA B . n B 1 143 MET 143 143 143 MET MET B . n B 1 144 THR 144 144 144 THR THR B . n B 1 145 GLN 145 145 145 GLN GLN B . n B 1 146 TYR 146 146 146 TYR TYR B . n B 1 147 PHE 147 147 147 PHE PHE B . n B 1 148 ARG 148 148 148 ARG ARG B . n B 1 149 LYS 149 149 149 LYS LYS B . n B 1 150 ILE 150 150 150 ILE ILE B . n B 1 151 GLY 151 151 151 GLY GLY B . n B 1 152 ASP 152 152 152 ASP ASP B . n B 1 153 SER 153 153 153 SER SER B . n B 1 154 VAL 154 154 154 VAL VAL B . n B 1 155 SER 155 155 155 SER SER B . n B 1 156 ARG 156 156 156 ARG ARG B . n B 1 157 LEU 157 157 157 LEU LEU B . n B 1 158 ASP 158 158 158 ASP ASP B . n B 1 159 ARG 159 159 159 ARG ARG B . n B 1 160 LYS 160 160 160 LYS LYS B . n B 1 161 GLU 161 161 161 GLU GLU B . n B 1 162 PRO 162 162 162 PRO PRO B . n B 1 163 GLU 163 163 163 GLU GLU B . n B 1 164 MET 164 164 164 MET MET B . n B 1 165 GLY 165 165 165 GLY GLY B . n B 1 166 ASP 166 166 166 ASP ASP B . n B 1 167 ASN 167 167 167 ASN ASN B . n B 1 168 THR 168 168 168 THR THR B . n B 1 169 PRO 169 169 169 PRO PRO B . n B 1 170 GLY 170 170 170 GLY GLY B . n B 1 171 ASP 171 171 171 ASP ASP B . n B 1 172 LEU 172 172 172 LEU LEU B . n B 1 173 ARG 173 173 173 ARG ARG B . n B 1 174 ASP 174 174 174 ASP ASP B . n B 1 175 THR 175 175 175 THR THR B . n B 1 176 THR 176 176 176 THR THR B . n B 1 177 THR 177 177 177 THR THR B . n B 1 178 PRO 178 178 178 PRO PRO B . n B 1 179 ILE 179 179 179 ILE ILE B . n B 1 180 ALA 180 180 180 ALA ALA B . n B 1 181 MET 181 181 181 MET MET B . n B 1 182 ALA 182 182 182 ALA ALA B . n B 1 183 ARG 183 183 183 ARG ARG B . n B 1 184 THR 184 184 184 THR THR B . n B 1 185 VAL 185 185 185 VAL VAL B . n B 1 186 ALA 186 186 186 ALA ALA B . n B 1 187 LYS 187 187 187 LYS LYS B . n B 1 188 VAL 188 188 188 VAL VAL B . n B 1 189 LEU 189 189 189 LEU LEU B . n B 1 190 TYR 190 190 190 TYR TYR B . n B 1 191 GLY 191 191 191 GLY GLY B . n B 1 192 GLY 192 192 192 GLY GLY B . n B 1 193 ALA 193 193 193 ALA ALA B . n B 1 194 LEU 194 194 194 LEU LEU B . n B 1 195 THR 195 195 195 THR THR B . n B 1 196 SER 196 196 196 SER SER B . n B 1 197 THR 197 197 197 THR THR B . n B 1 198 SER 198 198 198 SER SER B . n B 1 199 THR 199 199 199 THR THR B . n B 1 200 HIS 200 200 200 HIS HIS B . n B 1 201 THR 201 201 201 THR THR B . n B 1 202 ILE 202 202 202 ILE ILE B . n B 1 203 GLU 203 203 203 GLU GLU B . n B 1 204 ARG 204 204 204 ARG ARG B . n B 1 205 TRP 205 205 205 TRP TRP B . n B 1 206 LEU 206 206 206 LEU LEU B . n B 1 207 ILE 207 207 207 ILE ILE B . n B 1 208 GLY 208 208 208 GLY GLY B . n B 1 209 ASN 209 209 209 ASN ASN B . n B 1 210 GLN 210 210 210 GLN GLN B . n B 1 211 THR 211 211 211 THR THR B . n B 1 212 GLY 212 212 212 GLY GLY B . n B 1 213 ASP 213 213 213 ASP ASP B . n B 1 214 ALA 214 214 214 ALA ALA B . n B 1 215 THR 215 215 215 THR THR B . n B 1 216 LEU 216 216 216 LEU LEU B . n B 1 217 ARG 217 217 217 ARG ARG B . n B 1 218 ALA 218 218 218 ALA ALA B . n B 1 219 GLY 219 219 219 GLY GLY B . n B 1 220 PHE 220 220 220 PHE PHE B . n B 1 221 PRO 221 221 221 PRO PRO B . n B 1 222 LYS 222 222 222 LYS LYS B . n B 1 223 ASP 223 223 223 ASP ASP B . n B 1 224 TRP 224 224 224 TRP TRP B . n B 1 225 VAL 225 225 225 VAL VAL B . n B 1 226 VAL 226 226 226 VAL VAL B . n B 1 227 GLY 227 227 227 GLY GLY B . n B 1 228 GLU 228 228 228 GLU GLU B . n B 1 229 LYS 229 229 229 LYS LYS B . n B 1 230 THR 230 230 230 THR THR B . n B 1 231 GLY 231 231 231 GLY GLY B . n B 1 232 THR 232 232 232 THR THR B . n B 1 233 CYS 233 233 233 CYS CYS B . n B 1 234 ALA 234 234 234 ALA ALA B . n B 1 235 ASN 235 235 235 ASN ASN B . n B 1 236 GLY 236 236 236 GLY GLY B . n B 1 237 GLY 237 237 237 GLY GLY B . n B 1 238 ARG 238 238 238 ARG ARG B . n B 1 239 ASN 239 239 239 ASN ASN B . n B 1 240 ASP 240 240 240 ASP ASP B . n B 1 241 ILE 241 241 241 ILE ILE B . n B 1 242 GLY 242 242 242 GLY GLY B . n B 1 243 PHE 243 243 243 PHE PHE B . n B 1 244 PHE 244 244 244 PHE PHE B . n B 1 245 LYS 245 245 245 LYS LYS B . n B 1 246 ALA 246 246 246 ALA ALA B . n B 1 247 GLN 247 247 247 GLN GLN B . n B 1 248 GLU 248 248 248 GLU GLU B . n B 1 249 ARG 249 249 249 ARG ARG B . n B 1 250 ASP 250 250 250 ASP ASP B . n B 1 251 TYR 251 251 251 TYR TYR B . n B 1 252 ALA 252 252 252 ALA ALA B . n B 1 253 VAL 253 253 253 VAL VAL B . n B 1 254 ALA 254 254 254 ALA ALA B . n B 1 255 VAL 255 255 255 VAL VAL B . n B 1 256 TYR 256 256 256 TYR TYR B . n B 1 257 THR 257 257 257 THR THR B . n B 1 258 THR 258 258 258 THR THR B . n B 1 259 ALA 259 259 259 ALA ALA B . n B 1 260 PRO 260 260 260 PRO PRO B . n B 1 261 LYS 261 261 261 LYS LYS B . n B 1 262 LEU 262 262 262 LEU LEU B . n B 1 263 SER 263 263 263 SER SER B . n B 1 264 ALA 264 264 264 ALA ALA B . n B 1 265 VAL 265 265 265 VAL VAL B . n B 1 266 GLU 266 266 266 GLU GLU B . n B 1 267 ARG 267 267 267 ARG ARG B . n B 1 268 ASP 268 268 268 ASP ASP B . n B 1 269 GLU 269 269 269 GLU GLU B . n B 1 270 LEU 270 270 270 LEU LEU B . n B 1 271 VAL 271 271 271 VAL VAL B . n B 1 272 ALA 272 272 272 ALA ALA B . n B 1 273 SER 273 273 273 SER SER B . n B 1 274 VAL 274 274 274 VAL VAL B . n B 1 275 GLY 275 275 275 GLY GLY B . n B 1 276 GLN 276 276 276 GLN GLN B . n B 1 277 VAL 277 277 277 VAL VAL B . n B 1 278 ILE 278 278 278 ILE ILE B . n B 1 279 THR 279 279 279 THR THR B . n B 1 280 GLN 280 280 280 GLN GLN B . n B 1 281 LEU 281 281 281 LEU LEU B . n B 1 282 ILE 282 282 282 ILE ILE B . n B 1 283 LEU 283 283 283 LEU LEU B . n B 1 284 SER 284 284 284 SER SER B . n B 1 285 THR 285 285 ? ? ? B . n B 1 286 ASP 286 286 ? ? ? B . n B 1 287 LYS 287 287 ? ? ? B . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E 2 1 B,D,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-12 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Blu-Ice 'data collection' 5.0 ? 1 MOLREP phasing . ? 2 SHELXL-97 refinement . ? 3 XDS 'data reduction' . ? 4 XSCALE 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 213 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 650 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LYS 21 ? ? CA A LYS 21 ? ? CB A LYS 21 ? ? 131.13 110.60 20.53 1.80 N 2 1 NE A ARG 55 ? ? CZ A ARG 55 ? ? NH1 A ARG 55 ? ? 123.99 120.30 3.69 0.50 N 3 1 CD A ARG 59 ? A NE A ARG 59 ? A CZ A ARG 59 ? A 134.20 123.60 10.60 1.40 N 4 1 NE A ARG 59 ? A CZ A ARG 59 ? A NH1 A ARG 59 ? A 113.77 120.30 -6.53 0.50 N 5 1 NE A ARG 59 ? A CZ A ARG 59 ? A NH2 A ARG 59 ? A 124.11 120.30 3.81 0.50 N 6 1 NE A ARG 59 ? B CZ A ARG 59 ? B NH2 A ARG 59 ? B 117.00 120.30 -3.30 0.50 N 7 1 CB A PHE 68 ? ? CG A PHE 68 ? ? CD2 A PHE 68 ? ? 127.16 120.80 6.36 0.70 N 8 1 CB A PHE 68 ? ? CG A PHE 68 ? ? CD1 A PHE 68 ? ? 114.55 120.80 -6.25 0.70 N 9 1 NE A ARG 84 ? A CZ A ARG 84 ? A NH1 A ARG 84 ? A 123.58 120.30 3.28 0.50 N 10 1 NE A ARG 84 ? B CZ A ARG 84 ? B NH1 A ARG 84 ? B 124.09 120.30 3.79 0.50 N 11 1 CA A ARG 135 ? ? CB A ARG 135 ? ? CG A ARG 135 ? ? 134.08 113.40 20.68 2.20 N 12 1 NH1 A ARG 135 ? ? CZ A ARG 135 ? ? NH2 A ARG 135 ? ? 111.30 119.40 -8.10 1.10 N 13 1 NE A ARG 135 ? ? CZ A ARG 135 ? ? NH1 A ARG 135 ? ? 112.85 120.30 -7.45 0.50 N 14 1 NE A ARG 135 ? ? CZ A ARG 135 ? ? NH2 A ARG 135 ? ? 135.83 120.30 15.53 0.50 N 15 1 CA A GLU 163 ? ? CB A GLU 163 ? ? CG A GLU 163 ? ? 128.59 113.40 15.19 2.20 N 16 1 CB A ASP 213 ? ? CG A ASP 213 ? ? OD2 A ASP 213 ? ? 124.73 118.30 6.43 0.90 N 17 1 NE A ARG 217 ? ? CZ A ARG 217 ? ? NH1 A ARG 217 ? ? 116.41 120.30 -3.89 0.50 N 18 1 NE A ARG 217 ? ? CZ A ARG 217 ? ? NH2 A ARG 217 ? ? 123.90 120.30 3.60 0.50 N 19 1 NE A ARG 238 ? ? CZ A ARG 238 ? ? NH1 A ARG 238 ? ? 124.50 120.30 4.20 0.50 N 20 1 NE A ARG 238 ? ? CZ A ARG 238 ? ? NH2 A ARG 238 ? ? 117.14 120.30 -3.16 0.50 N 21 1 CA A GLN 280 ? ? CB A GLN 280 ? B CG A GLN 280 ? B 128.82 113.40 15.42 2.20 N 22 1 CB A GLN 280 ? B CG A GLN 280 ? B CD A GLN 280 ? B 127.24 111.60 15.64 2.60 N 23 1 CD B ARG 59 ? ? NE B ARG 59 ? ? CZ B ARG 59 ? ? 137.10 123.60 13.50 1.40 N 24 1 NH1 B ARG 59 ? ? CZ B ARG 59 ? ? NH2 B ARG 59 ? ? 112.06 119.40 -7.34 1.10 N 25 1 NE B ARG 59 ? ? CZ B ARG 59 ? ? NH1 B ARG 59 ? ? 130.15 120.30 9.85 0.50 N 26 1 CB B PHE 68 ? ? CG B PHE 68 ? ? CD2 B PHE 68 ? ? 127.10 120.80 6.30 0.70 N 27 1 NE B ARG 77 ? ? CZ B ARG 77 ? ? NH1 B ARG 77 ? ? 124.13 120.30 3.83 0.50 N 28 1 NE B ARG 77 ? ? CZ B ARG 77 ? ? NH2 B ARG 77 ? ? 117.02 120.30 -3.28 0.50 N 29 1 NE B ARG 105 ? ? CZ B ARG 105 ? ? NH2 B ARG 105 ? ? 124.16 120.30 3.86 0.50 N 30 1 NE B ARG 135 ? ? CZ B ARG 135 ? ? NH1 B ARG 135 ? ? 124.36 120.30 4.06 0.50 N 31 1 NE B ARG 148 ? ? CZ B ARG 148 ? ? NH1 B ARG 148 ? ? 126.33 120.30 6.03 0.50 N 32 1 NE B ARG 148 ? ? CZ B ARG 148 ? ? NH2 B ARG 148 ? ? 116.86 120.30 -3.44 0.50 N 33 1 NE B ARG 217 ? A CZ B ARG 217 ? A NH1 B ARG 217 ? A 126.50 120.30 6.20 0.50 N 34 1 CB B ASP 223 ? ? CG B ASP 223 ? ? OD1 B ASP 223 ? ? 127.87 118.30 9.57 0.90 N 35 1 NE B ARG 238 ? ? CZ B ARG 238 ? ? NH1 B ARG 238 ? ? 125.64 120.30 5.34 0.50 N 36 1 CG B ARG 249 ? ? CD B ARG 249 ? ? NE B ARG 249 ? ? 129.64 111.80 17.84 2.10 N 37 1 CD B ARG 249 ? ? NE B ARG 249 ? ? CZ B ARG 249 ? ? 138.28 123.60 14.68 1.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 63 ? A 55.38 -143.98 2 1 CYS A 63 ? B 31.85 -130.75 3 1 TRP A 99 ? ? 55.60 74.35 4 1 THR A 215 ? ? -104.07 -131.65 5 1 GLN A 247 ? ? 48.43 -115.75 6 1 CYS B 63 ? A 53.22 -148.70 7 1 CYS B 63 ? C 29.90 -131.20 8 1 TRP B 99 ? ? 53.66 71.90 9 1 THR B 215 ? ? -107.65 -131.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 245 ? CG ? A LYS 245 CG 2 1 Y 1 A LYS 245 ? CD ? A LYS 245 CD 3 1 Y 1 A LYS 245 ? CE ? A LYS 245 CE 4 1 Y 1 A LYS 245 ? NZ ? A LYS 245 NZ 5 1 Y 1 A GLN 247 ? CG ? A GLN 247 CG 6 1 Y 1 A GLN 247 ? CD ? A GLN 247 CD 7 1 Y 1 A GLN 247 ? OE1 ? A GLN 247 OE1 8 1 Y 1 A GLN 247 ? NE2 ? A GLN 247 NE2 9 1 Y 1 A THR 285 ? OG1 ? A THR 285 OG1 10 1 Y 1 A THR 285 ? CG2 ? A THR 285 CG2 11 1 Y 1 B SER 19 ? OG ? B SER 19 OG 12 1 Y 1 B GLU 20 ? CD ? B GLU 20 CD 13 1 Y 1 B GLU 20 ? OE1 ? B GLU 20 OE1 14 1 Y 1 B GLU 20 ? OE2 ? B GLU 20 OE2 15 1 Y 1 B LYS 21 ? CD ? B LYS 21 CD 16 1 Y 1 B LYS 21 ? CE ? B LYS 21 CE 17 1 Y 1 B LYS 21 ? NZ ? B LYS 21 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A ILE 12 ? A ILE 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A HIS 14 ? A HIS 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A TYR 17 ? A TYR 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A ASP 286 ? A ASP 286 22 1 Y 1 A LYS 287 ? A LYS 287 23 1 Y 1 B MET 1 ? B MET 1 24 1 Y 1 B ARG 2 ? B ARG 2 25 1 Y 1 B PHE 3 ? B PHE 3 26 1 Y 1 B ILE 4 ? B ILE 4 27 1 Y 1 B HIS 5 ? B HIS 5 28 1 Y 1 B ALA 6 ? B ALA 6 29 1 Y 1 B LEU 7 ? B LEU 7 30 1 Y 1 B LEU 8 ? B LEU 8 31 1 Y 1 B LEU 9 ? B LEU 9 32 1 Y 1 B ALA 10 ? B ALA 10 33 1 Y 1 B GLY 11 ? B GLY 11 34 1 Y 1 B ILE 12 ? B ILE 12 35 1 Y 1 B ALA 13 ? B ALA 13 36 1 Y 1 B HIS 14 ? B HIS 14 37 1 Y 1 B SER 15 ? B SER 15 38 1 Y 1 B ALA 16 ? B ALA 16 39 1 Y 1 B TYR 17 ? B TYR 17 40 1 Y 1 B ALA 18 ? B ALA 18 41 1 Y 1 B THR 285 ? B THR 285 42 1 Y 1 B ASP 286 ? B ASP 286 43 1 Y 1 B LYS 287 ? B LYS 287 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SO4 1 300 300 SO4 SUL A . D 2 SO4 1 300 300 SO4 SUL B . E 3 HOH 1 301 1 HOH HOH A . E 3 HOH 2 302 2 HOH HOH A . E 3 HOH 3 303 5 HOH HOH A . E 3 HOH 4 304 7 HOH HOH A . E 3 HOH 5 305 8 HOH HOH A . E 3 HOH 6 306 10 HOH HOH A . E 3 HOH 7 307 13 HOH HOH A . E 3 HOH 8 308 19 HOH HOH A . E 3 HOH 9 309 20 HOH HOH A . E 3 HOH 10 310 21 HOH HOH A . E 3 HOH 11 311 22 HOH HOH A . E 3 HOH 12 312 23 HOH HOH A . E 3 HOH 13 313 24 HOH HOH A . E 3 HOH 14 314 25 HOH HOH A . E 3 HOH 15 315 27 HOH HOH A . E 3 HOH 16 316 28 HOH HOH A . E 3 HOH 17 317 30 HOH HOH A . E 3 HOH 18 318 31 HOH HOH A . E 3 HOH 19 319 32 HOH HOH A . E 3 HOH 20 320 36 HOH HOH A . E 3 HOH 21 321 42 HOH HOH A . E 3 HOH 22 322 43 HOH HOH A . E 3 HOH 23 323 47 HOH HOH A . E 3 HOH 24 324 49 HOH HOH A . E 3 HOH 25 325 50 HOH HOH A . E 3 HOH 26 326 51 HOH HOH A . E 3 HOH 27 327 54 HOH HOH A . E 3 HOH 28 328 55 HOH HOH A . E 3 HOH 29 329 56 HOH HOH A . E 3 HOH 30 330 58 HOH HOH A . E 3 HOH 31 331 59 HOH HOH A . E 3 HOH 32 332 60 HOH HOH A . E 3 HOH 33 333 61 HOH HOH A . E 3 HOH 34 334 62 HOH HOH A . E 3 HOH 35 335 64 HOH HOH A . E 3 HOH 36 336 68 HOH HOH A . E 3 HOH 37 337 69 HOH HOH A . E 3 HOH 38 338 70 HOH HOH A . E 3 HOH 39 339 71 HOH HOH A . E 3 HOH 40 340 76 HOH HOH A . E 3 HOH 41 341 77 HOH HOH A . E 3 HOH 42 342 78 HOH HOH A . E 3 HOH 43 343 80 HOH HOH A . E 3 HOH 44 344 85 HOH HOH A . E 3 HOH 45 345 89 HOH HOH A . E 3 HOH 46 346 90 HOH HOH A . E 3 HOH 47 347 92 HOH HOH A . E 3 HOH 48 348 93 HOH HOH A . E 3 HOH 49 349 95 HOH HOH A . E 3 HOH 50 350 96 HOH HOH A . E 3 HOH 51 351 100 HOH HOH A . E 3 HOH 52 352 104 HOH HOH A . E 3 HOH 53 353 108 HOH HOH A . E 3 HOH 54 354 109 HOH HOH A . E 3 HOH 55 355 111 HOH HOH A . E 3 HOH 56 356 113 HOH HOH A . E 3 HOH 57 357 114 HOH HOH A . E 3 HOH 58 358 115 HOH HOH A . E 3 HOH 59 359 117 HOH HOH A . E 3 HOH 60 360 120 HOH HOH A . E 3 HOH 61 361 121 HOH HOH A . E 3 HOH 62 362 122 HOH HOH A . E 3 HOH 63 363 124 HOH HOH A . E 3 HOH 64 364 127 HOH HOH A . E 3 HOH 65 365 129 HOH HOH A . E 3 HOH 66 366 131 HOH HOH A . E 3 HOH 67 367 133 HOH HOH A . E 3 HOH 68 368 134 HOH HOH A . E 3 HOH 69 369 137 HOH HOH A . E 3 HOH 70 370 140 HOH HOH A . E 3 HOH 71 371 143 HOH HOH A . E 3 HOH 72 372 146 HOH HOH A . E 3 HOH 73 373 152 HOH HOH A . E 3 HOH 74 374 158 HOH HOH A . E 3 HOH 75 375 162 HOH HOH A . E 3 HOH 76 376 168 HOH HOH A . E 3 HOH 77 377 170 HOH HOH A . E 3 HOH 78 378 171 HOH HOH A . E 3 HOH 79 379 175 HOH HOH A . E 3 HOH 80 380 177 HOH HOH A . E 3 HOH 81 381 178 HOH HOH A . E 3 HOH 82 382 179 HOH HOH A . E 3 HOH 83 383 185 HOH HOH A . E 3 HOH 84 384 187 HOH HOH A . E 3 HOH 85 385 189 HOH HOH A . E 3 HOH 86 386 192 HOH HOH A . E 3 HOH 87 387 193 HOH HOH A . E 3 HOH 88 388 194 HOH HOH A . E 3 HOH 89 389 197 HOH HOH A . E 3 HOH 90 390 198 HOH HOH A . E 3 HOH 91 391 199 HOH HOH A . E 3 HOH 92 392 201 HOH HOH A . E 3 HOH 93 393 205 HOH HOH A . E 3 HOH 94 394 207 HOH HOH A . E 3 HOH 95 395 218 HOH HOH A . E 3 HOH 96 396 219 HOH HOH A . E 3 HOH 97 397 221 HOH HOH A . E 3 HOH 98 398 224 HOH HOH A . E 3 HOH 99 399 225 HOH HOH A . E 3 HOH 100 400 227 HOH HOH A . E 3 HOH 101 401 228 HOH HOH A . E 3 HOH 102 402 229 HOH HOH A . E 3 HOH 103 403 234 HOH HOH A . E 3 HOH 104 404 235 HOH HOH A . E 3 HOH 105 405 243 HOH HOH A . E 3 HOH 106 406 244 HOH HOH A . E 3 HOH 107 407 245 HOH HOH A . E 3 HOH 108 408 247 HOH HOH A . E 3 HOH 109 409 249 HOH HOH A . E 3 HOH 110 410 250 HOH HOH A . E 3 HOH 111 411 252 HOH HOH A . E 3 HOH 112 412 253 HOH HOH A . E 3 HOH 113 413 254 HOH HOH A . E 3 HOH 114 414 255 HOH HOH A . E 3 HOH 115 415 256 HOH HOH A . E 3 HOH 116 416 257 HOH HOH A . E 3 HOH 117 417 259 HOH HOH A . E 3 HOH 118 418 260 HOH HOH A . E 3 HOH 119 419 262 HOH HOH A . E 3 HOH 120 420 263 HOH HOH A . E 3 HOH 121 421 264 HOH HOH A . E 3 HOH 122 422 265 HOH HOH A . E 3 HOH 123 423 268 HOH HOH A . E 3 HOH 124 424 270 HOH HOH A . E 3 HOH 125 425 272 HOH HOH A . E 3 HOH 126 426 274 HOH HOH A . E 3 HOH 127 427 276 HOH HOH A . E 3 HOH 128 428 277 HOH HOH A . E 3 HOH 129 429 279 HOH HOH A . E 3 HOH 130 430 280 HOH HOH A . E 3 HOH 131 431 288 HOH HOH A . E 3 HOH 132 432 289 HOH HOH A . E 3 HOH 133 433 290 HOH HOH A . E 3 HOH 134 434 292 HOH HOH A . E 3 HOH 135 435 293 HOH HOH A . E 3 HOH 136 436 294 HOH HOH A . E 3 HOH 137 437 295 HOH HOH A . E 3 HOH 138 438 297 HOH HOH A . E 3 HOH 139 439 299 HOH HOH A . E 3 HOH 140 440 300 HOH HOH A . E 3 HOH 141 441 303 HOH HOH A . E 3 HOH 142 442 305 HOH HOH A . E 3 HOH 143 443 306 HOH HOH A . E 3 HOH 144 444 308 HOH HOH A . E 3 HOH 145 445 310 HOH HOH A . E 3 HOH 146 446 311 HOH HOH A . E 3 HOH 147 447 314 HOH HOH A . E 3 HOH 148 448 319 HOH HOH A . E 3 HOH 149 449 320 HOH HOH A . E 3 HOH 150 450 321 HOH HOH A . E 3 HOH 151 451 323 HOH HOH A . E 3 HOH 152 452 327 HOH HOH A . E 3 HOH 153 453 328 HOH HOH A . E 3 HOH 154 454 331 HOH HOH A . E 3 HOH 155 455 335 HOH HOH A . E 3 HOH 156 456 337 HOH HOH A . E 3 HOH 157 457 338 HOH HOH A . E 3 HOH 158 458 339 HOH HOH A . E 3 HOH 159 459 342 HOH HOH A . E 3 HOH 160 460 345 HOH HOH A . E 3 HOH 161 461 346 HOH HOH A . E 3 HOH 162 462 349 HOH HOH A . E 3 HOH 163 463 350 HOH HOH A . E 3 HOH 164 464 351 HOH HOH A . E 3 HOH 165 465 352 HOH HOH A . E 3 HOH 166 466 354 HOH HOH A . E 3 HOH 167 467 357 HOH HOH A . E 3 HOH 168 468 358 HOH HOH A . E 3 HOH 169 469 359 HOH HOH A . E 3 HOH 170 470 361 HOH HOH A . E 3 HOH 171 471 367 HOH HOH A . E 3 HOH 172 472 368 HOH HOH A . E 3 HOH 173 473 372 HOH HOH A . E 3 HOH 174 474 374 HOH HOH A . E 3 HOH 175 475 375 HOH HOH A . E 3 HOH 176 476 376 HOH HOH A . E 3 HOH 177 477 379 HOH HOH A . E 3 HOH 178 478 380 HOH HOH A . E 3 HOH 179 479 383 HOH HOH A . E 3 HOH 180 480 384 HOH HOH A . E 3 HOH 181 481 387 HOH HOH A . E 3 HOH 182 482 388 HOH HOH A . E 3 HOH 183 483 389 HOH HOH A . E 3 HOH 184 484 390 HOH HOH A . E 3 HOH 185 485 391 HOH HOH A . E 3 HOH 186 486 393 HOH HOH A . E 3 HOH 187 487 394 HOH HOH A . E 3 HOH 188 488 395 HOH HOH A . E 3 HOH 189 489 396 HOH HOH A . E 3 HOH 190 490 402 HOH HOH A . E 3 HOH 191 491 403 HOH HOH A . E 3 HOH 192 492 406 HOH HOH A . E 3 HOH 193 493 408 HOH HOH A . E 3 HOH 194 494 412 HOH HOH A . E 3 HOH 195 495 415 HOH HOH A . E 3 HOH 196 496 417 HOH HOH A . E 3 HOH 197 497 418 HOH HOH A . E 3 HOH 198 498 421 HOH HOH A . E 3 HOH 199 499 422 HOH HOH A . E 3 HOH 200 500 424 HOH HOH A . E 3 HOH 201 501 426 HOH HOH A . E 3 HOH 202 502 427 HOH HOH A . E 3 HOH 203 503 429 HOH HOH A . E 3 HOH 204 504 435 HOH HOH A . E 3 HOH 205 505 436 HOH HOH A . E 3 HOH 206 506 437 HOH HOH A . E 3 HOH 207 507 443 HOH HOH A . E 3 HOH 208 508 444 HOH HOH A . E 3 HOH 209 509 446 HOH HOH A . E 3 HOH 210 510 447 HOH HOH A . E 3 HOH 211 511 448 HOH HOH A . E 3 HOH 212 512 450 HOH HOH A . E 3 HOH 213 513 451 HOH HOH A . E 3 HOH 214 514 452 HOH HOH A . E 3 HOH 215 515 456 HOH HOH A . E 3 HOH 216 516 457 HOH HOH A . E 3 HOH 217 517 459 HOH HOH A . E 3 HOH 218 518 460 HOH HOH A . E 3 HOH 219 519 462 HOH HOH A . E 3 HOH 220 520 463 HOH HOH A . E 3 HOH 221 521 466 HOH HOH A . E 3 HOH 222 522 467 HOH HOH A . E 3 HOH 223 523 469 HOH HOH A . E 3 HOH 224 524 471 HOH HOH A . E 3 HOH 225 525 472 HOH HOH A . E 3 HOH 226 526 473 HOH HOH A . E 3 HOH 227 527 475 HOH HOH A . E 3 HOH 228 528 478 HOH HOH A . E 3 HOH 229 529 481 HOH HOH A . E 3 HOH 230 530 483 HOH HOH A . E 3 HOH 231 531 484 HOH HOH A . E 3 HOH 232 532 485 HOH HOH A . E 3 HOH 233 533 486 HOH HOH A . E 3 HOH 234 534 487 HOH HOH A . E 3 HOH 235 535 490 HOH HOH A . E 3 HOH 236 536 491 HOH HOH A . E 3 HOH 237 537 494 HOH HOH A . E 3 HOH 238 538 496 HOH HOH A . E 3 HOH 239 539 497 HOH HOH A . E 3 HOH 240 540 499 HOH HOH A . E 3 HOH 241 541 500 HOH HOH A . E 3 HOH 242 542 501 HOH HOH A . E 3 HOH 243 543 502 HOH HOH A . E 3 HOH 244 544 503 HOH HOH A . E 3 HOH 245 545 504 HOH HOH A . E 3 HOH 246 546 506 HOH HOH A . E 3 HOH 247 547 507 HOH HOH A . E 3 HOH 248 548 512 HOH HOH A . E 3 HOH 249 549 513 HOH HOH A . E 3 HOH 250 550 516 HOH HOH A . E 3 HOH 251 551 520 HOH HOH A . E 3 HOH 252 552 521 HOH HOH A . E 3 HOH 253 553 525 HOH HOH A . E 3 HOH 254 554 527 HOH HOH A . E 3 HOH 255 555 528 HOH HOH A . E 3 HOH 256 556 530 HOH HOH A . E 3 HOH 257 557 531 HOH HOH A . E 3 HOH 258 558 534 HOH HOH A . E 3 HOH 259 559 536 HOH HOH A . E 3 HOH 260 560 537 HOH HOH A . E 3 HOH 261 561 539 HOH HOH A . E 3 HOH 262 562 540 HOH HOH A . E 3 HOH 263 563 541 HOH HOH A . E 3 HOH 264 564 544 HOH HOH A . E 3 HOH 265 565 548 HOH HOH A . E 3 HOH 266 566 549 HOH HOH A . E 3 HOH 267 567 551 HOH HOH A . E 3 HOH 268 568 552 HOH HOH A . E 3 HOH 269 569 557 HOH HOH A . E 3 HOH 270 570 558 HOH HOH A . E 3 HOH 271 571 559 HOH HOH A . E 3 HOH 272 572 562 HOH HOH A . E 3 HOH 273 573 563 HOH HOH A . E 3 HOH 274 574 564 HOH HOH A . E 3 HOH 275 575 567 HOH HOH A . E 3 HOH 276 576 569 HOH HOH A . E 3 HOH 277 577 571 HOH HOH A . E 3 HOH 278 578 572 HOH HOH A . E 3 HOH 279 579 573 HOH HOH A . E 3 HOH 280 580 575 HOH HOH A . E 3 HOH 281 581 577 HOH HOH A . E 3 HOH 282 582 580 HOH HOH A . E 3 HOH 283 583 581 HOH HOH A . E 3 HOH 284 584 582 HOH HOH A . E 3 HOH 285 585 583 HOH HOH A . E 3 HOH 286 586 589 HOH HOH A . E 3 HOH 287 587 590 HOH HOH A . E 3 HOH 288 588 592 HOH HOH A . E 3 HOH 289 589 593 HOH HOH A . E 3 HOH 290 590 598 HOH HOH A . E 3 HOH 291 591 599 HOH HOH A . E 3 HOH 292 592 601 HOH HOH A . E 3 HOH 293 593 603 HOH HOH A . E 3 HOH 294 594 604 HOH HOH A . E 3 HOH 295 595 605 HOH HOH A . E 3 HOH 296 596 610 HOH HOH A . E 3 HOH 297 597 611 HOH HOH A . E 3 HOH 298 598 619 HOH HOH A . E 3 HOH 299 599 620 HOH HOH A . E 3 HOH 300 600 621 HOH HOH A . E 3 HOH 301 601 626 HOH HOH A . E 3 HOH 302 602 627 HOH HOH A . E 3 HOH 303 603 628 HOH HOH A . E 3 HOH 304 604 630 HOH HOH A . E 3 HOH 305 605 631 HOH HOH A . E 3 HOH 306 606 632 HOH HOH A . E 3 HOH 307 607 634 HOH HOH A . E 3 HOH 308 608 635 HOH HOH A . E 3 HOH 309 609 636 HOH HOH A . E 3 HOH 310 610 639 HOH HOH A . E 3 HOH 311 611 640 HOH HOH A . E 3 HOH 312 612 642 HOH HOH A . E 3 HOH 313 613 643 HOH HOH A . E 3 HOH 314 614 645 HOH HOH A . E 3 HOH 315 615 648 HOH HOH A . E 3 HOH 316 616 650 HOH HOH A . E 3 HOH 317 617 652 HOH HOH A . E 3 HOH 318 618 656 HOH HOH A . E 3 HOH 319 619 658 HOH HOH A . E 3 HOH 320 620 661 HOH HOH A . E 3 HOH 321 621 662 HOH HOH A . E 3 HOH 322 622 663 HOH HOH A . E 3 HOH 323 623 669 HOH HOH A . E 3 HOH 324 624 671 HOH HOH A . E 3 HOH 325 625 672 HOH HOH A . E 3 HOH 326 626 673 HOH HOH A . E 3 HOH 327 627 675 HOH HOH A . E 3 HOH 328 628 676 HOH HOH A . E 3 HOH 329 629 677 HOH HOH A . E 3 HOH 330 630 680 HOH HOH A . E 3 HOH 331 631 683 HOH HOH A . E 3 HOH 332 632 686 HOH HOH A . E 3 HOH 333 633 687 HOH HOH A . E 3 HOH 334 634 688 HOH HOH A . E 3 HOH 335 635 689 HOH HOH A . E 3 HOH 336 636 690 HOH HOH A . E 3 HOH 337 637 692 HOH HOH A . E 3 HOH 338 638 694 HOH HOH A . E 3 HOH 339 639 695 HOH HOH A . E 3 HOH 340 640 698 HOH HOH A . E 3 HOH 341 641 699 HOH HOH A . E 3 HOH 342 642 701 HOH HOH A . E 3 HOH 343 643 702 HOH HOH A . E 3 HOH 344 644 703 HOH HOH A . E 3 HOH 345 645 704 HOH HOH A . E 3 HOH 346 646 706 HOH HOH A . E 3 HOH 347 647 707 HOH HOH A . E 3 HOH 348 648 710 HOH HOH A . E 3 HOH 349 649 711 HOH HOH A . E 3 HOH 350 650 713 HOH HOH A . E 3 HOH 351 651 714 HOH HOH A . E 3 HOH 352 652 715 HOH HOH A . E 3 HOH 353 653 716 HOH HOH A . E 3 HOH 354 654 719 HOH HOH A . E 3 HOH 355 655 720 HOH HOH A . E 3 HOH 356 656 723 HOH HOH A . E 3 HOH 357 657 724 HOH HOH A . E 3 HOH 358 658 728 HOH HOH A . F 3 HOH 1 301 3 HOH HOH B . F 3 HOH 2 302 4 HOH HOH B . F 3 HOH 3 303 6 HOH HOH B . F 3 HOH 4 304 9 HOH HOH B . F 3 HOH 5 305 11 HOH HOH B . F 3 HOH 6 306 12 HOH HOH B . F 3 HOH 7 307 14 HOH HOH B . F 3 HOH 8 308 15 HOH HOH B . F 3 HOH 9 309 16 HOH HOH B . F 3 HOH 10 310 17 HOH HOH B . F 3 HOH 11 311 18 HOH HOH B . F 3 HOH 12 312 26 HOH HOH B . F 3 HOH 13 313 29 HOH HOH B . F 3 HOH 14 314 33 HOH HOH B . F 3 HOH 15 315 34 HOH HOH B . F 3 HOH 16 316 35 HOH HOH B . F 3 HOH 17 317 37 HOH HOH B . F 3 HOH 18 318 38 HOH HOH B . F 3 HOH 19 319 39 HOH HOH B . F 3 HOH 20 320 40 HOH HOH B . F 3 HOH 21 321 41 HOH HOH B . F 3 HOH 22 322 44 HOH HOH B . F 3 HOH 23 323 45 HOH HOH B . F 3 HOH 24 324 46 HOH HOH B . F 3 HOH 25 325 48 HOH HOH B . F 3 HOH 26 326 52 HOH HOH B . F 3 HOH 27 327 53 HOH HOH B . F 3 HOH 28 328 57 HOH HOH B . F 3 HOH 29 329 63 HOH HOH B . F 3 HOH 30 330 65 HOH HOH B . F 3 HOH 31 331 66 HOH HOH B . F 3 HOH 32 332 67 HOH HOH B . F 3 HOH 33 333 72 HOH HOH B . F 3 HOH 34 334 73 HOH HOH B . F 3 HOH 35 335 74 HOH HOH B . F 3 HOH 36 336 75 HOH HOH B . F 3 HOH 37 337 79 HOH HOH B . F 3 HOH 38 338 81 HOH HOH B . F 3 HOH 39 339 82 HOH HOH B . F 3 HOH 40 340 83 HOH HOH B . F 3 HOH 41 341 84 HOH HOH B . F 3 HOH 42 342 86 HOH HOH B . F 3 HOH 43 343 87 HOH HOH B . F 3 HOH 44 344 88 HOH HOH B . F 3 HOH 45 345 91 HOH HOH B . F 3 HOH 46 346 94 HOH HOH B . F 3 HOH 47 347 97 HOH HOH B . F 3 HOH 48 348 98 HOH HOH B . F 3 HOH 49 349 99 HOH HOH B . F 3 HOH 50 350 101 HOH HOH B . F 3 HOH 51 351 102 HOH HOH B . F 3 HOH 52 352 103 HOH HOH B . F 3 HOH 53 353 105 HOH HOH B . F 3 HOH 54 354 106 HOH HOH B . F 3 HOH 55 355 107 HOH HOH B . F 3 HOH 56 356 110 HOH HOH B . F 3 HOH 57 357 112 HOH HOH B . F 3 HOH 58 358 116 HOH HOH B . F 3 HOH 59 359 118 HOH HOH B . F 3 HOH 60 360 119 HOH HOH B . F 3 HOH 61 361 123 HOH HOH B . F 3 HOH 62 362 125 HOH HOH B . F 3 HOH 63 363 126 HOH HOH B . F 3 HOH 64 364 128 HOH HOH B . F 3 HOH 65 365 130 HOH HOH B . F 3 HOH 66 366 132 HOH HOH B . F 3 HOH 67 367 135 HOH HOH B . F 3 HOH 68 368 136 HOH HOH B . F 3 HOH 69 369 138 HOH HOH B . F 3 HOH 70 370 139 HOH HOH B . F 3 HOH 71 371 141 HOH HOH B . F 3 HOH 72 372 142 HOH HOH B . F 3 HOH 73 373 144 HOH HOH B . F 3 HOH 74 374 145 HOH HOH B . F 3 HOH 75 375 147 HOH HOH B . F 3 HOH 76 376 148 HOH HOH B . F 3 HOH 77 377 149 HOH HOH B . F 3 HOH 78 378 150 HOH HOH B . F 3 HOH 79 379 151 HOH HOH B . F 3 HOH 80 380 153 HOH HOH B . F 3 HOH 81 381 154 HOH HOH B . F 3 HOH 82 382 155 HOH HOH B . F 3 HOH 83 383 156 HOH HOH B . F 3 HOH 84 384 157 HOH HOH B . F 3 HOH 85 385 159 HOH HOH B . F 3 HOH 86 386 160 HOH HOH B . F 3 HOH 87 387 161 HOH HOH B . F 3 HOH 88 388 163 HOH HOH B . F 3 HOH 89 389 164 HOH HOH B . F 3 HOH 90 390 165 HOH HOH B . F 3 HOH 91 391 166 HOH HOH B . F 3 HOH 92 392 167 HOH HOH B . F 3 HOH 93 393 169 HOH HOH B . F 3 HOH 94 394 172 HOH HOH B . F 3 HOH 95 395 173 HOH HOH B . F 3 HOH 96 396 174 HOH HOH B . F 3 HOH 97 397 176 HOH HOH B . F 3 HOH 98 398 180 HOH HOH B . F 3 HOH 99 399 181 HOH HOH B . F 3 HOH 100 400 182 HOH HOH B . F 3 HOH 101 401 183 HOH HOH B . F 3 HOH 102 402 184 HOH HOH B . F 3 HOH 103 403 186 HOH HOH B . F 3 HOH 104 404 188 HOH HOH B . F 3 HOH 105 405 190 HOH HOH B . F 3 HOH 106 406 191 HOH HOH B . F 3 HOH 107 407 195 HOH HOH B . F 3 HOH 108 408 196 HOH HOH B . F 3 HOH 109 409 200 HOH HOH B . F 3 HOH 110 410 202 HOH HOH B . F 3 HOH 111 411 203 HOH HOH B . F 3 HOH 112 412 204 HOH HOH B . F 3 HOH 113 413 206 HOH HOH B . F 3 HOH 114 414 208 HOH HOH B . F 3 HOH 115 415 209 HOH HOH B . F 3 HOH 116 416 210 HOH HOH B . F 3 HOH 117 417 211 HOH HOH B . F 3 HOH 118 418 212 HOH HOH B . F 3 HOH 119 419 213 HOH HOH B . F 3 HOH 120 420 214 HOH HOH B . F 3 HOH 121 421 215 HOH HOH B . F 3 HOH 122 422 216 HOH HOH B . F 3 HOH 123 423 217 HOH HOH B . F 3 HOH 124 424 220 HOH HOH B . F 3 HOH 125 425 222 HOH HOH B . F 3 HOH 126 426 223 HOH HOH B . F 3 HOH 127 427 226 HOH HOH B . F 3 HOH 128 428 230 HOH HOH B . F 3 HOH 129 429 231 HOH HOH B . F 3 HOH 130 430 232 HOH HOH B . F 3 HOH 131 431 233 HOH HOH B . F 3 HOH 132 432 236 HOH HOH B . F 3 HOH 133 433 237 HOH HOH B . F 3 HOH 134 434 238 HOH HOH B . F 3 HOH 135 435 239 HOH HOH B . F 3 HOH 136 436 240 HOH HOH B . F 3 HOH 137 437 241 HOH HOH B . F 3 HOH 138 438 242 HOH HOH B . F 3 HOH 139 439 246 HOH HOH B . F 3 HOH 140 440 248 HOH HOH B . F 3 HOH 141 441 251 HOH HOH B . F 3 HOH 142 442 258 HOH HOH B . F 3 HOH 143 443 261 HOH HOH B . F 3 HOH 144 444 266 HOH HOH B . F 3 HOH 145 445 267 HOH HOH B . F 3 HOH 146 446 269 HOH HOH B . F 3 HOH 147 447 271 HOH HOH B . F 3 HOH 148 448 273 HOH HOH B . F 3 HOH 149 449 275 HOH HOH B . F 3 HOH 150 450 278 HOH HOH B . F 3 HOH 151 451 281 HOH HOH B . F 3 HOH 152 452 282 HOH HOH B . F 3 HOH 153 453 283 HOH HOH B . F 3 HOH 154 454 284 HOH HOH B . F 3 HOH 155 455 285 HOH HOH B . F 3 HOH 156 456 286 HOH HOH B . F 3 HOH 157 457 287 HOH HOH B . F 3 HOH 158 458 291 HOH HOH B . F 3 HOH 159 459 296 HOH HOH B . F 3 HOH 160 460 298 HOH HOH B . F 3 HOH 161 461 301 HOH HOH B . F 3 HOH 162 462 302 HOH HOH B . F 3 HOH 163 463 304 HOH HOH B . F 3 HOH 164 464 307 HOH HOH B . F 3 HOH 165 465 309 HOH HOH B . F 3 HOH 166 466 312 HOH HOH B . F 3 HOH 167 467 313 HOH HOH B . F 3 HOH 168 468 315 HOH HOH B . F 3 HOH 169 469 316 HOH HOH B . F 3 HOH 170 470 317 HOH HOH B . F 3 HOH 171 471 318 HOH HOH B . F 3 HOH 172 472 322 HOH HOH B . F 3 HOH 173 473 324 HOH HOH B . F 3 HOH 174 474 325 HOH HOH B . F 3 HOH 175 475 326 HOH HOH B . F 3 HOH 176 476 329 HOH HOH B . F 3 HOH 177 477 330 HOH HOH B . F 3 HOH 178 478 332 HOH HOH B . F 3 HOH 179 479 333 HOH HOH B . F 3 HOH 180 480 334 HOH HOH B . F 3 HOH 181 481 336 HOH HOH B . F 3 HOH 182 482 340 HOH HOH B . F 3 HOH 183 483 341 HOH HOH B . F 3 HOH 184 484 343 HOH HOH B . F 3 HOH 185 485 344 HOH HOH B . F 3 HOH 186 486 347 HOH HOH B . F 3 HOH 187 487 348 HOH HOH B . F 3 HOH 188 488 353 HOH HOH B . F 3 HOH 189 489 355 HOH HOH B . F 3 HOH 190 490 356 HOH HOH B . F 3 HOH 191 491 360 HOH HOH B . F 3 HOH 192 492 362 HOH HOH B . F 3 HOH 193 493 363 HOH HOH B . F 3 HOH 194 494 364 HOH HOH B . F 3 HOH 195 495 365 HOH HOH B . F 3 HOH 196 496 366 HOH HOH B . F 3 HOH 197 497 369 HOH HOH B . F 3 HOH 198 498 370 HOH HOH B . F 3 HOH 199 499 371 HOH HOH B . F 3 HOH 200 500 373 HOH HOH B . F 3 HOH 201 501 377 HOH HOH B . F 3 HOH 202 502 378 HOH HOH B . F 3 HOH 203 503 381 HOH HOH B . F 3 HOH 204 504 382 HOH HOH B . F 3 HOH 205 505 385 HOH HOH B . F 3 HOH 206 506 386 HOH HOH B . F 3 HOH 207 507 392 HOH HOH B . F 3 HOH 208 508 397 HOH HOH B . F 3 HOH 209 509 398 HOH HOH B . F 3 HOH 210 510 399 HOH HOH B . F 3 HOH 211 511 400 HOH HOH B . F 3 HOH 212 512 401 HOH HOH B . F 3 HOH 213 513 404 HOH HOH B . F 3 HOH 214 514 405 HOH HOH B . F 3 HOH 215 515 407 HOH HOH B . F 3 HOH 216 516 409 HOH HOH B . F 3 HOH 217 517 410 HOH HOH B . F 3 HOH 218 518 411 HOH HOH B . F 3 HOH 219 519 413 HOH HOH B . F 3 HOH 220 520 414 HOH HOH B . F 3 HOH 221 521 416 HOH HOH B . F 3 HOH 222 522 419 HOH HOH B . F 3 HOH 223 523 420 HOH HOH B . F 3 HOH 224 524 423 HOH HOH B . F 3 HOH 225 525 425 HOH HOH B . F 3 HOH 226 526 428 HOH HOH B . F 3 HOH 227 527 430 HOH HOH B . F 3 HOH 228 528 431 HOH HOH B . F 3 HOH 229 529 432 HOH HOH B . F 3 HOH 230 530 433 HOH HOH B . F 3 HOH 231 531 434 HOH HOH B . F 3 HOH 232 532 438 HOH HOH B . F 3 HOH 233 533 439 HOH HOH B . F 3 HOH 234 534 440 HOH HOH B . F 3 HOH 235 535 441 HOH HOH B . F 3 HOH 236 536 442 HOH HOH B . F 3 HOH 237 537 445 HOH HOH B . F 3 HOH 238 538 449 HOH HOH B . F 3 HOH 239 539 453 HOH HOH B . F 3 HOH 240 540 454 HOH HOH B . F 3 HOH 241 541 455 HOH HOH B . F 3 HOH 242 542 458 HOH HOH B . F 3 HOH 243 543 461 HOH HOH B . F 3 HOH 244 544 464 HOH HOH B . F 3 HOH 245 545 465 HOH HOH B . F 3 HOH 246 546 468 HOH HOH B . F 3 HOH 247 547 470 HOH HOH B . F 3 HOH 248 548 474 HOH HOH B . F 3 HOH 249 549 476 HOH HOH B . F 3 HOH 250 550 477 HOH HOH B . F 3 HOH 251 551 479 HOH HOH B . F 3 HOH 252 552 480 HOH HOH B . F 3 HOH 253 553 482 HOH HOH B . F 3 HOH 254 554 488 HOH HOH B . F 3 HOH 255 555 489 HOH HOH B . F 3 HOH 256 556 492 HOH HOH B . F 3 HOH 257 557 493 HOH HOH B . F 3 HOH 258 558 495 HOH HOH B . F 3 HOH 259 559 498 HOH HOH B . F 3 HOH 260 560 505 HOH HOH B . F 3 HOH 261 561 508 HOH HOH B . F 3 HOH 262 562 509 HOH HOH B . F 3 HOH 263 563 510 HOH HOH B . F 3 HOH 264 564 511 HOH HOH B . F 3 HOH 265 565 514 HOH HOH B . F 3 HOH 266 566 515 HOH HOH B . F 3 HOH 267 567 517 HOH HOH B . F 3 HOH 268 568 518 HOH HOH B . F 3 HOH 269 569 519 HOH HOH B . F 3 HOH 270 570 522 HOH HOH B . F 3 HOH 271 571 523 HOH HOH B . F 3 HOH 272 572 524 HOH HOH B . F 3 HOH 273 573 526 HOH HOH B . F 3 HOH 274 574 529 HOH HOH B . F 3 HOH 275 575 532 HOH HOH B . F 3 HOH 276 576 533 HOH HOH B . F 3 HOH 277 577 535 HOH HOH B . F 3 HOH 278 578 538 HOH HOH B . F 3 HOH 279 579 542 HOH HOH B . F 3 HOH 280 580 543 HOH HOH B . F 3 HOH 281 581 545 HOH HOH B . F 3 HOH 282 582 546 HOH HOH B . F 3 HOH 283 583 547 HOH HOH B . F 3 HOH 284 584 550 HOH HOH B . F 3 HOH 285 585 553 HOH HOH B . F 3 HOH 286 586 554 HOH HOH B . F 3 HOH 287 587 555 HOH HOH B . F 3 HOH 288 588 556 HOH HOH B . F 3 HOH 289 589 560 HOH HOH B . F 3 HOH 290 590 561 HOH HOH B . F 3 HOH 291 591 565 HOH HOH B . F 3 HOH 292 592 566 HOH HOH B . F 3 HOH 293 593 568 HOH HOH B . F 3 HOH 294 594 570 HOH HOH B . F 3 HOH 295 595 574 HOH HOH B . F 3 HOH 296 596 576 HOH HOH B . F 3 HOH 297 597 578 HOH HOH B . F 3 HOH 298 598 579 HOH HOH B . F 3 HOH 299 599 584 HOH HOH B . F 3 HOH 300 600 585 HOH HOH B . F 3 HOH 301 601 586 HOH HOH B . F 3 HOH 302 602 587 HOH HOH B . F 3 HOH 303 603 588 HOH HOH B . F 3 HOH 304 604 591 HOH HOH B . F 3 HOH 305 605 594 HOH HOH B . F 3 HOH 306 606 595 HOH HOH B . F 3 HOH 307 607 596 HOH HOH B . F 3 HOH 308 608 597 HOH HOH B . F 3 HOH 309 609 600 HOH HOH B . F 3 HOH 310 610 602 HOH HOH B . F 3 HOH 311 611 606 HOH HOH B . F 3 HOH 312 612 607 HOH HOH B . F 3 HOH 313 613 608 HOH HOH B . F 3 HOH 314 614 609 HOH HOH B . F 3 HOH 315 615 612 HOH HOH B . F 3 HOH 316 616 613 HOH HOH B . F 3 HOH 317 617 614 HOH HOH B . F 3 HOH 318 618 615 HOH HOH B . F 3 HOH 319 619 616 HOH HOH B . F 3 HOH 320 620 617 HOH HOH B . F 3 HOH 321 621 618 HOH HOH B . F 3 HOH 322 622 622 HOH HOH B . F 3 HOH 323 623 623 HOH HOH B . F 3 HOH 324 624 624 HOH HOH B . F 3 HOH 325 625 625 HOH HOH B . F 3 HOH 326 626 629 HOH HOH B . F 3 HOH 327 627 633 HOH HOH B . F 3 HOH 328 628 637 HOH HOH B . F 3 HOH 329 629 638 HOH HOH B . F 3 HOH 330 630 641 HOH HOH B . F 3 HOH 331 631 644 HOH HOH B . F 3 HOH 332 632 646 HOH HOH B . F 3 HOH 333 633 647 HOH HOH B . F 3 HOH 334 634 649 HOH HOH B . F 3 HOH 335 635 651 HOH HOH B . F 3 HOH 336 636 653 HOH HOH B . F 3 HOH 337 637 654 HOH HOH B . F 3 HOH 338 638 655 HOH HOH B . F 3 HOH 339 639 657 HOH HOH B . F 3 HOH 340 640 659 HOH HOH B . F 3 HOH 341 641 660 HOH HOH B . F 3 HOH 342 642 664 HOH HOH B . F 3 HOH 343 643 665 HOH HOH B . F 3 HOH 344 644 666 HOH HOH B . F 3 HOH 345 645 667 HOH HOH B . F 3 HOH 346 646 668 HOH HOH B . F 3 HOH 347 647 670 HOH HOH B . F 3 HOH 348 648 674 HOH HOH B . F 3 HOH 349 649 678 HOH HOH B . F 3 HOH 350 650 679 HOH HOH B . F 3 HOH 351 651 681 HOH HOH B . F 3 HOH 352 652 682 HOH HOH B . F 3 HOH 353 653 684 HOH HOH B . F 3 HOH 354 654 685 HOH HOH B . F 3 HOH 355 655 691 HOH HOH B . F 3 HOH 356 656 693 HOH HOH B . F 3 HOH 357 657 696 HOH HOH B . F 3 HOH 358 658 697 HOH HOH B . F 3 HOH 359 659 700 HOH HOH B . F 3 HOH 360 660 705 HOH HOH B . F 3 HOH 361 661 708 HOH HOH B . F 3 HOH 362 662 709 HOH HOH B . F 3 HOH 363 663 712 HOH HOH B . F 3 HOH 364 664 717 HOH HOH B . F 3 HOH 365 665 718 HOH HOH B . F 3 HOH 366 666 721 HOH HOH B . F 3 HOH 367 667 722 HOH HOH B . F 3 HOH 368 668 725 HOH HOH B . F 3 HOH 369 669 726 HOH HOH B . F 3 HOH 370 670 727 HOH HOH B . #